Xanthomonas campestris vesicatoria 85 10 uid58321

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|78045354|ref|YP_361604.1| disulfide isomerase/thiol-disulfide oxidase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MARLINAAVGIALLLTSAVVQNAQASEAPKPTLAERHLMASGVKVTHRFDSVSGLRAIVADNGADKRLFYVTPDGKSLIA
    GLVFDESGRNVTTEDMGRAGISASGNTTAVTQLQAQKLWQRVQGLKALKDGNRGADIYVFVDPT
    CQYCHRLMSMVRPYIA
    AGTLQVRWLPVAILSSRSPGLAEAMYKAPNVAQAIQSVSTNMLKPVPESEAIRLQLAQNLLAMRDTGQTGVPLVVYRVGQ
    RVVIKSGVPTDAELVALAGGAK

    >gi|78045446|ref|YP_361696.1| thiol:disulfide interchange protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MNRLALPLLLTLSLAACGDDSTPNASSGLDLAQAAVSKLAPHAKVTGVERAAVPGLLQVTVDGSQVIYISENGQHLLAGQ
    IIELASKDNLTERATSALHRKMLAELPPERKIVYAAEDPKHTVTVFTDVD
    CGYCRMLHEHIPDYNKAGISIEYVLYPRSG
    LQSPTYATSVSVWCAQDRKQALIAVSTGGELTPAQCTNPVAEDYALGQRLGVTATPAIFAEDGRQVGGLLPPAQLLAVLD
    GRAQRGPTQP

    >gi|78045636|ref|YP_361811.1| putative thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MGFVRQYATQAPERSAVEAQTGLQVLEFGTDWCGHCIAAQPLLQKLLGGYEAIDYRKIEDGKGRPLGRSFRVKLWPTIIL
    LRDGQELARAVRPQTREDLQDLLSLLDAA

    >gi|78045761|ref|YP_361936.1| putative rhodanese-like membrane protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MNFEELQAFVGRNPMLSLALVGLTIALIVTEVARLFRGYRALKPAELTRLINSENALVIDLSPTADFEKGHIAGSRNVAL
    AKFDPAGKLLANAKASPVVVV
    CRSGTTSAGAAKTLKKAGFEQVYWLEGGVAAWQMAELPLIKGR

    >gi|78045846|ref|YP_362021.1| organic hydroperoxide resistance protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MASPEKVLYTAHATATGGREGRAVSSDKALDAKLSTPRELGGAGGDGTNPEQLFAAGYAACFIGAMKAVAAQDKLKLPGE
    VSIDSSVGIGQIPGGFGIVVELRIAVPGMDKADLQALVDKAHQV
    CPYSNATRGNIDVTLTLA

    >gi|78046090|ref|YP_362265.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSTLVSLPTVAPAPDYQSIDRPLNFSVAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFDENRAEDDLAVATDG
    VTLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV

    >gi|78046123|ref|YP_362298.1| putative C-type cytochrome biogenesis protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MKSLSRWIARCALLAAPLLAAPLAVLAPAPAQAAVTEADLLPVDQAFALSATADSRDRIALHWKIAPGYYLYRHRISVKA
    GKGFAAGELALPEGESKHDEFFGQVQTYRKQLQATLAGKADPAVQTAVLQVQYQGCADAGVCYPPQRREIRLDLPAADAT
    GAQATAAPRENLGALVPRNAAAPRLFGAPGQTAGVDALPLPAEQAFNFEAIVGDGNSLLLRFTPAPGYYIYRDRTSLALE
    GANGVRTGLPRWPQGKAHRDEHFGDVVVYFDQAEVTLPLLRDHPDPAHVTLVATFQGCQTDGICYPPMTRRVALDVPAGT
    VSPQNQAQAAPLMISPLAAGQAPVEPAPAASTAVPVADASAGNPERTPPPHTDKGLLGMLVLALLGGLVLNLMPCVLPIL
    SLKVLGLAHSGESRSHARSHAIWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQQPWFVAALAYLMFAVGLSLSGVFT
    LGTNLGGIGQSLAARNGPLGDFFTGVLACVVASPCIAPFMGTALAYAFTAPALLAMLVFLVLGLGLALPFLLIGFVPSLA
    RRLPTPGAWMETLKQVLAFPMYLTAIWLLWVLGKQRGVDALALMLVGATLLALGLWCFERSRWKSHRLGMGLATTMLVLA
    LVPVVAVTRLSLPAATAAEGVVAFSPQLLDRLRADNRVVFVNMTADW
    CVTCKANEKNVLSSAEFRDALRRVDAVYMKGDW
    TNVDPAISTFLDQHQAVGVPLYVVYGPGAPPAILPTVLTGAITEDALLRAAR

    >gi|78046203|ref|YP_362378.1| putative thioredoxin reductase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MQHEVIIVGGSYAGLSAALQLARARRRVLLVDSGRRCNRFAETSHGLLGRDGASPARIADEARAQVLSYSSVQWADGEVV
    QVRGQAEAFEVVFADGSVHATRRLILAMGVVDRLPALAGLAERWGRQVFV
    CPYCHGYELQQGRIGVIATSALAAHQAAML
    PDWGPTWLFLNDTLVPDESQRAQLETRAVHVVTGAVAALQGEGDALELVLHDGQRFALDGVFITTQTEISPLVRQLGCAT
    SEGPFGRLLAVDAMQATTVPGVFACGDIVNPAASVVLAAASGAMAGVATHRSLIFGLGS

    >gi|78046334|ref|YP_362509.1| putative thiol:disulfide interchange protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MKTRFALTLMALLPILVACKAQDGSSDTAPAATTPAAETAPAPAAATPAADPAAPPAVGESATTPPPAAPSAAPRAPNGP
    EPVAGTDYLDIDAGQPYQQAAGKIEVAEVFGYV
    CPACNAFQPLIGPWKAGLPSDVHFVYVPAMFGGTWDDYGRAFYAAET
    LGVQEKTHEALYKAIHVDQTLKGERGKDSVQDIAAFYAKYGVDQKTFIDTMSSFGVSAKTNRAKQFATRSKITGTPSLII
    NGKYLIKGQSFPDMLRIADHLIARERATLAK

    >gi|78046335|ref|YP_362510.1| putative disulfide oxidoreductase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MKLLSRLPLLLMFLLPLVACAADKKAAPVEGEDYTLIDGGQPYAPLAGKVEVTEVFGYTCPHCAHFEPVLEAWVAKQPAY
    VRFTPVPAAFGGFWDAFARAYFAADILGVAKRSHRAMFDAIHEKQTVPTQNVAPEELAAFYAGYGIPQQRFIETYKSEAV
    EAKLKAAREFALRSKIPGTPAIIVNGRYLIGARNYPDMLRIADYLIAREHAAPAKR

    >gi|78046493|ref|YP_362668.1| methionine sulfoxide reductase A [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MLGIGAFKQRMPRPGEALPGREQALPLHNTHLVNGHPLRGEFIGLAQVQFGLGCFWGAERKFWNVPGVYTTAVGYAGGQT
    PNATYSEVCSGQTGHTEAVLVVFDEQAVSFAQLLRTFWESHDPTQGMQQGNDVGTQYRSAIYCTTQAQYDAALASRDAYQ
    QQLTAAGYGAITTEIRFPAPTFYYAEDDHQQYLAKHPNGYCGLGGTGVSCPIGLDA

    >gi|78046498|ref|YP_362673.1| Alkyl hydroperoxide reductase subunit F [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MLDANLKTQLTAYLERVTRPIQINASIDDSAGSREMLDLLEELVLLSDKISLDIHRDDNQRKPSFALTTPGQDISLRFAG
    LPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLEGDYQFETYFSLS
    CQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQ
    DEVEARQIMSVPTVYLNGELFDQGRMTLEQIVAKLDTNAAKRDAAKIAAKEAFDVLVVGGGPAGSAAAVYAARKGIRTGV
    AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADGLIEIKLANGASLKSKTVILS
    TGARWRQMNVPGEDQYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLR
    SLHNVRIITSAQTTEVLGDGQKVTGLVYKDRTGGDIQHIELEGVFVQIGLLPNTEFLRGTVALSPRGEIIVDDRGQTDVP
    GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRTSAPATADSVAQAA

    >gi|78046499|ref|YP_362674.1| Alkyl hydroperoxide reductase subunit C [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSLINTQVQPFKANAYHNGNFIEVTEASLKGKWSVLIFMPAAFTFNCPTEVEDAADNYAAFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAQFPLIGDPTHKLTRAFGVHIEEEGLALRGTFIINPEGVIKTLEIHDNSIARDVTETLRKLTAAQFVAN
    NPGQVCPAKWKEGAKTLAPSLDLVGKI

    >gi|78046525|ref|YP_362700.1| putative thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MTVRLVRSACALLLPLLLLSACKPASEATPAAGNGAAPAATPQAPAAPATPADPAAPPNSSVVQQTAQMPRLSLPTVTGE
    TYDLAAHRGKWVVVNFWATW
    CAPCLKEMPELSALHTMRDTVEVVGLAYEDITSADMQAFLKDHPVSYPIAILDPYQPPQD
    FATPRGLPMTYLIGPDGKVAKQFLGPVTARDIEAAVGITGKAG

    >gi|78046582|ref|YP_362757.1| disulfide bond formation protein B [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MNPFRWSFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFAALAMFFLLGALHGPRAAAGRKVYGVLSFIAA
    GVGMGIAARHVWVQIRPKDMMSS
    CGPPLSFLSETMGPFEVFRTVLTGTGDCGNIDWRFLGLSMPMWSMVWFVGLALWALY
    AGFKARRSSVHH

    >gi|78046630|ref|YP_362805.1| putative glutaredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSDLTPTTEFPVSQDHTDQDAASGPQITLYSSAICPYCVAAKNFLKSKGKTWTEVRIDLDPAERDRMIALAKRTSVPQIF
    VGDVHVGGYDDMMAMHRAGKLEPLLAGSAGGQA

    >gi|78046631|ref|YP_362806.1| carboxymuconolactone decarboxylase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSGPDDGSADRLREFTQFRQRMNQRILAEPNQVVRRFFALDTQTYQAGALDVKTKELLGLVASMVLRCDDCISYHVAQCK
    EAGVTREEFFETFSVGLVVGGSIVIPHLRRAVDFLDQLEGGAQAPAQHAHD

    >gi|78046726|ref|YP_362901.1| putative peroxiredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MLFAVPGAFTPTCSAKHLPGYVEHFEQFRKRGIEVLCTAVNDPFVMQAWGRSQLIPDGLHLLPDGNAELARALGLEIDAS
    GSGMGLRSRRYALYADDAVVKALFVEEPGEFKVSAADYVLQHLPD

    >gi|78046883|ref|YP_363058.1| putative thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MTDAPLLIACPSCAAMNRIAPTRLRDAPNCGSCHRPLFLGTPVALSAADFDKHAVRSALPLVVDFWAPWCGPCLSMAPKF
    AAAAAALEPQVRLAKVDTDLHPALGTRFGIRSIPTLLVIQGGQELGRHSGAVSSAQIVNWVRSVLSKR

    >gi|78046939|ref|YP_363114.1| hypothetical protein XCV1383 [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MLCKSQSHPTNESQLMRIDIWSDVVCPWCWIGKRRFQAALAALGAQAPALDIHYHAFQLDPDAGLEPTPLRAALASKFGG
    TARVEQILAQTQATAQAEGLPLDFGRGQVQVSTLRAHRLIWLASHEGDVDAVMEALFHAHFAEGQNVGAFDTLVRAGEAG
    GLTAARVQAMLESDEGTVEVQAQLAQAAALGIRAVPSFVIDGRALIQGAQPPESFAQALLQLAAESTPVGGPDACGPDGC
    VV

    >gi|78047044|ref|YP_363219.1| ArsC family protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MTTLYGLKNCDTCKKAAKWLDRVGVAYTFVDYRDHKPEPETLAAWAQQVGGFDVLINKSSTTWRQLPDNRKAAGSAAEWK
    LLLREYPQLIRRPLVITDEGALHQGFSDNGFKKLFGVG

    >gi|78047070|ref|YP_363245.1| glutathione peroxidase-like protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSDISTFAFTDLEGRTQSMRDYAGNVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVIGFPCDQFGHQEPGDAAQIRQ
    FCSLDYAVDFPLAAKIEVNGNGAHPLWQWLKHEQRGVLGSEAIKWNFTKFLVGRDGRVLERYAPTTKPEALAADIERALG
    A

    >gi|78047088|ref|YP_363263.1| glutathione transferase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSSVRPPLTVHGMSSSGNCYKVRLLLEQLGSRYHWVEVDSVAGQTRTPEYLAKNPNGKVPMVERDDGRVLTESNAILFWL
    AEGTPYLPTDAWQRAQALSWMFFEQYSHEPYVAVARFISLWTPRDAARRAELPQLRARGEQALAVMEQHLQQHTWFTGSD
    YGIADIALFAYTHCAEDGGFDLERLPAIGAWIQRVQGLPRFVPMPAAASVAA

    >gi|78047132|ref|YP_363307.1| dihydrolipoamide dehydrogenase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSEQEQFDVVVIGAGPAGYHAAIRAAQLGMKVACIDAALGKDGKPALGGTCLRVGCIPSKALLDSSRQFWNMGHLFGDHG
    ISFNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPYYGFGQLLPGNIVKVTQHEGGEIELKGTNVILAAGSESIEL
    PFAKFDGDTIVDNVGGLDFTAVPKRLAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALADAEVAKTALKEFKKQGLD
    IKLGAKVSKTEITGSGDAKQVVLSYTDAAGEQTLTVDKLLVAVGRKAATKNLLAEGTGVKVTDRGQIEVDGHCHTGVDGV
    WAIGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWVIYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAV
    AMGEPAGFVKVIADAETDRVLGMHLVGVGVSELVHEGVLTMEFNGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN


    >gi|78047148|ref|YP_363323.1| glutathione peroxidase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MLLNRLLALVLTGFFATSAFAAGTPVLDVEYRPLAGKTPINLNRTYGGKVVMVVNTASKCGFTPQYEGLEALNQRFGSRG
    FTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKVHVLGAQATPLYQRLTQATGVAPGWNFHKYLISRDGRVVAQ
    FPSKIKPDDPSVLAAIERELKAPAH

    >gi|78047184|ref|YP_363359.1| thiosulfate sulfurtransferase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSADPNWTTLVDAATLSAALQHPQLRLLDARAAPPTAPDPHAARKAYAQGHLPGAHYADLDHDLADLSRPAQGRHPLPHS
    EAFARRLGEWGIDPQSQVVVYDAGDGSMAAARAWWMLRLMGHRRVAVLDGGLAAWRAAGFAESTESPALRSGTAYPGHFD
    ATAVVDAEQIAQRLQQAPGWLLDARAGERFRGEVEPIDPVAGHVPGAVSRPLGLSLRDGRFKPAAELRAELSALLGAYRP
    EQAVVM
    CGSGVTACHLLLALEVAGLSGARVYASSWSGWLQDASRPVATGA

    >gi|78047216|ref|YP_363391.1| putative iron-sulfur cluster assembly accessory protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MAVSLTPAALERVQRFVQQTPGALGLRFGVTKTGCSGWGHVTDLAREARDDDAVFEQGGVRIFVDPASLPLVDGTCIDFG
    KHGLSETFTFSNPNATAECGCGESFTTADEHR

    >gi|78047267|ref|YP_363442.1| thiol:disulfide interchange protein (c-type cytochrome biogenesis protein CcmG) [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MNRLLPLLGFVLLAALFGVGILRTMQHNPRDVPSPLIGKPAPAFSLPRLDHPAQRVGRDQLLGKPYVLNVFGSWCAECVH
    EHPVLMAQASRLGVPLIGYNYKDVPADAIAWLARLGNPYAVVIADEAGQTAIDFGVYGAPETFLIDAQGVIRYKHIGVLT
    PDAINDELLPAIAALPKGTP

    >gi|78047338|ref|YP_363513.1| hypothetical protein XCV1782 [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MQGLIEQYGLALVFANVLALSLGLPVPALPTLVLVGASYALQGGGDAWLAGLAALAVSVAASLLGDLVWYLAGRRFGNRT
    LQSLCRLSLSRDSCMKQTERFFSRWGVRVLAVAKFVPGLSMVSVPMAGAMRVRPAAFLRYDAFGASLWALVGLGVGAVFA
    RQVQDVLALLSELGSGAIVVLAAFLAGYVGWRWWRRQSLLRSLEHARIAVEELVPLLDGEESLRPTVLDIRAPGYRQLQP
    YTIPGAVFADERQLAQILASVPRDRSVVIY
    CACPDEVSAAWLAARMRERGYRDVRPLLGGLDAWRDAGHPVTSLVPVTVV
    ADANAATATA

    >gi|78047344|ref|YP_363519.1| AhpC/TSA family peroxiredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MTDAVLELPAATFDLPLALSGGTHTTLRDHAGTWLVLYFYPKDSTPGCTTEGLDFNALLPQFKKAGAMVLGVSRDSVKSH
    DNFCAKQGFAFPLISDSDEALCRAFDVIKEKNMYGKQVLGIERSTFLLSPEGHVVQEWRKVKVAGHAEAVLAAVKAHAKQ


    >gi|78047611|ref|YP_363786.1| thioredoxin-disulfide reductase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSAFSASPAKHSRLLILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPGDPHGLMGPDLMSRMQAHAER
    FETEVIFDHIHTADLSQRPFRLIGDGAEYTCDALIIATGATAKYLGIPTEEAFKGRGVSA
    CATCDGFFYKDQDVVVVGGG
    NTAVEEALYLSNIARKVYLVHRRDTLRAEKIMQDKLFAKVAAGKIETVWHHAIDEVLGNDAGVTGVRVKSTIDGSTRDID
    AHGFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLNGAATETSVAGVFAAGDVADQHYRQAITSAGFGCMAALDAERYLDK
    SA

    >gi|78047630|ref|YP_363805.1| molybdopterin biosynthesis protein MoeB [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MRACHGQDCTSQLLRLRDNGRMSSHDISPADARARALQGALLVDIRQLHERASGQAEGALAIAQNSLETEPAAHLPEQTR
    AIVLI
    CQSGKRSAHTAAILRAHGYAHVASVAGGTSAWASAGLPLVRPTLPADEQDFLERYSRHLRLSQVGLEGQRRLARA
    RVLLIGAGGLGSPAAFYLAAAGVGHLRIADDDVVDRSNLQRQILHTEDSVGTAKVDSAAQRIAALNPRVDIEAVRTRVTA
    DNVEALLQDVDVVVDGADNFPARYLLNDACVKFGKPLVYGAVQQFEGQVSVFDAGRHRGHAPCYRCLFPEPPPPEFAPS
    C
    AEAGVLGVLPGVIGLLQATEAIKLLLGIGDGLTGRLLSFDALAMRFRDIRLSPDPHCPVCAPGAAFRGYADYAAFCGSAV
    G

    >gi|78047735|ref|YP_363910.1| putative NAD(FAD)-dependent oxidoreductase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSGMVIVGAGQAGLQTAESLRSGGYTGSIVLLGDEPCAPYHRPSLSKGFLLGEVSDTQLYIRAPGALNRKGIQWHASARV
    MRIEHATRTLHLDDGSTLGYTGLCLATGARARRLEVPGAGLGHVCMLRGMADTRALAAILPHTSRVVVIGGGFIGLEFAS
    IARRLGKQVVVLEAADRLMARVVSPQLADFFLRLHRDNGATIELGSNVSALSGNRGVVTAVHTADGRVFPADLVVVGIGV
    IPNGELAQQAGLACDRGALIVDACARSSSPGIVGAGDCTVRQRAGSGLLRLESVQNAIEQAKSAAASLLGEHRPYPALPW
    FWSEQYEVRLQMAGFAAGHTQAVVRGDLATSTFSLFYYVDGELCAVDSINRPQDHLAARKLLELGRSPTPQQAADPNFAL
    TSLIPA

    >gi|78047814|ref|YP_363989.1| hypothetical protein XCV2258 [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MAAGRHCRAPHRGQTHPRLIALGHNHRMNAQLTQELPEFPTWLNARPSTLQEHRGRALVLAFVNASSVWCAERLAELAHW
    QARSPGRLQVIVVQVPRFDSERLPQRSLKQLRGHGVSAPILLDKDWETWRRFGIESWPTLVLLDAYGRERQRLVGVTGDL
    DKALTALCEGQQPPSDADLHGVAEREPEPHLALRFPTGLAATEDRLYVADTGHHRVLECTHSGRVLRQFGHGNADFIDGG
    VGEAAFRRPQGLALERDQLYVADTGNHALRRINLRSGQVDTLCGTGRSGEPVEGPLASPGASALNYPQGLAIADNQVLIA
    MAGDNRIWSYHLGRAALTARAGTGALEIRDGSGHLAAFAQPAGLASVQQVAYVCDGLGSSIRTMQLRGDLVQTLVGGQGT
    WQFGDQDGPRSTARLQFPQAIALAADSPLLWIADTGNGRLRCLRLGGGELTTVALPRRLHGPAGLAVTAGAVWIAETDAH
    AILRYDLASGALSDVSIDE

    >gi|78047859|ref|YP_364034.1| dihydrolipoamide dehydrogenase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MQARKVDIAIIGAGTAGITAFHALKAAGKDVVLIDRGPLGTTCARVGCMPSKAALHAGMRWTTAKELPAGVTLSAQGPQA
    LWRHTRQTRDALAGAAAERTRKAVGENLIMAEARFVAPGTLEVGDQRIEAKAFIVATGSHPVVPKSLDGAASHILTTDTL
    FEQKELPQRLGILGLGAIGLELGLALSRLDVQVIGADQQDTIGGIQDPEVQDRALSRFGGEFPMWLGAPVEVTLAGDKVR
    MRTDKHEALVDRLLVVTGRQPNTEALNLQAAGILLDKAGRPNIDASTMQASDAPIFFAGDVQPDRPLMHEAADEGQMAAQ
    AALTRLRGEQWQGAPRRVPISILFTDPDVCAVGMSYQAAMKKDAVVGIAEGSGNGRSKILGAQDNLLRIYVEPGTGLLLG
    ASMLLTQGEHLAHLLAWAIQAKQTVNDLLTMPFYHPSIEEMLQSALKSASQQLNP

    >gi|78047862|ref|YP_364037.1| disulfide isomerase/thiol-disulfide oxidase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MFAKRSRISLFLAASLLLVTGCSQAETANQPPALKALEDQGLTVMQEFKVGGGLRAFAAVAGDRPVAIYITSDGNAIVGT
    RLNAKGEPIDEAALNNLAAKPLSDKEWAQLQSATSVRDGQANAPRIVYAFSDAN
    CPYCHRFWEAARPWVDAGKVQIRHIM
    VGIIREDSPAKAAAILGAADPSAALLENERKYSQGGITPAKSIPANVRKTLDDNQMLMLSMGFRGTPGIVVRGPDGVLKK
    YNGMPQGPQLAEVLGPR

    >gi|78047863|ref|YP_364038.1| putative thiol disulfide interchange protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MISVGPFSVQVVAVFAAVLLAWAVARMVAKRLPDSPYKAAGGMLMDAVFLGFVAARLGYIAQWWDEYAQSPMSMFFIGDQ
    GFTWWIGVAATLVFIWWRTRSTRALRRPVLVGVTAGLLAWFAAGGVLELLQRSAPPLPALALATLDEKPVVLNSYIGRPV
    VLNLWASW
    CPPCRREMPVFEQAQAQYPEIAFVMVNQGESAQQARAFLEAQGLQLKDVLLDPASQTMQAVASRGLPTTLFF
    NEHGRLVDTHLGELSMASLKNTVSRRFAQSQQIKTEKE

    >gi|78047864|ref|YP_364039.1| putative thiol:disulfide interchange protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MVGSAWANGLLPSWGSSERQFLDVAEVFKLDPAQQQGDSFLIAGHIADGYYVYRHAIKLVDARGHEISLTLPAGTAKHDE
    FFGDTEIYKGDALNLRFPVTAAGPLTLHWQGCAEAGICYPPQTVNLALPEVAAGTSTAGNGSTHESPTAAPASQGSVAGA
    TEIAEDQAAAQRLAALGPVWGTLLFFGFGLLLAFTPCSLPMIPIVSSMVVGSQAKPRRAFFLSLSYVVAMAGTYAVVGVA
    AGMAGANLQATLQSPWLLGAFAALFLVLASSLFGLFELQMPSALVNRVESAGRDRSGGSIPGAAALGFLSALLVGPCMTA
    PLAGALLYIGQTGSAVYGGMALFALGLGMGLPLLAIAVFGARVLPRPGAWMDRVRVAFGYVMVGMAVMMLTRFLPGTVGL
    VLWGAWVLSVAIGLIAWGQAVAAKHRLAWTLRSGAVFAGLWSVLMLVGAASGGESALQPLAHLRGGSTSAASAEAGVAFV
    QAKSVEDVDAHLAQAASRDQWTLIDFYADW
    CVSCHVIERNVFGDPAVASRLARMQVVRPDVTRNDATDQALLKRWGVMGP
    PTLILVGPDGKERRDLRVVGEIDARTFLDHLDKAGS

    >gi|78047867|ref|YP_364042.1| thioredoxin reductase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MTMATHHQLIILGSGPAGWTAAVYAARANLKPLVLTGLQMGGQLMTTTEVDNWPGDAHGLMGPDLMTRMQAHAERFETEV
    VFDHIHTADLSKRPFTLTGDSAQYTCDALIIATGATAKYLGIPSEEAFKGRGVSA
    CATCDGFFYKDQDVIVVGGGNTAVE
    EALYLSNIARKVYLVHRRDTLRAEKIMQDKLFAKVAAGKVETVWHHEVDEVLGNDMGVTGVRVKSTLDGSTRDIDAHGFF
    VAIGHSPNTELFKGQLAMNNGYLEIRSGLGGNATQTSVEGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDSAVVR

    >gi|78047869|ref|YP_364044.1| putative thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MLQELNNDNFDTTLGQVPGVYAVRFWAEWCGPCRVMSPIFKDVARDMQDRAHFGEVDIDQAPELAGRFGVQSIPTVVLFK
    DGQVIDRMTGAAPKPNVLRFINNHLD

    >gi|78047870|ref|YP_364045.1| ArsR family transcriptional regulator [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MNPPAHIDGSSRLDPLAEVAKTLGHPHRLALLEQIVRGERSVEKLAELTGITVANASQHLQHLKRAGCVQTRRDGKHMLY
    RLGPGPLASVVVALHDYVEFQHSRIREAIADSRQRPQEMESVSIDGLLDRMDEGAVVLLDIRGDEEFAQAHLPGAINIPL
    EQLADRIGELSRDTEVVAY
    CRGPYCVLSMQAVSILQAHGMQATPLAGGVPEWRAAGLALQGSTGPVS

    >gi|78047871|ref|YP_364046.1| putative thiol:disulfide interchange protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MKRRHFLIAAAMVPLAPLANSVSAQEAFKAGKDFLELDKPVPVDAPPGKVEVIEFFSYNCPHCAAFEPQLEIWTRQLPSI
    ASFRRVPVPFVGSDVEAKQRMYYALQALGKEDEFRPRIFRAIHQEHQRLFGDDAILAWADKQPGLDGKKFAEAYHSFSTM
    TRAKRATQTTSDFKVAGVPALGIAGRWYADGETAGSPERALQVTSFLIREASRA

    >gi|78047892|ref|YP_364067.1| copper-translocating P-type ATPase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSMPSISDSRAALAPISLPIEGMTCASCVGRVEAALTKVEGVDSVSVNLATEKAEIRLAGPVDRAALIQAVEKVGYEVPA
    SVVELAVEGMT
    CASCVGRVEKALKAVPGVAEAAVNLATERATVRGTASMDALVAAVQKAGYEARAVDNSAQADDEAAEKK
    DAERAGLKRDLILAAVLALPVFVLEMGSHLVPGVHHWIKSTIGIQQSWYLQFVLTALVLAFPGRRFYTKGFPALMRLGPD
    MNSLVAVGTAAAFGYSVVATFLPNLLPAGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLVKLQAKEAHVLRDG
    RAVDIPIQDVALGDMVEVRPGERVPVDGEVTDGRSFVDESMITGEPIPVEKTIGSTVVGGTVNQKGALTLRATAVGGQTM
    LAQIIRLVEQAQSSKLPIQAVVDKVTLWFVPAVMLAATLTFLAWLIFGPSPALTFALVNAVAVLIIACPCAMGLATPTSI
    MVGTGRGAEMGVLFRKGEALQLLRDAKVVAVDKTGTLTEGRPVLTDLEIAPGFDRRQVLMQVAAVESRSEHPIARAIVES
    ATEGGTTLPTMADFDSVTGMGVRATVDGVRVEVGADRFMRELGLDVGGFAGTAERLGNEGKSPLYAAIDGRLAAIIAVAD
    PIKSSTPAAIAALHQLGLKVAMITGDNARTAQAIARQLGIDEVVAEVLPEGKVEAVRRLKATHGQIAYVGDGINDAPALA
    EADVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIGNIRQNLFWAFAYNTALIPVAAGALYPAWGVLLSPVFA
    AAAMGMSSVFVLGNALRLRRFQPPLDTASAASH

    >gi|78047903|ref|YP_364078.1| hypothetical protein XCV2347 [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MPTCSCTSPTTEIDMTQIAPLTIDTADAATAATLKAVKAKLGMVPNLFATLAHAPAALNGYLGLSETLGTGRLNASQREI
    VALAAGQANRCQY
    CLSAHTLIGKGAGLSAEAIAAARTGQAANALDDAIAGFARALVEQRGVVSADAMANYRRAGLDDGLI
    LEVIANVALNTLTNYTNHIADPTVDFPVVAV

    >gi|78048000|ref|YP_364175.1| hypothetical protein XCV2444 [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MTLPHLAWYWPLIGGLMIGTASGAYLLLVGRIAGISGLLADALGLHAGGARSLSILFLAGLLTSAGVALALKPITLAPLS
    GTSMPVLIVAGVLVGYGTRLGAG
    CTSGHGVSGLARLSPRSIVATTVFMLLGMATVTAVRAVAGAGA

    >gi|78048084|ref|YP_364259.1| thiol:disulfide interchange protein (c-type cytochrome biogenesis protein CcmG) [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MVESRSPRLPTAVLVGAIVLLLALAALLVYAVVRSGQDDRDALPSALIGKPAPEFALPLLHDPAIVVHARELRGAPYIIN
    VWGSW
    CPACREEHPVLSRFALTKRVRVIGYNWKDERNDALRWLEQLGNPYLLVVADQDGRTAIDFGIAAAPETFLVDGRG
    VVRWKYSGMLTQSIIDTQLIPALSKIERSPTAAPDLHAKQ

    >gi|78048187|ref|YP_364362.1| stringent starvation protein A [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MATSVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTYDLVPVDPQNPPEDLIDLNPYHSVPTLVERDLVLYAASVVSEYLD
    ERYPHPPLMPVDPLSRARLRLAMLRIEHDWVPQVQAIQLGNKTQAEAGRKRLKELLTASVPLFKASKFFLNPEMSLADCA
    MAPIIWRLDALEISLPKDGKAIEDYGNRIFRNPGFIRSLTDQEKKLRDLPG

    >gi|78048382|ref|YP_364557.1| glutaredoxin-related protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MPVMERIQAEVEQHPIVLFMKGTPQFPMCEFSSRAVQALVAAGADQLRTVNVLEEPEVRANLPRYSNWPTFPQLFIHGEL
    IGGCDITLELFEAGELKRIVSEAYQP

    >gi|78048459|ref|YP_364634.1| putative glutathione reductase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSARYDYDVVILGGGSGGLAAGFRAAKHGARVAIMEPDELGGTCVNLGCVPKKAMWLAADLAGKIELASVLGFDVPRPTL
    AWQELVTHRQGYISNIHASYRRRLNEDGVVLIPQRGVLQDRHTVMGSDGVPVTAEHIVIATGAHPLRPDVEGAEHGEVSD
    DFFNL
    CHAPEQVAIVGGGYIAVEIAGLLQALGSRVHLFVQDERLLERFDAELTLQLADNLRHLGVRLHFGFTTTALERDL
    HGALRVHGHCVHPREQGNDVFDKVFFAVGRRANTAGLGLDTVGVALGDKGEVVVDDGQTTNVPNIHAIGDVGGKVGLTPV
    AIAAGRKLMDRLFGHQPDARMDYENVPSVVFSHPPLGNVGLTEEQARARYNGAVRVYRSNFRPMLHALADAPQRSLFKLV
    CVGEEERVVGVHLLGESADEMLQGFAVAVKMGATKRDFEETVAIHPTSSEEIVLMH

    >gi|78048496|ref|YP_364671.1| thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSDKPHVFDATTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQIAAAFQIRSV
    PTVFLVKGGEIVDGFPGAMPEGQVREFLTQHGVLPAEPQVAEDVPPAPLDPQAQAAALREAVAAEPDKDELKLDLALALL
    KTGDTAEAEQLIDALPANLATDDRAVCAKARLSFANVLKDAPDAGTPQAAVDANSADLRARHLLGVRHLLDGNDEAALEQ
    FLEMLRQDRSFDDNLPRRSLIDAFRVIQDEDLVGRYRRKMSALVF

    >gi|78048540|ref|YP_364715.1| 6-O-methylguanine-DNA methyltransferase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSTLHYDTFPSPIGALSVAADATGVHHILFAQNRYDAIGRARWLHDPDAPLVREAREQLLDYLHGGRRSFDLPLAPVGTP
    FQLTVWRTLAQIPFGQTWSYAQLAQAVGKPAASRAVGAANGRNPLPIVLP
    CHRVIGANGTLTGFGGGLPTKQALLQLEGW
    SPRGAARADDLFAPASAVRTG

    >gi|78048590|ref|YP_364765.1| putative OsmC-like protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSDRPVSVRTGTVPYTVSIHDGLHTWSGDTQPANGGSDAGPDPESQVLGALGACTAITVSMVAARKHWPLTAVHVHLHYT
    QRGAAGTAIARAVVLDGALDDEQRARLMEVADKCPIHRLLTGEVRIETQLQAAGGGGDTAIRSD

    >gi|78048616|ref|YP_364791.1| OsmC-like protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MGISRHATAHWEGDLKTGKGQLSTPQSGLMDNTRYAFSSRFGDEKGTNPEELIAAAHAGCFTMALSAQLTEAGFPPASLD
    TRADVDLSMEGGPQLSQIRLKLKAVVPGIDEAKFRELADAAKKN
    CPVSKALSAVPISLETEFSS

    >gi|78049182|ref|YP_365357.1| glutaredoxin-like protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSLDPALRSRIDTLLQSSRVVLFMKGQPGMPQCGFSAKAVGVLDGLGIDYAHVNVLADQEIREGIKAYGDWPTIPQLYVD
    GELIGGSDIIVQMADSGELSSMLGLQAPDRSPPKITITPAAVEMLKSALADAPDASLTLAIDANFQPNFQLAPTNPNAIA
    AESNGLRVQFDLASARRADGITIDWVDDIRGRGLAIDNPNAPKPVQELSVRDADDRLKAGSLTLVDVRPADERALATVAA
    PFRTLDAHERAAIEQLPKDTPLAFL
    CHRGGRSLQAAEHFRGLGFTNVYNVTGGIDAWSDEVDNGVAKY

    >gi|78049193|ref|YP_365368.1| arsenate reductase (glutaredoxin) [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MHAVIYHNPGCGTSRNTLALIRHTGIEPQIVDYLQHPPSRQTLQALIAAAGITVRQAMRQKGTPYLELGLDDPTLDDAAL
    LSAMLAHPILINRPFVQTTRGTRLCRPSELVLDLLPPATHGFIKEDGERVLDEAGQRIGR

    >gi|78049231|ref|YP_365406.1| protein disulfide isomerase precursor [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MYRLAIAALLGAISLTACAQSSQPAASTAGAKPAAAPAATGTVDQRVSTALKALDPDFKPDYIGAAPFPGFREVVVGGQV
    LYLSDDGRYLIQAQPFDIQNKQFAASPGLLAYRRKQLDTVPKADRIVFAPANPKYTVTVFTDVE
    CGYCRKLHSEIGELNK
    QGIAVEYLAFPRMGLGSQDHKEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYNLGQRLGVNGTPAIFAPDGTQL
    GGYLPPAQLREALEKRAVSTAGGSR

    >gi|78049333|ref|YP_365508.1| dihydrolipoamide dehydrogenase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MAVIEIKVPDIGDYSDVPVIEVLVAVGDSVAKDQGLVTLESDKATLEVPSSAAGVVKELKVKVGDTLSEGALVLLLETEG
    EAAAPAKAEPKAAPAAAAPAAAPGSKPPVTPSHRAPAEPAAPKPALASGKPADIECKMVVLGAGPGGYTAAFRAADLGLE
    TVLIERYASLGGV
    CLNVGCIPSKALLHAAAVIDEVAHAGDFGVDFGQPKIALDKLREYKEKVVGKLTGGLASMAKQRKVR
    TVTGVASFVSPNELEIVGDDGKTQLLRFEHCIIAAGSQAVKLPNFPWDDKRVMDSTDALELHDIPKTLLVVGGGIIGLEM
    ATVYSALGSKVTVVEFMDQLMPGADKDLVKPLADRLKKQGVEVHLKTKATDVKADKAGITVSFEAAVEGEKPGLQATTYD
    RVLVAVGRSPNGKKIGAEKAGVTVTERGFIPVDRQMRTNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAGEKKEWVAR
    VIPSVAYTNPEIAWVGVTETEAKAKGLKVGVAKFPWAASGRAIGIGRTEGFTKLIFDEQTHRVIGGAIVGVHAGDLLAEI
    GLAIEMGAEAEDIGHTIHAHPTLSESVGMAAEVYDGTITDLYIPKKK

    >gi|78049368|ref|YP_365543.1| methionine sulfoxide reductase B [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSQFDLTPPSPAQRDALIAGLSDEEQRVLLHHGTEAPFCGVFLDNKLDGVYTCRLCGLPLFRSSAKFESGTGWPSFFAPY
    DPAHVREIRDTSYGMIRTEIVCARCDSHLGHVFPDGPPPTGERH
    CLNSVSLGFTENGQALPNPLQRQGAEAQPA

    >gi|78049511|ref|YP_365686.1| thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQNRALAIKYHVRSIPMLL
    LFKDGQVQATQIGAVGKGQLTQMIDKTLGGAAA

    >gi|78049552|ref|YP_365727.1| putative disulphide-isomerase precursor [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MTLSLPRPSPSLIALLAVLAALTACDKPAPPAAPAPPKTASTPAPVAGIAWREGDVEDAFAEAKDSGKPILLYWGAAWCP
    PCNRLKATLFKDPAFIARTQQFVAVHLDGDSEGAQAWGERFGVKAYPTIIVLRPDRREITRLAGNADNARLAEVLRVAAK
    STSTAQQLLDKALHTPQQLSADDWAVLGNYAWGTDDTLVKPDAAADVLTRLSTSAPQPALQRSFALAAISAARHPPAASS
    ANRTLLEAVLADPAEVRANLGTLNYVPARLVTAASNEAGERSTLSNALNQALDKVYADPSLPISDRLGTAYARIQLARLA
    QGQPTETEAEGPQPPLPKDVVEVVHQRVQWATDTAKTDEERQSTISMAAALLSEVGDRSAAEQLLLAELSRSKTPYYYMP
    ELADLAEQRGDKKTALLWLKRAYDSAQGPATRVQWGVMYVDGLIRLSPDDSAGIEGAATQVIGELAGQPDGYRQRTRQRF
    ATLGTALKTWSKQHRREGSAVLARLQQKMQSSCDSKATSECASWLS

    >gi|78049714|ref|YP_365889.1| putative thioredoxin [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MRRSSLPGPIKSWPNANTIDTMQTITVTSPEHYIAALAEHPRALVDFYKDDCPGCRMLDMSLERFAKSDAAGGLALLKVK
    LEVLGHDFFRELGLRQTPTLALYRDGSEVARLPGFQSPAQVEAAVRSGL

    >gi|78049835|ref|YP_366010.1| putative secreted protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MARRFPWLWMGLLVACALIAVLAWQNRQLRVQQHWLQTRISTPYDGMYVPRIEATDGDGRRHLLGAPHGPAQVLFFFTTT
    CPYCQRSAPTVLRAARQLQANLPGRPQLLGVCHCDAAQAARYAHVHGFDFPVVTLTDRRALMLFRARNVPLLMAIDGEGR
    VRHSHLGVFDTTERVQDLVAALRRTDAPAAFATVKE

    >gi|78050013|ref|YP_366188.1| glutathione peroxidase [Xanthomonas campestris pv. vesicatoria str. 85-10]
    MSQTLYDIPVTRIDGQPTTLADYRGKVLLVVNVASKCGLTPQYEGLEALYRDKRMQGLEVLGFPANDFNAQEPGSEAEIA
    QFCQLTYDVTFPMFAKIAVTGDQAHPLYRALTSTHPHTTGDGPMREKLAGYGIAPNPAPGVVWNFEKFLIGRDGKIVDRF
    APDIPADDARLRAAVDAALATHA