Xanthomonas campestris B100

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|188989486|ref|YP_001901496.1| putative thioredoxin [Xanthomonas campestris pv. campestris str. B100]
    MAFVREYAAQAPDRSAVDAQPGLQVLEFGTDWCGHCMAAQPLLQKLLGGYADIEYRKIEDGKGRPLGRSFRVKLWPTIIL
    LRDGEEVARAVRPQTREDLQAVLSALEAVG

    >gi|188989619|ref|YP_001901629.1| membrane-anchored phosphatase / sulfurtransferase family enzyme [Xanthomonas campestris pv. campestris str. B100]
    MNFEELQAFVGRNPMLSLALVGLTIAIIVTEIARLFRGYRALKPAELTRLINSENALVIDLSPTADFEKGHIAGSRNVAL
    AKFDPAGKLLANAKSSPVVVV
    CRSGNASAGAAKTLKKAGFEQVYWLEGGIAAWQMAELPLVKGRA

    >gi|188989682|ref|YP_001901692.1| organic hydroperoxide resistance protein [Xanthomonas campestris pv. campestris str. B100]
    MASPEKVLYTAHATATGGREGRAVSSDSALDVKLSTPRELGGAGGDGTNPEQLFAAGYSACFIGAMKAVAAQDKLKLPGE
    ISIDGSVGIGQIPGGFGIAVELKIAVPGMEPAELQALVDKAHQV
    CPYSNATRGNIDVTLTLA

    >gi|188989912|ref|YP_001901922.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas campestris pv. campestris str. B100]
    MSTLVSLPTAAPAPDYQSIDRPLNFSNAAAAKVRELIQEEGNAELALRVYIQGGGCSGFQYGFEFDENRAEDDLAVATDG
    VTLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV

    >gi|188989945|ref|YP_001901955.1| hypothetical protein xccb100_0549 [Xanthomonas campestris pv. campestris str. B100]
    MKSLSRWIARCAVLVAPLFVALPLLLTAPAAQAVTEADLLPVDQAFALSAKADGRDRIALTWKIAPGYYLYRHRISVKSG
    QGFTAGALDLPEGESKHDEFFGQVQTYRTALQASLAGKAAPGQRSAILQVQYQGCADAGVCYPPQRRELRVDLPDAPTTA
    PPRESLGALVPRGPSGARLFGAPGQTAGVDALPLPADQAFNFEAIVGDGNSLLLRFTPAPGYYLYRDRTSLSLEGTSDIR
    TGLPRWPQGRTHRDEHFGDVVVYFDQAEVTLPLLRDRPDPARVTLVATFQGCQSDGICYPPMTRRVRLDLPAGTVSPHNQ
    ATATPLLISPLSAGEVAAERAAPPAPADAAPGPDATAGNPERSRPPHLERNLLAILLLALAGGLVLNLMPCVLPILSLKV
    LGLAHSGESRNHARSHAIWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQQPWFVAALAYLMFAVGLSLSGVFTLGSN
    LGGIGQSLAARNGPLGDFFTGVLACVVASPCIAPFMGTALAYAFTAPAPLAMLVFLTLGLGLALPFLLIGFIPSLARRLP
    TPGAWMETLKQVLAFPMYLTAIWLLWVLGKQRGVDALALMLVGATLLALGLWWFERSRWNSHRLGMGLAAAMLVLAIVPV
    VAVTRLSLPRATATEGSVTYTPELLDRLRADNRVVFVNMTADW
    CVTCKANEKNVLSSTDFRDALRRVDAVYMKGDWTNVD
    PKISAFLDQHQAVGVPLYVVYGPGAPPAVLPTVLTGAITEDALLRAAR

    >gi|188990046|ref|YP_001902056.1| thioredoxin-disulfide reductase [Xanthomonas campestris pv. campestris str. B100]
    MHYDVIIIGGSYAGLSAGLQLARARRRILVLDSGLRRNRFAATSHGFLSRDGESPAQIAAHGRTQLRAYPDVHWADAEVT
    QVDGTAEAFRVTLGNGGAHTARRLIIATGMVDRLADIPGLAERWGKQIFV
    CPYCHGYELEQGQIGVLATSAFAVHQAAML
    PDWGATRLFLNDALALDATQNAQLQARGVTLVPGAVARIQGDDAHVEVVLRDGQTTQLDGLFITTQTHISPVVTAMGCAL
    ADGPLGSHVAVDAMQATSVPGVFACGDIASPAASVTFAVASGAMAGVAAHRSLIFGLPA

    >gi|188990192|ref|YP_001902202.1| exported thiol:disulfide interchange protein [Xanthomonas campestris pv. campestris str. B100]
    MKTRFALTLMALLPILVACKAQDGSSDTAPAPAPAAETATAPAATPATDAAAPPAVGESANAPATDTAAAPPAPAPRAPN
    GPEPVAGTDYLDIEGGQPYQQAAGKIEVAEVFGYV
    CPACNAFQPLIGPWKAGLPSDVHFVYVPAMFGGPWDDYARAFYAA
    ETLGVQEKTHDALYKAIHVDQSLKGERGKDSVQDIAGFYAKYGVDSKTFIDTMSSFGVSAKTNRAKQFATRSKITGTPSL
    IVNGKYLVKGQSFPDMLRIADHLIARERATLAK

    >gi|188990193|ref|YP_001902203.1| exported thiol:disulfide interchange protein [Xanthomonas campestris pv. campestris str. B100]
    MNLFSRLSLLLLILLPLAACAADKKAPPVEGEDYVLIDGGQPYAPLAGKVEVAEVFGYTCPHCAHFEPTLEAWTAKQPAY
    VRVTPVPAAFGGFWDAFARAYFAADTLGVAKRSHRAMFDAIHEKHTVPTQNVAPEELAAFYVAYGVPQQRFIDTLKSAAV
    EDKVKAAREFATRAKIPGTPALVVNGRYLITARDYTDMLRVADYLIAREHAAPAAR

    >gi|188990224|ref|YP_001902234.1| hypothetical protein xccb100_0829 [Xanthomonas campestris pv. campestris str. B100]
    MSLDPALRSRIDTLLQSNRVVLFMKGQPGMPQCGFSAKAIGVLDGLGIDYAHVNVLADQEIREGIKAYGDWPTIPQLYVD
    GELIGGSDIIVQMADSGELSSMLGLQAPDRSPPKITITPAAVEMLKGALADAPDASLTLAIDANFQPNFQLAPTNPNAIA
    AESNGLRVQFDLASARRADGITIDWVDDIRGRGLAIDNPNAPKPVQELAVRDADDRLKAGTLTVVDVRPADERALATVAA
    PFRTLDAHERLEIEQLPKDTPLAFL
    CHRGGRSLQAAEHFRGLGFTNVYNVTGGIDAWSDAVDNGVPKY

    >gi|188990812|ref|YP_001902822.1| OsmC-like protein [Xanthomonas campestris pv. campestris str. B100]
    MGISRHATAHWEGDLKTGKGQLSTPQSGLMENTRYAFSSRFGDEKGTNPEELIAAAHAGCFTMALSAQLTEAGFPPTSLD
    TRADVDLSMEGGPQLSQIRLKLKAVVPGIDEAEFRELADTAKKN
    CPVSKALSAVPISLETEFSS

    >gi|188990844|ref|YP_001902854.1| Putative OsmC-like protein [Xanthomonas campestris pv. campestris str. B100]
    MSDRAVSVVTGAVPYTVTVHDGQHRWIGDTQPANGGQDAGPDPEAQVLGALGACTAITVSMVAARKQWPLAAVHVHLHYT
    QRGAAGTSITRAIVLDGALDDDQRARLLEVAEKCPIHRLLTGEVRIATELQPHALVDAAGGSTR

    >gi|188990904|ref|YP_001902914.1| 6-O-methylguanine-DNA methyltransferase [Xanthomonas campestris pv. campestris str. B100]
    MSTLHYDTFPSPIGALTVAADTTGVRHILFAQNRHDAPGRALWQHGPDAPLVQAAREQLLDYLYGGRRSFDLPLAPAGTP
    FQLQVWQTLARIPFGETWSYAQLAQAVGRPAASRAVGAANGRNPLPIVLP
    CHRVIGASGALTGFGGGLPTKQALLQLEGW
    SPQASARRVAAVVGEDLFAR

    >gi|188990935|ref|YP_001902945.1| thioredoxin [Xanthomonas campestris pv. campestris str. B100]
    MSDKAHVFDVTTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAADYNGAFELAKVDVDKEQQIAAAFQIRSV
    PTVFLVKGGELVDGFPGAMPEGQIREFLTQHGVLPAEPQVAEEVPLAPLDPQAQVAALREAIAAEPDKDELKLDLALALL
    KTGDTLEAEQLIDALPANLATDDRAVRAKARLGFANVLKDAPDAAALQTTVAADGSDLHARHLLGVRHLLDGDDEAALEQ
    FLEMLRQNRGFEDNLPRRSLIDAFRVIEDEDLVGRYRRKMSALLF

    >gi|188990978|ref|YP_001902988.1| Putative glutathione reductase [Xanthomonas campestris pv. campestris str. B100]
    MSARYDYDVVVLGGGSGGLAAAFRAAKHGARVAIMEPGELGGTCVNLGCVPKKAMWLAADLASKIELAGALGFDVVRPTL
    TWQELVTHRQGYIGNIHASYRRRLDDDGVVLIPQRGVLQDRHTLMGADGVPVTAEHIVIATGAHPLRPHVEGAEHGHVSD
    DFFNLCHAPDHVAIVGGGYIAVEIAGLLQALGSRVHLFVQGERLLERFDAELTLQLADNLRHLGVRLHFGFRTTGVQRDD
    TGKLRMRGHSAHPGELGNDVFDQVFFAIGRRANTAGLGLEALGVELGKKGEIVVDDGQTTNVPNIHAVGDVDGKVGLTPV
    AIAAGRKLMDRLFGGQPDARMDYDNVPSVVFSHPPLGAVGLTEEQARERYDGAVRVYRSNFRPMLHALADAPQRSVFKLV
    CVGEEERVVGVHLLGESADEMLQGFAVAVKMGATKRDFDETVAIHPTSSEEIVLMH

    >gi|188991057|ref|YP_001903067.1| hypothetical protein xccb100_1661 [Xanthomonas campestris pv. campestris str. B100]
    MPVMERIQAEVEQHPIVLFMKGTPQFPMCGFSSRAVQALVAAGADQLRTVNVLEEPEIRANLPRYSNWPTFPQLFIHGEL
    IGGCDITMELFEAGELKRIVSEAYQP

    >gi|188991246|ref|YP_001903256.1| Stringent starvation protein A [Xanthomonas campestris pv. campestris str. B100]
    MATSVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTYDLVSVDPQNPPEDLIDLNPYHSVPTLVERDLVLYAASVVSEYLD
    ERYPHPPLMPVDPLSRARLRLAMLRIEHDWVPQVQAIQLGNKTQAEAGRKRLKELLTASVPLFKASKFFLNPEMSLADCA
    MAPIIWRLDALEISLPKDSKAIEDYGNRIFRNPGFIRSLTDQEKKLRDMPG

    >gi|188991289|ref|YP_001903299.1| hypothetical protein xccb100_1894 [Xanthomonas campestris pv. campestris str. B100]
    MTHLQFDNRLRAQLPGDPEQGPRRREVLAAWSAVRPTPVAAPTLLAYSADVAQRLGLRAEDLASPQFAEVFGGNALYPGM
    QPWAVNYGGHQFGHWAGQLGDGRAISLGEAIGVDGGRYELQLKGAGPTPYSRGADGRAVLRSSIREFLCSEAMHYLGVPT
    TRALSLVGTGDAVVRDMFYDGHPRREPGAIVCRVAPSFIRFGNFELPAARGDVDLLRQWVDFTLARDFPDLPGSGEDRIA
    AWFGQVCERTAVMVAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWVDDYDPDWTPNTTDAQGRRYRFGTQPQVAYWNLG
    RLAQALSPLFGDAASLQAGLDQFRDTYLACDRRDTAAKLGLAECQDEDLHLIDDLRALMREAEMDMTLTFRGLVDLSPQQ
    PDASVLREAFYDETKRAAQAPALGAWLQRYAARCLQDGASDAVRASRMRAANPRYVLRNYLAQQAIDQAEQGDLSGVHAL
    LEVMQRPYDDQPRRESFAAKRPDWARDRAG
    CSMLSCSS

    >gi|188991350|ref|YP_001903360.1| Thiol:disulfide interchange protein (c-type cytochrome biogenesis protein CcmG) [Xanthomonas campestris pv. campestris str. B100]
    MSDPRTSRLPTAVLVGAGILLLALAALLVYAVVRSGNDDRDALPSALIGKPAPEFALPLLHDPSIIVHARELRGAPYIIN
    VWGSW
    CPACREEHPVLSRFALTKRVRVIGYNWKDERADALRWLEQLGNPYLLVVADTDGRTAIDFGIAAAPETFLVDGRG
    VVRWKYSGMLTQSIIDTQLIPALTRIERSPSAAPDLHTAR

    >gi|188991459|ref|YP_001903469.1| hypothetical protein xccb100_2064 [Xanthomonas campestris pv. campestris str. B100]
    MTGLGHNHCMTAQLTQELPEFPTWLNARPSTLQEHRGRALVLAFVNASSVWCAERLAELAHWQARSPGRLQVIVVQVPRF
    DSERMPQRSLKQLRGHGVSAPILLDKDWETWRRFGIESWPTLVLLDAYGRERQRLVGVTGDLDKALAALCEGQPPPSDAD
    LHGVAERDPEPRLALRFPTGLAATEDRLYIADTGHHRILECTHSGRVLRQFGHGNADLIDGGVGEAAFRRPQGLALEREE
    LYVADTGNHALRRINLRSGQVDTLCGTGRSGEPIEGPLASAGASPLNYPQGLAVADNQLLIAMAGDNRIWSYHLGRAALS
    ARAGTGSLEIRDGSGHLAAFAQPAGLAAVQQVAYVCDGLGSSIRTMQLRGDLVQTLVGGQGTWQFGEDDGPRSTARLQFP
    QAIALAADSPMLWVADTGNGRLRCLRLGGGELTTVALPRRLHGPAGLAVAGGAVWIAETDAHAVLRYDLATGALSDVSID
    E

    >gi|188991664|ref|YP_001903674.1| Thioredoxin-disulfide reductase [Xanthomonas campestris pv. campestris str. B100]
    MSASSASPAKHSRLLILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPGDPHGLMGPDLMSRMQAHAER
    FDTEVIFDHIHTADLSQRPFRLIGDSAEYTCDALIIATGATAKYLGIPTEEAFKGRGVSA
    CATCDGFFYKDQDVVVVGGG
    NTAVEEALYLSNIARKVYLVHRRDTLRAEKIMQDKLFAKVAAGKIETVWHHAIEEVLGNDAGVTGVRVKSTLDGSTRDID
    AHGFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLNGAATETSVAGVFAAGDVADQHYRQAITSAGFGCMAALDAERYLDK
    SA

    >gi|188991683|ref|YP_001903693.1| molybdopterin biosynthesis protein MoeB [Xanthomonas campestris pv. campestris str. B100]
    MSHDLSPAQARARALRGALLIDIRQPHERVSGQAEGALAIAQADLEQAPAQHLPDRDCDILLICQSGKRSAQTAAQLREQ
    GYPHALSVLGGTTAWSRDGLPLVRPTLPPDEVDFLERYSRHLRLPQVGIDGQQRLARARVLLIGAGGLGSPAAFYLAAAG
    IGHLRIADDDVVDRSNLQRQILHTEDSVGVAKVVSAAQRIAALNPRVQVDAIQTRVTASNVEALLQDVDVVVDGADNFAA
    RYLLNDACVKLGKPLVYGAVQQFEGQLSVFDAGRHRGQLPCYRCLFPEPPPPEFAPS
    CAEAGVLGVLPGVIGLLQAAEAI
    KLLLGLGDSLAGRLLSFDALAMRFREIRLPPDPQCPVCAPGTAFPGYADYATFCGTPA

    >gi|188991918|ref|YP_001903928.1| Putative AhpC/TSA family peroxiredoxin [Xanthomonas campestris pv. campestris str. B100]
    MTDAVLELPAATFDLPLSLSGGTQTTLRAHAGHWLVIYFYPKDSTPGCTTEGLDFNALLPEFDKAGAKILGVSRDSVKSH
    DNFCAKQGFAFPLVSDGDEALCRAFDVIKEKNMYGKQVLGIERSTFLLSPEGQVVQAWRKVKVAGHADAVLAALKAHAKQ


    >gi|188991923|ref|YP_001903933.1| hypothetical protein xccb100_2528 [Xanthomonas campestris pv. campestris str. B100]
    MQGLIEQYGLALVFANVLALSLGLPVPAMPTLVLVGAGYALHGGSAAWSAALAALAVSVFASVLGDLVWYLAGRRFGNRT
    LQSLCRLSLSRDTCMKKTERFFGRWGVRVLAVAKFVPGLSMVSVPMAGAMQVRPGAFLRYDAFGALLWAAVGLGLGALFA
    DQVQDVLHFLSTLGSGAVLVVALLLAGYVGWRWWRRHTLLRSLETARIAVEELVPMLAADEAMRPAVLDIRAQGFRDLQP
    YTIPGAMFADERELAQILATVPRDRSVVIY
    CACPDEVSAAWLAGRLRERGYRDVRPLLGGLDAWRDAGHPVVSLVPLATL
    APTGEAGALA

    >gi|188991996|ref|YP_001904006.1| Thiol:disulfide interchange protein (c-type cytochrome biogenesis protein CcmG) [Xanthomonas campestris pv. campestris str. B100]
    MNRLLPLLGFLALAALFGFGIYWTMQHNPRDVPSPLIGKPAPAFSLPLLDQPQQQVTRDQLLGKPYVLNVFGSWCAACAQ
    EHPVLMAHGRTLGVALIGYNYKDAPADANAWLAQHGNPYGMVIADEPGQTAIDFGVYGAPESFLIDAHGIIRYKHIGVLT
    PEVIRNELMPAIAGLSQGAP

    >gi|188992093|ref|YP_001904103.1| Putative iron-sulfur cluster assembly accessory protein [Xanthomonas campestris pv. campestris str. B100]
    MPLLCWSARMTISLTPAALERVQRFVQQTPGALGLRFGVTKTGCSGWGHITDLAREKRDDDAVFEQGGVRIFVDPTSLPL
    VDGTCIDFGKHGLSETFTFSNPNATAECGCGESFTTEAEHR

    >gi|188992118|ref|YP_001904128.1| thiosulfate sulfurtransferase [Xanthomonas campestris pv. campestris str. B100]
    MSAEPDWTTLVDSATLAAALQHPRLRLLDARAAPPTVPDPGAAQRDYAQGHLPDAHFADLHDALADVSRPGQGRHPLPHS
    DVFAAQLGRWGITPDSQVVVYDAADGSMAAARAWWMLRLMGHRHVAVLDGGLAAWRAAGLPETTAVPVPVDSGAYPGSFD
    ADAVVDAEAILARLDAAPGWLLDARAGERFRGEVEPIDPVAGHVPGAVSRPLGMSLRDGRFKPAAELRAELGALLGDYAP
    EQAVVM
    CGSGVTACHLLLALEVAGLSGARVYAGSWSGWLQDRSRPVAVASQLQAQ

    >gi|188992166|ref|YP_001904176.1| hypothetical protein xccb100_2771 [Xanthomonas campestris pv. campestris str. B100]
    MSLNRLLVLVFAGLFSTAAVAAGTSVLDLDYRPLAGKAPINLNRSYGGKVVMVVNTASKCGFTPQYEGLEALNQRFGSRG
    FTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKVHVLGAQATPLYQRLTRETGVAPGWNFHKYLIGRNGQVVAQ
    FPSKVKPDDPQVLAAIERELKAPAR

    >gi|188992182|ref|YP_001904192.1| dihydrolipoamide dehydrogenase [Xanthomonas campestris pv. campestris str. B100]
    MSEQFDVVVIGAGPAGYHAAIRAAQLGMKVACIDAAIGKDGKPALGGTCLRVGCIPSKALLDSSRQFWNMGHLFGDHGIS
    FNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPYYGFGQLQPGNIVKVTQHEGGEIELKGTNVILAAGSESIELPF
    AKFDGDTIVDNVGGLDFTAVPKRMAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALADAEVAKTALKEFKKQGLDIK
    LGAKVSKTEITGSGDAKQVVVSYTDGAGEQTLTVDKLLVAVGRKAATKNLLADGTGVKVTERGQIEVDGHCHTGVDGVWA
    IGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWVIYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAM
    GEPAGFVKVIVDAETDRVLGMHLVGVGVSELVHEGVLTMEFSGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN

    >gi|188992262|ref|YP_001904272.1| glutathione S-transferase family protein [Xanthomonas campestris pv. campestris str. B100]
    MTGRCALPRARLRQGFAKPRRAVTLPAPRCCRGVSVTSTVRPPLTVHGMSSSGNCYKVRLLLEQLGSRYHWVEVDSVSGE
    TRTPEYLAKNPNGKVPMVERDDGRVLTESNAILFWLAEGTPYLPTDTWQRAQALSWMFFEQYSHEPYVAVARFISLWTPR
    DAARRAELPQLRAGGEQALAVMEQHLRQQAWFTGADYGIADIALFAYTHCAEDGGFDLERWSAIDGWLQRVRALPGFVAM
    PAPVSA

    >gi|188992280|ref|YP_001904290.1| glutathione peroxidase-like protein [Xanthomonas campestris pv. campestris str. B100]
    MTTLSTYQFTDLDGQPQSLAEYAGKVVLVVNVASKCGFTPQYTGLQALWQRYRDRGLVVIGFPCDQFGHQEPGDAADIRQ
    FCSLDYAVDFPLAAKVEVNGSGAHPLWQWLKHEKRGVLGSEAIKWNFTKFLIGRDGRVLERYAPTTKPEALAADIERALG
    V

    >gi|188992306|ref|YP_001904316.1| ArsC family protein [Xanthomonas campestris pv. campestris str. B100]
    MTTVYGLKNCDTCKKATKWLDRFGVAYTFVDYREHTPAPDTLLEWAGKAGGFDALINKSSTTWRQLPDNKKTPGSEAEWK
    LLLREYPQLIRRPVVLTDDGTLSQGFSDNGFKARFAVG

    >gi|188992418|ref|YP_001904428.1| hypothetical protein xccb100_3023 [Xanthomonas campestris pv. campestris str. B100]
    MHTPVMRIDIWSDVVCPWCWIGKRRFEQAVATLGERLPALEIHYHAFQLDPDSGLQPVPLREALLPKFGSAERTEQLLAQ
    TQQTARAEGLPFDFSRGQVQVTTLPAHRLIWLAAREGDVEPVIEALFHAHFAEGKNLAAADTLIAAGAAGGLAPARVQAL
    LASDEGSAQVQAQLLQAAQIGIRAVPSFVIDGRSLLQGAQPADVMAQALLQLAAESAPAAATGDACGPDGCAI

    >gi|188992554|ref|YP_001904564.1| Putative thioredoxin [Xanthomonas campestris pv. campestris str. B100]
    MTDTPLLVACPSCAAMNRLPPSRLRDAPKCGSCHTALFLGTPVALSSADFDKHAVRSELPLLVDFWAPWCGPCLSMAPQF
    AAAAASLEPQLRLAKVDTDLHPVLGTRFGIRSIPTLLILRNGKELARQSGAMGSTQIIAWARSVLSSH

    >gi|188992693|ref|YP_001904703.1| putative peroxiredoxin [Xanthomonas campestris pv. campestris str. B100]
    MTIQVGDRIPEVVLKHLREGIEAVDTHTLFTGRKVVLFAVPGAFTPTCSAKHLPGYVEQFEAFRKRGIEVLCTAVNDPFV
    MQAWGRSQLVPDGLHLVPDGNAELARALGLEIDASGSGMGLRSRRYALYADDGVVKALFVEEPGEFKVSAADYVLQHLPD


    >gi|188992780|ref|YP_001904790.1| Carboxymuconolactone decarboxylase, probable [Xanthomonas campestris pv. campestris str. B100]
    MSGSDDGSADRLREFTDFRQRMNQRILAEPNQVVRRFFALDTQTYQAGALDVKTKELLGLVASMVLRCDDCISYHVAQCK
    EAGVTREEFFETFSVGLVVGGSIVIPHLRRAVDFLDQLEGGAPAPAEHSHG

    >gi|188992781|ref|YP_001904791.1| Putative glutaredoxin [Xanthomonas campestris pv. campestris str. B100]
    MRAARRVGVNRQLIHSVAVTTSKFQSPVTICQTTDPTTEFPVSQDHTGQQAATGPQITLYSTAICPYCVAAKNFLKSKGQ
    TWTEVRIDLDPAERDKMVALAKRTSVPQIFVGDIHVGGYDDMMAMHRAGKLEPLFAAAGGQA

    >gi|188992828|ref|YP_001904838.1| disulfide bond formation protein B [Xanthomonas campestris pv. campestris str. B100]
    MADNPHLGPWQAVTMNPFRWGFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFATLALLFLLGALHGPRGA
    GGRKAYGVLAFIAAGVGMGIAARHVWVQIRPKDMMSS
    CGPPLSFLSETMGPFEVFRTVLTGTGDCGNIDWRFLGLSMPMW
    SMVWFVGLALWALYAGFKHRGPRKLF

    >gi|188992884|ref|YP_001904894.1| Putative thioredoxin [Xanthomonas campestris pv. campestris str. B100]
    MTLRSLMRGACALLLPLVLLTACKPTGEGTSTTASPAPTPANQAPATPPAGTDPAAVSTTSSVVQKTAEMPTLSLPTVSG
    ETYDLAAHRGKWVVVNFWATW
    CAPCLKEMPELSALHTMRDSIEVVGLAYEDITTADMQSFLKDHPVSYPVAILDPYQPPQ
    DFATPRGLPMTYLIGPDGKVAKQFLGPVTARDIETAVGITGKAG

    >gi|188992912|ref|YP_001904922.1| alkyl hydroperoxide reductase subunit C [Xanthomonas campestris pv. campestris str. B100]
    MSLINTQVQPFKANAYHNGNFIEVTEASLKGKWSVLIFMPAAFTFNCPTEVEDAADNYAAFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAQFPLIGDPAHKLTRAFGVHIEEEGLALRGTFIINPEGVIKTLEIHDNSIARDVTETLRKLTAAQFVAN
    NPGQVCPAKWKEGAKTLAPSLDLVGKI

    >gi|188992913|ref|YP_001904923.1| alkyl hydroperoxide reductase subunit F [Xanthomonas campestris pv. campestris str. B100]
    MLDANLKTQLTAYLERVTRPIQIHASIDDTPKAREMLELLEDLVLLSDKISLDVHRDDNQRKPSFALTTPGQDISVRFAG
    LPMGHEFTSLVLALLQVGGHPSKATAELIEQVQHLDGDYQFETYFSLS
    CQNCPDVVQALNLAAVLNPRIKHVAIDGALFQ
    DEVETRQIMSVPTVYLNGELFDQGRMTLEQIVAKLDTNAAKRDAAKIAAKEAFDVLVVGGGPAGSAAAVYAARKGIRTGV
    AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYEVDIMNLQRAEQLIPAGADGLVEIKLANGASLKSKTVILS
    TGARWRQMNVPGEDQYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLR
    SLHNVRIITSAQTTEVLGDGQKVTGLVYKDRTGGDTQHIDLEGVFVQIGLLPNTEFLRGTVELSPRGEIIVDDRGQTNVP
    GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRSSAPVSADVAQAA

    >gi|188992919|ref|YP_001904929.1| methionine sulfoxide reductase A [Xanthomonas campestris pv. campestris str. B100]
    MLGIGAFKQRMPRSGEALPGRTQALPLHNTHLINGHPLRGEFTGLAQVQFGLGCFWGAERKFWNVPGVYTTAVGYAGGKT
    PNATYSEVCSGQTGHTEAVLVVYDAQAVSFEQLLRTFWESHDPTQGMQQGNDVGTQYRSAIYCSTQAQYDAAIASRDAYQ
    QQLTAAGYGDITTEILYPAPTFYYAEDDHQQYLAKHPNGYCGLGGTGVSCPIGLDA

    >gi|188993066|ref|YP_001905076.1| arsenate reductase (glutaredoxin) [Xanthomonas campestris pv. campestris str. B100]
    MHAVIYHNPACGTSRNTLALIRHVGIEPQIIEYLRDPPTRATLQALIAEAGLSVRDALRQKGTPYLELGLDDPALDDAAL
    LSAMLAHPILISRPFVRTDRGVRLCRPSEQVLELLPAATSGFIKEDGERVLDEAGRRVSQ

    >gi|188993094|ref|YP_001905104.1| Protein disulfide isomerase [Xanthomonas campestris pv. campestris str. B100]
    MYRLAIAALLGAISLTACAQSSQPAASNTAAKPAAAPASGNVDQRVGAALKALDPDFKPDYIGAAPFPGFREVVVGGQVL
    YVSDDGRYLIQAQPFDIQNKQFAASEGLLAYRRKQLQTVPKADRIVFAPANPKYTVTVFTDVE
    CGYCRKLHSEIGELNKQ
    GIAVEYLAFPRMGLGSQDHKEMIAVWCAADRKQALTAAKSGQPVNAKDCKNPVSMEYTLGQRLGVNGTPAIFAPDGTQLG
    GYLPPAQLREALEKRAVTTAGGSR

    >gi|188993199|ref|YP_001905209.1| dihydrolipoyl dehydrogenase [Xanthomonas campestris pv. campestris str. B100]
    MAVIEIKVPDIGDYSDVPVIEVLVAVGDSVVKDQGLVTLESDKATLEVPSSAAGVVKELKVKIGDNLSEGAVVLLLETEG
    EAAAAPAAPKAETKVAAPAAPAATAPGSKPPVTPSHRAPAEPAAPKPALASGKAADIECKMVVLGAGPGGYTAAFRAADL
    GLDTVLIERYASLGGV
    CLNVGCIPSKALLHAAAVIDEVAHAGDFGVDFGQPKITLDKLREYKEKVVGKLTGGLASMAKQR
    KVRTVTGVASFVSPNELEIVGDDGKTQLLRFEHCVIAAGSQAVKLPNFPWDDKRVMDSTDALELHDIPKTLLVVGGGIIG
    LEMATVYSALGSKVTVVEFMDQLMPGADKDLVKPLADRLKKQGVEVHLKTKATDVSADAKGITVSFEAASEGEKPGLQAT
    AFDRVLVAVGRSPNGKKIGADKAGVTVTERGFIPVDRQMRTNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAGEKKEW
    VARVIPSVAYTNPEIAWVGVTETEAKAKGLKVGVAKFPWAASGRAIGIGRTEGFTKLIFDEDTHRIIGGAIVGVHAGDLL
    AEIGLAIEMGAEAEDIGHTIHAHPTLSESVGMAAEVYDGTITDLYIPKKK

    >gi|188993232|ref|YP_001905242.1| methionine sulfoxide reductase B [Xanthomonas campestris pv. campestris str. B100]
    MSQFDLTPPSPAQRDALIAGLSDEEQRVLLHHGTEAPFCGVFLDNKLDGVYTCRLCGLPLFRSNAKFDSGTGWPSFFAPY
    DPAHVREIRDTSYGMVRTEIVCARCDSHLGHVFPDGPPPTGERH
    CLNSVSLAFTEDGQPLPNPLQRAGAETQPA

    >gi|188993354|ref|YP_001905364.1| thioredoxin [Xanthomonas campestris pv. campestris str. B100]
    MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGKLKVAKVNVDQNRALAIKYHVRSIPMLL
    LFKDGEVQASQIGAVGKGQLTQMIDKTLGGAAA

    >gi|188993404|ref|YP_001905414.1| Putative disulphide-isomerase [Xanthomonas campestris pv. campestris str. B100]
    MKLSCRRPRPLSIALLAVLATLTACDKPTPSAHAQASPTAAPAAHAGIAWREGGLEAAFAEARDSGKPILLYWGAAWCAP
    CNRLKATLFQDPAFIAQTRHFVAVHLDGDAEGTLDWGERFGIKGYPTIIVLRSDRSEVTRLAGNSDTARLADVLRVVATS
    TTTVKQLLDKAQHAPQELSADDWAVLGNYGWGMDDSLVKSGELPALLARLSERAPQPSLRRRFALAAIVAPEDPPTPSPA
    NRAVLEAILADPAEVRANLSTLNYVPAWLVKAGSTDAGQRARLSAKLDQALDAVYADPGVPINDRLETAFAKIELARLAQ
    GQPTETAPKEPQPPLPAAVVETVHQRVQTIVAAARTAEEHQSITDSAAALLSEVGDSSGAEQLLLAEVGRSKTPYYYMPR
    LSQLAEERGDRKTALSWLKKNYTTASSPVARAQSGARYADGLIRLSPEDSAAIEAVATQAIGALAAQSDADRQRSRKRFA
    RLGSALKTWSKQHQQEGTAVLARLRQKMQASCGGKNTSECTSWLS

    >gi|188993476|ref|YP_001905486.1| mercuric reductase [Xanthomonas campestris pv. campestris str. B100]
    MTATRYDAIVVGAGQAGPSLTVRLAERGQRVAVIERHLVGGTCVNTGCMPTKTLVASARVAHLARRAGDYGVRIAGPVEV
    DLPQVMARAHAISDAARTGVEQWLAQTPGVQLIRGHARFVAPDRLRVGAQELGAPRIFLNVGGRARTPELPGLDQISPLN
    NTSILQLRTLPQHLVVIGGSYIGLEFAQIFRRLGAKVTVVEQHAHLIGREDADISEAIAQMLQDEGIAVRTDARCIAFAA
    HADGAAVQLECAQGAPQIVASHVLLALGRQPNTDDLGLEAAGIATDAQGYVQVDMQLATNVPGVWAMGDCNGRGAFTHTA
    YNDYEILAANLLDGAERRLSQRVPAYALFTDPPLGRVGMSETQARASGRPLLVAQRPMQQVGRARENGETIGMMKLVADA
    QTRRVLGAAILGLHGDEAIHGIIDLINADQPIDTLEWAVPIHPTVSELWPTLARALAPAQ

    >gi|188993570|ref|YP_001905580.1| Putative thioredoxin [Xanthomonas campestris pv. campestris str. B100]
    MQTITVTSPEHYTEVLAAHPRALVDFYKDNCPGCKMLDMSLDKFSASDAAAGVALLKVKLEVVGEEFFRDLGLRQTPTLA
    LYRDGSEVARLPGFQSPAQVETAVKTSL

    >gi|188993659|ref|YP_001905669.1| Putative secreted protein [Xanthomonas campestris pv. campestris str. B100]
    MARRFPWLWLGLLAACILVAVLAWQNQQLRTQQQWLQTRVTAPYAGMYVPIIAAPGVDGRSYTLGAAQGQPQVLFFFTTT
    CPYCRRSAPTVVRAARQLQANLPGRPQLLGVCHCDLAQAARYAHVHGFDFPVVTLTDRRALMLFRARNVPLVMAVDGGGR
    VRHSHVGLFDTTERVQDLVAALRRTDAPAALATVKE

    >gi|188993829|ref|YP_001905839.1| Glutathione peroxidase, probable [Xanthomonas campestris pv. campestris str. B100]
    MSQSIHDIPVTDINGGATSLAAHRGKVLLVVNVASKCGLTPQYEGLEALYRDKQAQGLEVLGFPANDFNGQEPGSEAEIA
    QFCQLTYDVTFPLFSKIAVTGAEIHPLYQALTSAQPQATGDGPMREKLAGYGIAANPAPGVLWNFEKFLIGRDGQVIERF
    APDVAADDVRLRQAVDAALAH