Xanthomonas campestris ATCC 33913 uid57887

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|21229560|ref|NP_635477.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MAFVREYAAQAPDRSAVDAQPGLQVLEFGTDWCGHCMAAQPLLQKLLGGYANIEYRKIEDGKGRPLGRSFRVKLWPTIIL
    LRDGEEVARAVRPQTREDLQAVLSALEAVG

    >gi|21229680|ref|NP_635597.1| hypothetical protein XCC0202 [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MRQFPPASSTVISVNFEELQAFVGRNPMLSLALVGLTIAIIVTEIARLFRGYRALKPAELTRLINSENALVIDLSPTADF
    EKGHIAGSRNVALAKFDPAGKLLANAKSSPVVVV
    CRSGNASAGAAKTLKKAGFEQVYWLEGGIAAWQMAELPLVKGRA

    >gi|21229742|ref|NP_635659.1| organic hydroperoxide resistance protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MASPEKVLYTAHATATGGREGRAVSSDSALDVKLSTPRELGGAGGDGTNPEQLFAAGYSACFIGAMKAVAAQDKLKLPGE
    ISIDGSVGIGQIPGGFGIAVELKIAVPGMEPAELQALVDKAHQV
    CPYSNATRGNIDVTLTLA

    >gi|21229963|ref|NP_635880.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSTLVSLPTAAPAPDYQSIDRPLNFSNAAAAKVRELIQEEGNAELALRVYIQGGGCSGFQYGFEFDENRAEDDLAVATDG
    VTLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV

    >gi|21229994|ref|NP_635911.1| c-type cytochrome biogenesis protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MKSLSRWIARCAVLVAPLFVALPLLLTAPAAQAVTEADLLPVDQAFALSAKADGRDRIALTWKIAPGYYLYRHRISVKSG
    QGFTAGALDLPEGESKHDEFFGQVQTYRTALQASLAGKAAPGQRSAILQVQYQGCADAGVCYPPQRRELRVDLPDAPTTA
    PPRESLGALVPRGPSGARLFGAPGQTAGVDALPLPADQAFNFEAIVGDGNSLLLRFTPAPGYYLYRDRTSLSLEGTSDIR
    TGLPRWPQGRTHRDEHFGDVVVYFDQAEVTLPLLRDRPDPARVTLVATFQGCQSDGICYPPMTRRVRLDLPAGTVSPHNQ
    ATATPLLISPLSAGEVAAERAAPGPPADAAPGPDATAGNPERSRPPHLERNLLAILLLALAGGLVLNLMPCVLPILSLKV
    LGLAHSGESRNHARSHAIWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQQPWFVAALAYLMFAVGLSLSGVFTLGSN
    LGGIGQSLAARNGPLGDFFTGVLACVVASPCIAPFMGTALAYAFTAPAPLAMLVFLTLGLGLALPFLLIGFIPSLARRLP
    TPGAWMETLKQVLAFPMYLTAIWLLWVLGKQRGVDALALMLVGATLLALGLWWFERSRWNSHRLGMGLAAAMLVLAIVPV
    VAVTRLSLPRATATEGSVTYTPELLDRLRADNRVVFVNMTADW
    CVTCKANEKNVLSSTDFRDALRRVDAVYMKGDWTNVD
    PKISAFLDQHQAVGVPLYVVYGPGAPPAVLPTVLTGAITEDALLRAAR

    >gi|21230019|ref|NP_635936.1| dihydrolipoamide dehydrogenase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MAVIEIKVPDIGDYSDVPVIEVLVAVGDSVVKDQGLVTLESDKATLEVPSSAAGVVKELKVKIGDNLSEGAVVLLLETEG
    EAAAAPAAPKAETKAETKAAAPAAAPAAAAPGSKPPVTPSHRAPAEPAASKPALASGKAADIECKMVVLGAGPGGYTAAF
    RAADLGLDTVLIERYASLGGV
    CLNVGCIPSKALLHAAAVIDEVAHAGDFGVDFGQPKITLDKLREYKEKVVGKLTGGLAS
    MAKQRKVRTVTGVASFVSPNELEIVGDDGKTQLLRFEHCIIAAGSQAVKLPNFPWDDKRVMDSTDALELHDIPKTLLVVG
    GGIIGLEMATVYSALGSKVTVVEFMDQLMPGADKDLVKPLADRLKKQGVEVHLKTKATDVSADAKGITVSFEAATEGEKP
    GLQATAFDRVLVAVGRSPNGKKIGADKAGVTVTERGFIPVDRQMRTNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAG
    EKKEWVARVIPSVAYTNPEIAWVGVTETEAKAKGLKVGVAKFPWAASGRAIGIGRTEGFTKLIFDEETHRIIGGAIVGVH
    AGDLLAEIGLAIEMGAEAEDIGHTIHAHPTLSESVGMAAEVYDGTITDLYIPKKK

    >gi|21230130|ref|NP_636047.1| disulfide isomerase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MYRLAIAALLGAISLTACAQSSQPAASNTAAKPAAAPATGNVDQRVGAALKALDPDFKPDYIGAAPFPGFREVVVGGQVL
    YVSDDGRYLIQAQPFDIQNKQFAASEGLLAYRRKQLQTVPKADRIVFAPANPKYTVTVFTDVE
    CGYCRKLHSEIGELNKQ
    GIAVEYLAFPRMGLGSQDHKEMIAVWCAADRKQALTAAKSGQPVNAKDCKNPVSMEYTLGQRLGVNGTPAIFAPDGTQLG
    GYLPPAQLREALEKRAVTTAGGSR

    >gi|21230161|ref|NP_636078.1| arsenate reductase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MHAVIYHNPACGTSRNTLALIRHVGIEPQIIEYLRDPPTRATLQALIAEAGLSVRDALRQKGTPYLELGLDDPALDDAAL
    LSAMLAHPILINRPFVRTDRGVRLCRPSEQVLELLPAATSGFIKEDGERVLDEAGRRVSQ

    >gi|21230302|ref|NP_636219.1| methionine sulfoxide reductase A [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MLGIGAFKQRMPRSGEALPGRTQALPLHNTHLINGHPLRGEFTGLAQVQFGLGCFWGAERKFWNVPGVYTTAVGYAGGKT
    PNATYSEVCSGQTGHTEAVLVVYDAQAVSFEQLLRTFWESHDPTQGMQQGNDVGTQYRSAIYCSTQAQYDAAIASRDAYQ
    QQLTAAGYGDITTEILYPAPTFYYAEDDHQQYLAKHPNGYCGLGGTGVSCPIGLDA

    >gi|21230307|ref|NP_636224.1| alkyl hydroperoxide reductase subunit F [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MLDANLKTQLTAYLERVTRPIQIHASIDDIPKAREMLELLEDLVLLSDKISLDVHRDDNQRKPSFALTTPGQDISVRFAG
    LPMGHEFTSLVLALLQVGGHPSKATAELIEQVQHLDGDYQFETYFSLS
    CQNCPDVVQALNLAAVLNPRIKHVAIDGALFQ
    DEVETRQIMSVPTVYLNGELFDQGRMTLEQIVAKLDTNAAKRDAAKIAAKDAFDVLVVGGGPAGSAAAVYAARKGIRTGV
    AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADGLVEIKLANGASLKSKTVILS
    TGARWRQMNVPGEDQYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLR
    SLHNVRIITSAQTTEVLGDGQKVTGLVYKDRTGGDTQHIDLEGVFVQIGLLPNTEFLRGTVELSPRGEIIVDDRGQTNVP
    GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRSSAPVSADVAQAA

    >gi|21230308|ref|NP_636225.1| alkyl hydroperoxide reductase subunit C [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSLINTQVQPFKANAYHNGNFIEVTEASLKGKWSVLIFMPAAFTFNCPTEVEDAADNYAAFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAQFPLIGDPAHKLTRAFGVHIEEEGLALRGTFIINPEGVIKTLEIHDNSIARDVTETLRKLTAAQFVAN
    NPGQVCPAKWKEGAKTLAPSLDLVGKI

    >gi|21230335|ref|NP_636252.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MTLRSLMRGACALLLPLVLLTACKPTGEGTSTTASPAPTPANQAPATPPAGTDPAAVSTTSSVVQKTAEMPTLSLPTVSG
    ETYDLAAHRGKWVVVNFWATW
    CAPCLKEMPELSALHTMRDSIEVVGLAYEDITTADMQSFLKDHPVSYPVAILDPYQPPQ
    DFATPRGLPMTYLIGPDGKVAKQFLGPVTARDIETAVGITGKAG

    >gi|21230390|ref|NP_636307.1| disulfide bond formation protein B [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MNPFRWGFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFATLALLFLLGALHGPRGAGGRKAYGVLAFIAA
    GVGMGIAARHVWVQIRPKDMMSS
    CGPPLSFLSETMGPFEVFRTVLTGTGDCGNIDWRFLGLSMPMWSMVWFVGLALWALY
    AGFKHRGPRKLF

    >gi|21230434|ref|NP_636351.1| glutaredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MRAARRVGVNRQLIHSVAVTTSKFQSPVTICQTTDPTTEFPVSQDHTGQQAATGPQITLYSTAICPYCVAAKNFLKSKGQ
    TWTEVRIDLDPAERDKMVALAKRTSVPQIFVGDIHVGGYDDMMAMHRAGKLEPLFAAAGGQA

    >gi|21230435|ref|NP_636352.1| hypothetical protein XCC0966 [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSGSDDGSADRLREFTDFRQRMNQRILAEPNQVVRRFFALDTQTYQAGALDVKTKELLGLVASMVLRCDDCISYHVAQCK
    EAGVTREEFFETFSVGLVVGGSIVIPHLRRAVDFLDQLEGGAPAPAEHSHG

    >gi|21230504|ref|NP_636421.1| peroxiredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MTIQVGDRIPEVVLKHLREGIEAVDTHTLFTGRKVVLFAVPGAFTPTCSAKHLPGYVEQFEAFRKRGIEVLCTAVNDPFV
    MQAWGRSQLVPDGLHLVPDGNAELARALGLEIDASGSGMGLRSRRYALYADDGVVKALFVEEPGEFKVSAADYVLQHLPD


    >gi|21230637|ref|NP_636554.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MTDTPLLVACPSCAAMNRLPPSRLRDAPKCGSCHTALFLGTPVALSSADFDKHAVRSELPLLVDFWAPWCGPCLSMAPQF
    AAAAASLEPQLRLAKVDTDLHPVLGTRFGIRSIPTLLILRNGKELARQSGAMGSTQIIAWARSVLSSH

    >gi|21230737|ref|NP_636654.1| polyketide synthase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MHTPVMRIDIWSDVVCPWCWIGKRRFEQAVATLGERLPALEIHYHAFQLDPDSGLQPVPLREALLPKFGSAERTEQLLAQ
    TQQTARAEGLPFDFSRGQVQVTTLPAHRLIWLAAREGDVEPVIEALFHAHFAEGKNLAAADTLIAAGAAGGLAPARVQAL
    LASDEGSAQVQAQLLQAAQIGIRAVPSFVIDGRSLLQGAQPADVMAQALLQLAAESAPAAATGDACGPDGCAI

    >gi|21230843|ref|NP_636760.1| hypothetical protein XCC1386 [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MTTVYGLKNCDTCKKATKWLDRFGVAYTFVDYREHTPAPDTLLEWAGKAGGFDALINKSSTTWRQLPDNKKTPGSEAEWK
    LLLREYPQLIRRPVVLTDDGTLSQGFSDNGFKARFAVG

    >gi|21230869|ref|NP_636786.1| glutathione peroxidase-like protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MTTLSTYQFTDLDGQPQSLAEYAGKVVLVVNVASKCGFTPQYAGLQALWQRYRDRGLVVIGFPCDQFGHQEPGDAADIRQ
    FCSLDYAVDFPLAAKVEVNGSGAHPLWQWLKHEKRGVLGSEAIKWNFTKFLIGRDGSVLERYAPTTKPEALAADIERALG
    A

    >gi|21230887|ref|NP_636804.1| glutathione S-transferase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MRPPLTVHGMSSSGNCYKVRLLLEQLGSRYHWVEVDSVSGETRTPEYLAKNPNGKVPMVERDDGRVLTESNAILFWLAEG
    TPYLPTDTWQRAQALSWMFFEQYSHEPYVAVARFISLWTPRDAARRAELPQLRARGEQALGVMEQHLRQHAWFTGADYGI
    ADIALFAYTHCAEDGGFDLERWSAIDGWLQRVRALPGFVAMPAPVSA

    >gi|21230940|ref|NP_636857.1| dihydrolipoamide dehydrogenase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSEQFDVVVIGAGPAGYHAAIRAAQLGMKVACIDAAIGKDGKPALGGTCLRVGCIPSKALLDSSRQFWNMGHLFGDHGIS
    FNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPYYGFGQLQPGNIVKVTQHEGGEIELKGTNVILAAGSESIELPF
    AKFDGDTIVDNVGGLDFTAVPKRMAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALADAEVAKTALKEFKKQGLDIK
    LGAKVSKTEITGSGDAKQVVLSYTDAAGEQTLTVDKLLVAVGRKAATKNLLADGTGVKLTERGQIEVDGHCHTGVDGVWA
    IGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWVIYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAM
    GEPAGFVKVIADAETDRVLGMHLVGVGVSELVHEGVLTMEFSGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN

    >gi|21230956|ref|NP_636873.1| ABC transporter vitamin B12 uptake permease [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSLNRLLVLVFAGLFSTAAVAAGTSVLDLDYRPLAGKAPINLNRSYGGKVVMVVNTASKCGFTPQYEGLEALNQRFGSRG
    FTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKVHVLGAQATPLYQRLTRETGVAPGWNFHKYLIGRNGHVVAQ
    FPSKVKPDDPQVLAAIERELKAPAR

    >gi|21230991|ref|NP_636908.1| thiosulfate sulfurtransferase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSAEPDWTTLVDSATLAAALQHPQLRLLDARAAPPTAPDPGAAQRDYAQGHLPGAHFANLHDALADVSRPGQGRHPLPHS
    DVFAAQLGRWGITPDSQVVVYDAADGSMAAARAWWMLRLMGHRRVAVLDGGLAAWRAAGLPETTAVPSPADSGAYPGSFD
    ADAVVDAEAILARLDAAPGWLLDARAGERFRGEVEPIDPVAGHVPGAVSRPLGMSLRDGRFKPAAELRAELGALLCDYAP
    EQAVVM
    CGSGVTACHLLLALEVAGLSGARVYAGSWSGWLQDRSRPVAVASQLQAQ

    >gi|21231016|ref|NP_636933.1| hypothetical protein XCC1562 [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MPLLCWSARMTISLTPAALERVQRFVQQTPGALGLRFGVTKTGCSGWGHITDLAREKRDDDAVFEQGGVSIFVDPTSLPL
    VDGTCIDFGKHGLSETFTFSNPNATAECGCGESFTTEAEHR

    >gi|21231111|ref|NP_637028.1| C-type cytochrome biogenesis protein/thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MNRLLPLLGFLALAALFGFGIYWTMQHNPRDVPSPLIGKPAPAFSLPLLDQPQQQITRDQLLGKPYVLNVFGSWCAACAQ
    EHPVLMAHGRTLGVALIGYNYKDAPADANAWLAQHGNPYGMVIADEPGQTAIDFGVYGAPESFLIDAHGIIRYKHIGVLT
    PEVIRNELMPAIAGLSQGAP

    >gi|21231183|ref|NP_637100.1| hypothetical protein XCC1731 [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MQGLIEQYGLALVFANVLALSLGLPVPAMPTLVLVGAGYALHGGSAAWSAALAALAVSVFASVLGDLVWYLAGRRFGNRT
    LQSLCRLSLSRDTCMKKTERFFGRWGVRVLAVAKFVPGLSMVSVPMAGAMQVRPGAFLRYDAFGALLWAAVGLGLGALFA
    DQVQDVLHFLSTLGSGAVLVVALLLAGYVGWRWWRRHTLLRSLETARIAVEELVPMLAADEAMRPAVLDIRAQGFRDLQP
    YTIPGAVFADERELAQILATVPRDRSVVIY
    CACPDEVSAAWLAGRLRERGYRDVRPLLGGLDAWRDAGHPVVSLVPLATL
    APTGEAGALA

    >gi|21231188|ref|NP_637105.1| bacterioferritin comigratory protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MTDAVLELPAATFDLPLSLSGGTQTTLRAHAGHWLVIYFYPKDSTPGCTTEGLDFNALLPEFDKAGAKILGVSRDSVKSH
    DNFCAKQGFAFPLVSDGDEALCRAFDVIKEKNMYGKQVLGIERSTFLLSPEGQVVQAWRKVKVAGHADAVLAALKAHAKQ


    >gi|21231419|ref|NP_637336.1| thioredoxin reductase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSASSASPAKHSRLLILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPGDPHGLMGPDLMSRMQAHAER
    FDTEVIFDHIHTADLSQRPFRLIGDSAEYTCDALIIATGATAKYLGIPTEEAFKGRGVSA
    CATCDGFFYKDQDVVVVGGG
    NTAVEEALYLSNIARKVYLVHRRDTLRAEKIMQDKLFAKVAAGKIETVWHHAIEEVLGNDAGVTGVRVKSTLDGSTRDID
    AHGFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLNGAATETSVAGVFAAGDVADQHYRQAITSAGFGCMAALDAERYLDK
    SA

    >gi|21231437|ref|NP_637354.1| molybdopterin biosynthesis protein MoeB [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSHDLSPAQARARALRGALLIDIRQPHERVSGQAEGALAIAQADLEQAPAQHLPDRDRDILLICQSGKRSAQTAAQLREQ
    GYPHALSVLGGTTAWSRDGLPLVRPTLPSDETDFLERYSRHLRLPQVGIDGQQRLARARVLLIGAGGLGSPAAFYLAAAG
    VGHLRMADDDVVDRSNLQRQILHTEDSVGMAKVVSAAQRIAALNPRVQVDAIQTRVTASNIEALLQDVDVVVDGADNFAA
    RYLLNDACVKLGKPLVYGAVQQFEGQLSVFDAGRHRGQLPCYRCLFPEPPPPEFAPS
    CAEAGVLGVLPGVIGLLQATEAI
    KLLLGLGDSLAGRLLSFDALAMRFREIRLPPDPQCPVCAPGTAFPGYADYATFCGTPA

    >gi|21231560|ref|NP_637477.1| hypothetical protein XCC2116 [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MAAGRYRRAPDRGQTHPRLTGLGHNHCMTAQLTQELPEFPTWLNARPSTLQEHRGRALVLAFVNASSVWCAERLAELARW
    QARSPGRLQVIVVQVPRFDSERMPQRSLKQLRGHGVSAPILLDKDWETWRRFGIESWPTLVLLDAYGRERQRLVGVTGDL
    DKALAALCEGQQPPSDADLHGVAERDPEPRLALRFPTGLAATEDRLYIADTGHHRILECTHSGRVLRQFGHGNADLIDGG
    VGEAAFRRPQGLALEREELYVADTGNHALRRINLRSGQVDTLCGTGRSGEPIEGPLASAGASPLNYPQGLAVADNQLLIA
    MAGDNRIWSYHLGRAALSARAGTGSLEIRDGSGHLAAFAQPAGLAAVQQVAYVCDGLGSSIRTMQLRGDLVQTLVGGQGT
    WQFGEDDGPRSAARLQFPQAIALAADSPMLWVADTGNGRLRCLRLGGGELTTVALPRRLHGPAGLAVAGGAVWIAETDAH
    AVLRYDLATGALSDVSIDE

    >gi|21231664|ref|NP_637581.1| c-type cytochrome biogenesis protein/thioredoxin dsbE or [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSDPRTSRLPTAVLVGAGILLLALAALLVYAVVRSGNDDRDALPSALIGKPAPEFALPLLHDPSIIVHARELRGAPYIIN
    VWGSW
    CPACREEHPVLSRFALTKRVRVIGYNWKDERADALRWLEQLGNPYLLVVADTDGRTAIDFGIAAAPETFLVDGRG
    VVRWKYSGMLTQSIIDTQLIPALTRIERSPSAAPDLHTAR

    >gi|21231722|ref|NP_637639.1| hypothetical protein XCC2284 [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MTHLQFDNRLRAELPGDPEEGPRRREVLAAWSAVQPTPVAAPTLLAYSADVAQRLGLRAEDLASPRFAEVFGGNALYPGM
    QPWAVNYGGHQFGHWAGQLGDGRAISLGEAIGVDGGRYELQLKGAGPTPYSRGADGRAVLRSSIREFLCSEAMHYLGVPT
    TRALSLVGTGDAVVRDMFYDGHPRREPGAIVCRVAPSFIRFGNFELPAARGDVDLLRQWVDFTLARDFPDLPGSGEDRIA
    SWLGQVCERTAVMVAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWVDDYDPDWTPNTTDAQGRRYRFGTQPQVAYWNLG
    RLAQALSPLFGDAAPLQAGLDQFRDTYLACDRRDTAAKLGLAECQDEDLHLIDDLRALMREAEMDMTLTFRGLVDLSPQQ
    PDASVLREAFYDETKRAAQAPALGAWLQRYAARCLQDGASDAVRASRMRAANPRYVLRNYLAQQAIDQAEQGDLSGVHAL
    LEVMQRPYDDQPRRESFAAKRPDWARDRAG
    CSMLSCSS

    >gi|21231758|ref|NP_637675.1| stringent starvation protein A [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MATSVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTYDLVSVDPQNPPEDLIDLNPYHSVPTLVERDLVLYAASVVSEYLD
    ERYPHPPLMPVDPLSRARLRLAMLRIEHDWVPQVQAIQLGNKTQAEAGRKRLKELLTASVPLFKASKFFLNPEMSLADCA
    MAPIIWRLDALEISLPKDSKAIEDYGNRIFRNPGFIRSLTDQEKKLRDMPG

    >gi|21231933|ref|NP_637850.1| hypothetical protein XCC2500 [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MPVMERIQAEVEQHPIVLFMKGTPQFPMCGFSSRAVQALVAAGADQLRTVNVLEEPEIRANLPRYSNWPTFPQLFIHGEL
    IGGCDITMELFEAGELKRIVSEAYQP

    >gi|21232010|ref|NP_637927.1| reductase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSARYDYDVVVLGGGSGGLAAAFRAAKHGARVAIMEPGELGGTCVNLGCVPKKAMWLAADLASKIELAGALGFDVVRPTL
    TWQELVTHRQGYIGNIHASYRRRLDDDGVVLIPQRGVLQDRHTLMGADGVPVTAEHIVIATGAHPLRPHVEGAEHGHVSD
    DFFNLCHAPDHVAIVGGGYIAVEIAGLLQALGSRVHLFVQGERLLERFDAELTLQLADNLRHLGVRLHFGFRTTGVQRDD
    TGKLRMRGHSAHPGELGNDVFDQVFFAIGRRANTAGLGLEALGVELGKKGEIVVDDGQTTNVPNIHAVGDVDGKVGLTPV
    AIAAGRKLMDRLFGGQPDARMDYDNVPSVVFSHPPLGAVGLTEEQARERYDGAVRVYRSNFRPMLHALADAPQRSVFKLV
    CVGEEERVVGVHLLGESADEMLQGFAVAVKMGATKRDFDETVAIHPTSSEEIVLMH

    >gi|21232053|ref|NP_637970.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSDKAHVFDVTTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAADYNGAFELAKVDVDKEQQIAAAFQIRSV
    PTVFLVKGGELVDGFPGAMPEGQIREFLTQHGVLPAEPQVAEEVPLAPLDPQAQVAALREAIAAEPDKDELKLDLALALL
    KTGDTLEAEQLIDALPANLATDDRAVRAKARLGFANVLKDAPDAAALQTTVAADGSDLHARHLLGVRHLLDGDDEAALEQ
    FLEMLRQNRGFEDNLPRRSLIDAFRVIEDEDLVGRYRRKMSALLF

    >gi|21232084|ref|NP_638001.1| 6-O-methylguanine-DNA methyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSTLHYDTFPSPIGALTVAADTTGVRHILFAQNRHDAPGRALWQHGPDAPLVQAAREQLLDYLYGGRRSFDLPLAPAGTP
    FQLQVWQTLARIPFGETWSYAQLAQAVGRPAASRAVGAANGRNPLPIVLP
    CHRVIGASGALTGFGGGLPTKQALLQLEGW
    SPQASARRVAAVVGEDLFAR

    >gi|21232147|ref|NP_638064.1| hypothetical protein XCC2716 [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSDRAVSVVTGAVPYTVTVHDGQHRWIGDTQPANGGQDAGPDPEAQVLGALGACTAITVSMVAARKQWPLAAVHVHLHYT
    QRGAAGTSITRAIVLDGALDDDQRARLLEVAEKCPIHRLLTGEVRIATELQPHALVDAAGGSTR

    >gi|21232176|ref|NP_638093.1| osmotically inducible protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MGISRHATAHWEGDLKTGKGQLSTPQSGLMENTRYAFSSRFGDEKGTNPEELIAAAHAGCFTMALSAQLTEAGFPPTSLD
    TRADVDLSMEGGPQLSQIRLKLKAMVPGIDEAKFRELADTAKKN
    CPVSKALSAVPISLETEFSS

    >gi|77747933|ref|NP_638714.2| glutaredoxin-like protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSLDPALRSRIDTLLQSNRVVLFMKGQPGMPQCGFSAKAIGVLDGLGIDYAHVNVLADQEIREGIKAYGDWPTIPQLYVD
    GELIGGSDIIVQMADSGELSSMLGLQAPDRSPPKITITPAAVEMLKGALADAPDASLTLAIDANFQPNFQLAPTNPNAIA
    AESNGLRVQFDLASARRADGITIDWVDDIRGRGLAIDNPNAPKPVQELAVRDADDRLKAGTLTVVDVRPADERALATVAA
    PFRTLDAHERLEIEQLPKDTPLAFL
    CHRGGRSLQAAEHFRGLGFTNVYNVTGGIDAWSDAVDNGVPKY

    >gi|21232828|ref|NP_638745.1| disulfide oxidoreductase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MNLFSRLSLLLLILLPLAACAADKKAPPVEGEDYVLIDGGQPYAPLAGKVEVAEVFGYTCPHCAHFEPTLEAWTAKQPAY
    VRVTPVPAAFGGFWDAFARAYFAADTLGVAKRSHRAMFDAIHEKHTVPTQNVAPEELAAFYVAYGVPQQRFIDTLKSAAV
    EDKVKAAREFATRAKIPGTPALVVNGRYLITARDYTDMLRVADYLIAREHAAPAAR

    >gi|21232829|ref|NP_638746.1| thiol:disulfide interchange protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MKTRFALTLMALLPILVACKAQDGSSDTAPAPAPAAETATAPAATPATDAAAPPAVGESANAPATDTAAAPPAPAPRAPN
    GPEPVAGTDYLDIEGGQPYQQAAGKIEVAEVFGYV
    CPACNAFQPLIGPWKAGLPSDVHFVYVPAMFGGPWDDYARAFYAA
    ETLGVQEKTHDALYKAIHVDQSLKGERGKDSVQDIAGFYAKYGVDSKTFIDTMSSFGVSAKTNRAKQFATRSKITGTPSL
    IVNGKYLVKGQSFPDMLRIADHLIARERATLAK

    >gi|21232973|ref|NP_638890.1| hypothetical protein XCC3544 [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MHYDVIIIGGSYAGLSAGLQLARARRRILVLDSGLRRNRFAATSHGFFSRDGESPAQIAAHGRTQLRAYPDVHWADAEVT
    QVDGTAEAFRVTLGNGGAHMARRLIIATGVVDRLPDIPGLAERWGKQIFV
    CPYCHGYELEQGRIGVLATSAFAVHQAAML
    PDWGVTRLFLNDALVLDAKQNAQLQARGVTLVPGAVARIQGDDAHVEVVLRDGQTTQLDGLFITTQTHISPVVTAMGCAL
    ADGPLGSHVAVDAMQATSVPGVFACGDIASPAASVTFAVASGAMAGVAAHRSLIFGLPA

    >gi|21233080|ref|NP_638997.1| methionine sulfoxide reductase B [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSQFDLTPPSPAQRDALIAGLSDEEQRVLLHHGTEAPFCGVFLDNKLDGVYTCRLCGLPLFRSNAKFDSGTGWPSFFAPY
    DPAHVREIRDTGYGMIRTEIVCARCDSHLGHVFPDGPPPTGERH
    CLNSVSLAFTEDGQPLPNPLQRAGADTQPA

    >gi|21233205|ref|NP_639122.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGKLKVAKVNVDQNRALAIKYHVRSIPMLL
    LFKDGEVQASQIGAVGKGQLTQMIDKTLGGAAA

    >gi|21233251|ref|NP_639168.1| disulphide-isomerase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MKLSCRRPRPLSIALLAVLATLTACDKPTPSAHAQASPTAAPAAHAGIAWREGGLEAAFAEARDSGKPILLYWGAAWCAP
    CNRLKATLFQDPAFIAQTRHFVAVHLDGDAEGTLDWGERFGIKGYPTIIVLRSDRSEVTRLAGNSDTARLADVLRVVATS
    TTTVKQLLDKAQHAPQELSADDWAVLGNYGWGMDDSLVKSGELPALLARLSERAPQPSLRRRFALAAIVAPEDPPTPSPA
    NRAVLEAILADPAEVRANLSTLNYVPAWLVKAGSTDAGQRASLSAKLDQALDAVYADPGVPINDRLETAFAKIELARLAQ
    GQPTETAPKEPQPPLPAAVVETVHQRVQTIVAAARTAEEHQSITDSAAALLSEVGDSSGAEQLLLAEVGRSKTPYYYMPR
    LSQLAEERGDRKTALSWLKKNYTTASSPVARAQSGARYADGLIRLSPEDSAAIEAVATQAIGALAAQSDADRQRSRKRFA
    RLGSALKTWSKQHQQEGTAVLARLRQKMQASCGGKNTSECTSWLS

    >gi|21233314|ref|NP_639231.1| mercuric reductase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MTATRYDAIVVGAGQAGPSLAVRLAERGQRVAVIERHLVGGTCVNTGCMPTKTLVASARVAHLARRAGDYGVRIAGPVEV
    DLPQVMARAHAISDAARTGVEQWLAQTPGVQLIRGHARFVAPDRLRVGAQELGAPRIFLNVGGRARTPELPGLDQISPLN
    NTSILQLRTLPQHLVVIGGSYIGLEFAQIFRRLGAQVTVVEQHAHLIGREDADISEAIAQMLQDEGIAVRTDARCIAFAA
    HADGAAVQLECAQGAPQIVASHVLLALGRQPNTDDLGLEAAGIATDAQGYVQVDMQLATNVPGVWAMGDCNGRGAFTHTA
    YNDYEILAANLLDGAERRLSQRVPAYALFTDPPLGRVGMSETQARASGRPLLVAQRPMQQVGRARENGETIGMMKLVADA
    QTRRVLGAAILGLHGDEAIHGIIDLINADQPIDTLEWAVPIHPTVSELWPTLARALAPAQ

    >gi|21233405|ref|NP_639322.1| thioredoxin [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MQTITVTSPEHYTEVLAAHPRALVDFYKDNCPGCKMLDMSLDKFSASDAAAGVALLKVKLEVVGEEFFRDLGLRQTPTLA
    LYRDGSEVARLPGFQSPAQVETAVKTSL

    >gi|21233485|ref|NP_639402.1| cytochrome C biogenesis protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MARRFPWLWLGLLAACILVAVLAWQNQQLRTQQQWLQTRVTAPYAGMYVPTIAAPGVDGRSYTLGAAQGQPQVLFFFTTT
    CPYCRRSAPTVVRAARQLQANLPGRPQLLGVCHCDPAQAARYAHVHGFDFPVVTLTDRRALMLFRARNVPLVMAVDGEGR
    VRHSHVGLFDTTERVQDLVAALRRTDAPAALATVKE

    >gi|21233630|ref|NP_639547.1| glutathione peroxidase [Xanthomonas campestris pv. campestris str. ATCC 33913]
    MSQSIHDIPVTDINGGATSLAAHRGKVLLVVNVASKCGLTPQYEGLEALYRDKQAQGLEVLGFPANDFNGQEPGSEAEIA
    QFCQLTYDVTFPLFSKIAVTGAEIHPLYQALTSAQPQATGDGPMREKLAGYGIAANPAPGVLWNFEKFLIGRDGQVIERF
    APDVAADDVRLRQAVDAALAH