Xanthomonas campestris 8004 uid57595

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|66766433|ref|YP_241195.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
    MAFVREYAAQAPDRSAVDAQPGLQVLEFGTDWCGHCMAAQPLLQKLLGGYANIEYRKIEDGKGRPLGRSFRVKLWPTIIL
    LRDGEEVARAVRPQTREDLQAVLSALEAVG

    >gi|66766557|ref|YP_241319.1| hypothetical protein XC_0212 [Xanthomonas campestris pv. campestris str. 8004]
    MRQFPPASSTVISVNFEELQAFVGRNPMLSLALVGLTIAIIVTEIARLFRGYRALKPAELTRLINSENALVIDLSPTADF
    EKGHIAGSRNVALAKFDPAGKLLANAKSSPVVVV
    CRSGNASAGAAKTLKKAGFEQVYWLEGGIAAWQMAELPLVKGRA

    >gi|66766619|ref|YP_241381.1| organic hydroperoxide resistance protein [Xanthomonas campestris pv. campestris str. 8004]
    MASPEKVLYTAHATATGGREGRAVSSDSALDVKLSTPRELGGAGGDGTNPEQLFAAGYSACFIGAMKAVAAQDKLKLPGE
    ISIDGSVGIGQIPGGFGIAVELKIAVPGMEPAELQALVDKAHQV
    CPYSNATRGNIDVTLTLA

    >gi|66766839|ref|YP_241601.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas campestris pv. campestris str. 8004]
    MSTLVSLPTAAPAPDYQSIDRPLNFSNAAAAKVRELIQEEGNAELALRVYIQGGGCSGFQYGFEFDENRAEDDLAVATDG
    VTLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV

    >gi|66766870|ref|YP_241632.1| c-type cytochrome biogenesis protein [Xanthomonas campestris pv. campestris str. 8004]
    MKSLSRWIARCAVLVAPLFVALPLLLTAPAAQAVTEADLLPVDQAFALSAKADGRDRIALTWKIAPGYYLYRHRISVKSG
    QGFTAGALDLPEGESKHDEFFGQVQTYRTALQASLAGKAAPGQRSAILQVQYQGCADAGVCYPPQRRELRVDLPDAPTTA
    PPRESLGALVPRGPSGARLFGAPGQTAGVDALPLPADQAFNFEAIVGDGNSLLLRFTPAPGYYLYRDRTSLSLEGTSDIR
    TGLPRWPQGRTHRDEHFGDVVVYFDQAEVTLPLLRDRPDPARVTLVATFQGCQSDGICYPPMTRRVRLDLPAGTVSPHNQ
    ATATPLLISPLSAGEVAAERAAPGPPADAAPGPDATAGNPERSRPPHLERNLLAILLLALAGGLVLNLMPCVLPILSLKV
    LGLAHSGESRNHARSHAIWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQQPWFVAALAYLMFAVGLSLSGVFTLGSN
    LGGIGQSLAARNGPLGDFFTGVLACVVASPCIAPFMGTALAYAFTAPAPLAMLVFLTLGLGLALPFLLIGFIPSLARRLP
    TPGAWMETLKQVLAFPMYLTAIWLLWVLGKQRGVDALALMLVGATLLALGLWWFERSRWNSHRLGMGLAAAMLVLAIVPV
    VAVTRLSLPRATATEGSVTYTPELLDRLRADNRVVFVNMTADW
    CVTCKANEKNVLSSTDFRDALRRVDAVYMKGDWTNVD
    PKISAFLDQHQAVGVPLYVVYGPGAPPAVLPTVLTGAITEDALLRAAR

    >gi|66766954|ref|YP_241716.1| hypothetical protein XC_0616 [Xanthomonas campestris pv. campestris str. 8004]
    MHYDVIIIGGSYAGLSAGLQLARARRRILVLDSGLRRNRFAATSHGFFSRDGESPAQIAAHGRTQLRAYPDVHWADAEVT
    QVDGTAEAFRVTLGNGGAHMARRLIIATGVVDRLPDIPGLAERWGKQIFV
    CPYCHGYELEQGRIGVLATSAFAVHQAAML
    PDWGVTRLFLNDALVLDAKQNAQLQARGVTLVPGAVARIQGDDAHVEVVLRDGQTTQLDGLFITTQTHISPVVTAMGCAL
    ADGPLGSHVAVDAMQATSVPGVFACGDIASPAASVTFAVASGAMAGVAAHRSLIFGLPA

    >gi|66767100|ref|YP_241862.1| thiol:disulfide interchange protein [Xanthomonas campestris pv. campestris str. 8004]
    MKTRFALTLMALLPILVACKAQDGSSDTAPAPAPAAETATAPAATPATDAAAPPAVGESANAPATDTAAAPPAPAPRAPN
    GPEPVAGTDYLDIEGGQPYQQAAGKIEVAEVFGYV
    CPACNAFQPLIGPWKAGLPSDVHFVYVPAMFGGPWDDYARAFYAA
    ETLGVQEKTHDALYKAIHVDQSLKGERGKDSVQDIAGFYAKYGVDSKTFIDTMSSFGVSAKTNRAKQFATRSKITGTPSL
    IVNGKYLVKGQSFPDMLRIADHLIARERATLAK

    >gi|66767101|ref|YP_241863.1| disulfide oxidoreductase [Xanthomonas campestris pv. campestris str. 8004]
    MNLFSRLSLLLLILLPLAACAADKKAPPVEGEDYVLIDGGQPYAPLAGKVEVAEVFGYTCPHCAHFEPTLEAWTAKQPAY
    VRVTPVPAAFGGFWDAFARAYFAADTLGVAKRSHRAMFDAIHEKHTVPTQNVAPEELAAFYVAYGVPQQRFIDTLKSAAV
    EDKVKAAREFATRAKIPGTPALVVNGRYLITARDYTDMLRVADYLIAREHAAPAAR

    >gi|77761114|ref|YP_241891.2| glutaredoxin-like protein [Xanthomonas campestris pv. campestris str. 8004]
    MSLDPALRSRIDTLLQSNRVVLFMKGQPGMPQCGFSAKAIGVLDGLGIDYAHVNVLADQEIREGIKAYGDWPTIPQLYVD
    GELIGGSDIIVQMADSGELSSMLGLQAPDRSPPKITITPAAVEMLKGALADAPDASLTLAIDANFQPNFQLAPTNPNAIA
    AESNGLRVQFDLASARRADGITIDWVDDIRGRGLAIDNPNAPKPVQELAVRDADDRLKAGTLTVVDVRPADERALATVAA
    PFRTLDAHERLEIEQLPKDTPLAFL
    CHRGGRSLQAAEHFRGLGFTNVYNVTGGIDAWSDAVDNGVPKY

    >gi|66767695|ref|YP_242457.1| osmotically inducible protein [Xanthomonas campestris pv. campestris str. 8004]
    MGISRHATAHWEGDLKTGKGQLSTPQSGLMENTRYAFSSRFGDEKGTNPEELIAAAHAGCFTMALSAQLTEAGFPPTSLD
    TRADVDLSMEGGPQLSQIRLKLKAMVPGIDEAKFRELADTAKKN
    CPVSKALSAVPISLETEFSS

    >gi|66767726|ref|YP_242488.1| hypothetical protein XC_1400 [Xanthomonas campestris pv. campestris str. 8004]
    MSDRAVSVVTGAVPYTVTVHDGQHRWIGDTQPANGGQDAGPDPEAQVLGALGACTAITVSMVAARKQWPLAAVHVHLHYT
    QRGAAGTSITRAIVLDGALDDDQRARLLEVAEKCPIHRLLTGEVRIATELQPHALVDAAGGSTR

    >gi|66767790|ref|YP_242552.1| 6-O-methylguanine-DNA methyltransferase [Xanthomonas campestris pv. campestris str. 8004]
    MSTLHYDTFPSPIGALTVAADTTGVRHILFAQNRHDAPGRALWQHGPDAPLVQAAREQLLDYLYGGRRSFDLPLAPAGTP
    FQLQVWQTLARIPFGETWSYAQLAQAVGRPAASRAVGAANGRNPLPIVLP
    CHRVIGASGALTGFGGGLPTKQALLQLEGW
    SPQASARRVAAVVGEDLFAR

    >gi|66767821|ref|YP_242583.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
    MSDKAHVFDVTTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAADYNGAFELAKVDVDKEQQIAAAFQIRSV
    PTVFLVKGGELVDGFPGAMPEGQIREFLTQHGVLPAEPQVAEEVPLAPLDPQAQVAALREAIAAEPDKDELKLDLALALL
    KTGDTLEAEQLIDALPANLATDDRAVRAKARLGFANVLKDAPDAAALQTTVAADGSDLHARHLLGVRHLLDGDDEAALEQ
    FLEMLRQNRGFEDNLPRRSLIDAFRVIEDEDLVGRYRRKMSALLF

    >gi|66767863|ref|YP_242625.1| reductase [Xanthomonas campestris pv. campestris str. 8004]
    MSARYDYDVVVLGGGSGGLAAAFRAAKHGARVAIMEPGELGGTCVNLGCVPKKAMWLAADLASKIELAGALGFDVVRPTL
    TWQELVTHRQGYIGNIHASYRRRLDDDGVVLIPQRGVLQDRHTLMGADGVPVTAEHIVIATGAHPLRPHVEGAEHGHVSD
    DFFNLCHAPDHVAIVGGGYIAVEIAGLLQALGSRVHLFVQGERLLERFDAELTLQLADNLRHLGVRLHFGFRTTGVQRDD
    TGKLRMRGHSAHPGELGNDVFDQVFFAIGRLANTAGLGLEALGVELGKKGEIVVDDGQTTNVPNIHAVGDVDGKVGLTPV
    AIAAGRKLMDRLFGGQPDARMDYDNVPSVVFSHPPLGAVGLTEEQARERYDGAVRVYRSNFRPMLHALADAPQRSVFKLV
    CVGEEERVVGVHLLGESADEMLQGFAVAVKMGATKRDFDETVAIHPTSSEEIVLMH

    >gi|66767940|ref|YP_242702.1| hypothetical protein XC_1616 [Xanthomonas campestris pv. campestris str. 8004]
    MPVMERIQAEVEQHPIVLFMKGTPQFPMCGFSSRAVQALVAAGADQLRTVNVLEEPEIRANLPRYSNWPTFPQLFIHGEL
    IGGCDITMELFEAGELKRIVSEAYQP

    >gi|66768116|ref|YP_242878.1| stringent starvation protein A [Xanthomonas campestris pv. campestris str. 8004]
    MATSVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTYDLVSVDPQNPPEDLIDLNPYHSVPTLVERDLVLYAASVVSEYLD
    ERYPHPPLMPVDPLSRARLRLAMLRIEHDWVPQVQAIQLGNKTQAEAGRKRLKELLTASVPLFKASKFFLNPEMSLADCA
    MAPIIWRLDALEISLPKDSKAIEDYGNRIFRNPGFIRSLTDQEKKLRDMPG

    >gi|66768152|ref|YP_242914.1| hypothetical protein XC_1831 [Xanthomonas campestris pv. campestris str. 8004]
    MTHLQFDNRLRAELPGDPEEGPRRREVLAAWSAVQPTPVAAPTLLAYSADVAQRLGLRAEDLASPRFAEVFGGNALYPGM
    QPWAVNYGGHQFGHWAGQLGDGRAISLGEAIGVDGGRYELQLKGAGPTPYSRGADGRAVLRSSIREFLCSEAMHYLGVPT
    TRALSLVGTGDAVVRDMFYDGHPRREPGAIVCRVAPSFIRFGNFELPAARGDVDLLRQWVDFTLARDFPDLPGSGEDRIA
    SWLGQVCERTAVMVAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWVDDYDPDWTPNTTDAQGRRYRFGTQPQVAYWNLG
    RLAQALSPLFGDAAPLQAGLDQFRDTYLACDRRDTAAKLGLAECQDEDLHLIDDLRALMREAEMDMTLTFRGLVDLSPQQ
    PDASVLREAFYDETKRAAQAPALGAWLQRYAARCLQDGASDAVRASRMRAANPRYVLRNYLAQQAIDQAEQGDLSGVHAL
    LEVMQRPYDDQPRRESFAAKRPDWARDRAG
    CSMLSCSS

    >gi|66768213|ref|YP_242975.1| c-type cytochrome biogenesis protein/thioredoxin dsbE or [Xanthomonas campestris pv. campestris str. 8004]
    MSDPRTSRLPTAVLVGAGILLLALAALLVYAVVRSGNDDRDALPSALIGKPAPEFALPLLHDPSIIVHARELRGAPYIIN
    VWGSW
    CPACREEHPVLSRFALTKRVRVIGYNWKDERADALRWLEQLGNPYLLVVADTDGRTAIDFGIAAAPETFLVDGRG
    VVRWKYSGMLTQSIIDTQLIPALTRIERSPSAAPDLHTAR

    >gi|66768320|ref|YP_243082.1| hypothetical protein XC_1999 [Xanthomonas campestris pv. campestris str. 8004]
    MAAGRYRRAPDRGQTHPRLTGLGHNHCMTAQLTQELPEFPTWLNARPSTLQEHRGRALVLAFVNASSVWCAERLAELARW
    QARSPGRLQVIVVQVPRFDSERMPQRSLKQLRGHGVSAPILLDKDWETWRRFGIESWPTLVLLDAYGRERQRLVGVTGDL
    DKALAALCEGQQPPSDADLHGVAERDPEPRLALRFPTGLAATEDRLYIADTGHHRILECTHSGRVLRQFGHGNADLIDGG
    VGEAAFRRPQGLALEREELYVADTGNHALRRINLRSGQVDTLCGTGRSGEPIEGPLASAGASPLNYPQGLAVADNQLLIA
    MAGDNRIWSYHLGRAALSARAGTGSLEIRDGSGHLAAFAQPAGLAAVQQVAYVCDGLGSSIRTMQLRGDLVQTLVGGQGT
    WQFGEDDGPRSAARLQFPQAIALAADSPMLWVADTGNGRLRCLRLGGGELTTVALPRRLHGPAGLAVAGGAVWIAETDAH
    AVLRYDLATGALSDVSIDE

    >gi|66768509|ref|YP_243271.1| molybdopterin biosynthesis protein MoeB [Xanthomonas campestris pv. campestris str. 8004]
    MSHDLSPAQARARALRGALLIDIRQPHERVSGQAEGALAIAQADLEQAPAQHLPDRDRDILLICQSGKRSAQTAAQLREQ
    GYPHALSVLGGTTAWSRDGLPLVRPTLPSDETDFLERYSRHLRLPQVGIDGQQRLARARVLLIGAGGLGSPAAFYLAAAG
    VGHLRMADDDVVDRSNLQRQILHTEDSVGMAKVVSAAQRIAALNPRVQVDAIQTRVTASNIEALLQDVDVVVDGADNFAA
    RYLLNDACVKLGKPLVYGAVQQFEGQLSVFDAGRHRGQLPCYRCLFPEPPPPEFAPS
    CAEAGVLGVLPGVIGLLQATEAI
    KLLLGLGDSLAGRLLSFDALAMRFREIRLPPDPQCPVCAPGTAFPGYADYATFCGTPA

    >gi|66768527|ref|YP_243289.1| thioredoxin reductase [Xanthomonas campestris pv. campestris str. 8004]
    MSASSASPAKHSRLLILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPGDPHGLMGPDLMSRMQAHAER
    FDTEVIFDHIHTADLSQRPFRLIGDSAEYTCDALIIATGATAKYLGIPTEEAFKGRGVSA
    CATCDGFFYKDQDVVVVGGG
    NTAVEEALYLSNIARKVYLVHRRDTLRAEKIMQDKLFAKVAAGKIETVWHHAIEEVLGNDAGVTGVRVKSTLDGSTRDID
    AHGFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLNGAATETSVAGVFAAGDVADQHYRQAITSAGFGCMAALDAERYLDK
    SA

    >gi|66768804|ref|YP_243566.1| bacterioferritin comigratory protein [Xanthomonas campestris pv. campestris str. 8004]
    MTDAVLELPAATFDLPLSLSGGTQTTLRAHAGHWLVIYFYPKDSTPGCTTEGLDFNALLPEFDKAGAKILGVSRDSVKSH
    DNFCAKQGFAFPLVSDGDEALCRAFDVIKEKNMYGKQVLGIERSTFLLSPEGQVVQAWRKVKVAGHADAVLAALKAHAKQ


    >gi|66768809|ref|YP_243571.1| hypothetical protein XC_2501 [Xanthomonas campestris pv. campestris str. 8004]
    MQGLIEQYGLALVFANVLALSLGLPVPAMPTLVLVGAGYALHGGSAAWSAALAALAVSVFASVLGDLVWYLAGRRFGNRT
    LQSLCRLSLSRDTCMKKTERFFGRWGVRVLAVAKFVPGLSMVSVPMAGAMQVRPGAFLRYDAFGALLWAAVGLGLGALFA
    DQVQDVLHFLSTLGSGAVLVVALLLAGYVGWRWWRRHTLLRSLETARIAVEELVPMLAADEAMRPAVLDIRAQGFRDLQP
    YTIPGAVFADERELAQILATVPRDRSVVIY
    CACPDEVSAAWLAGRLRERGYRDVRPLLGGLDAWRDAGHPVVSLVPLATL
    APTGEAGALA

    >gi|66768881|ref|YP_243643.1| C-type cytochrome biogenesis protein/thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
    MNRLLPLLGFLALAALFGFGIYWTMQHNPRDVPSPLIGKPAPAFSLPLLDQPQQQITRDQLLGKPYVLNVFGSWCAACAQ
    EHPVLMAHGRTLGVALIGYNYKDAPADANAWLAQHGNPYGMVIADEPGQTAIDFGVYGAPESFLIDAHGIIRYKHIGVLT
    PEVIRNELMPAIAGLSQGAP

    >gi|66768979|ref|YP_243741.1| hypothetical protein XC_2672 [Xanthomonas campestris pv. campestris str. 8004]
    MPLLCWSARMTISLTPAALERVQRFVQQTPGALGLRFGVTKTGCSGWGHITDLAREKRDDDAVFEQGGVSIFVDPTSLPL
    VDGTCIDFGKHGLSETFTFSNPNATAECGCGESFTTEAEHR

    >gi|66769004|ref|YP_243766.1| thiosulfate sulfurtransferase [Xanthomonas campestris pv. campestris str. 8004]
    MSAEPDWTTLVDSATLAAALQHPQLRLLDARAAPPTAPDPGAAQRDYAQGHLPGAHFANLHDALADVSRPGQGRHPLPHS
    DVFAAQLGRWGITPDSQVVVYDAADGSMAAARAWWMLRLMGHRRVAVLDGGLAAWRAAGLPETTAVPSPADSGAYPGSFD
    ADAVVDAEAILARLDAAPGWLLDARAGERFRGEVEPIDPVAGHVPGAVSRPLGMSLRDGRFKPAAELRAELGALLCDYAP
    EQAVVM
    CGSGVTACHLLLALEVAGLSGARVYAGSWSGWLQDRSRPVAVASQLQAQ

    >gi|66769042|ref|YP_243804.1| ABC transporter vitamin B12 uptake permease [Xanthomonas campestris pv. campestris str. 8004]
    MSLNRLLVLVFAGLFSTAAVAAGTSVLDLDYRPLAGKAPINLNRSYGGKVVMVVNTASKCGFTPQYEGLEALNQRFGSRG
    FTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKVHVLGAQATPLYQRLTRETGVAPGWNFHKYLIGRNGHVVAQ
    FPSKVKPDDPQVLAAIERELKAPAR

    >gi|66769058|ref|YP_243820.1| dihydrolipoamide dehydrogenase [Xanthomonas campestris pv. campestris str. 8004]
    MSEQFDVVVIGAGPAGYHAAIRAAQLGMKVACIDAAIGKDGKPALGGTCLRVGCIPSKALLDSSRQFWNMGHLFGDHGIS
    FNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPYYGFGQLQPGNIVKVTQHEGGEIELKGTNVILAAGSESIELPF
    AKFDGDTIVDNVGGLDFTAVPKRMAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALADAEVAKTALKEFKKQGLDIK
    LGAKVSKTEITGSGDAKQVVLSYTDAAGEQTLTVDKLLVAVGRKAATKNLLADGTGVKLTERGQIEVDGHCHTGVDGVWA
    IGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWVIYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAM
    GEPAGFVKVIADAETDRVLGMHLVGVGVSELVHEGVLTMEFSGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN

    >gi|66769114|ref|YP_243876.1| glutathione S-transferase [Xanthomonas campestris pv. campestris str. 8004]
    MRPPLTVHGMSSSGNCYKVRLLLEQLGSRYHWVEVDSVSGETRTPEYLAKNPNGKVPMVERDDGRVLTESNAILFWLAEG
    TPYLPTDTWQRAQALSWMFFEQYSHEPYVAVARFISLWTPRDAARRAELPQLRARGEQALGVMEQHLRQHAWFTGADYGI
    ADIALFAYTHCAEDGGFDLERWSAIDGWLQRVRALPGFVAMPAPVSA

    >gi|66769132|ref|YP_243894.1| glutathione peroxidase-like protein [Xanthomonas campestris pv. campestris str. 8004]
    MTTLSTYQFTDLDGQPQSLAEYAGKVVLVVNVASKCGFTPQYAGLQALWQRYRDRGLVVIGFPCDQFGHQEPGDAADIRQ
    FCSLDYAVDFPLAAKVEVNGSGAHPLWQWLKHEKRGVLGSEAIKWNFTKFLIGRDGSVLERYAPTTKPEALAADIERALG
    A

    >gi|66769158|ref|YP_243920.1| hypothetical protein XC_2852 [Xanthomonas campestris pv. campestris str. 8004]
    MTTVYGLKNCDTCKKATKWLDRFGVAYTFVDYREHTPAPDTLLEWAGKAGGFDALINKSSTTWRQLPDNKKTPGSEAEWK
    LLLREYPQLIRRPVVLTDDGTLSQGFSDNGFKARFAVG

    >gi|66769267|ref|YP_244029.1| polyketide synthase [Xanthomonas campestris pv. campestris str. 8004]
    MHTPVMRIDIWSDVVCPWCWIGKRRFEQAVATLGERLPALEIHYHAFQLDPDSGLQPVPLREALLPKFGSAERTEQLLAQ
    TQQTARAEGLPFDFSRGQVQVTTLPAHRLIWLAAREGDVEPVIEALFHAHFAEGKNLAAADTLIAAGAAGGLAPARVQAL
    LASDEGSAQVQAQLLQAAQIGIRAVPSFVIDGRSLLQGAQPADVMAQALLQLAAESAPAAATGDACGPDGCAI

    >gi|66769368|ref|YP_244130.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
    MTDTPLLVACPSCAAMNRLPPSRLRDAPKCGSCHTALFLGTPVALSSADFDKHAVRSELPLLVDFWAPWCGPCLSMAPQF
    AAAAASLEPQLRLAKVDTDLHPVLGTRFGIRSIPTLLILRNGKELARQSGAMGSTQIIAWARSVLSSH

    >gi|66769502|ref|YP_244264.1| peroxiredoxin [Xanthomonas campestris pv. campestris str. 8004]
    MTIQVGDRIPEVVLKHLREGIEAVDTHTLFTGRKVVLFAVPGAFTPTCSAKHLPGYVEQFEAFRKRGIEVLCTAVNDPFV
    MQAWGRSQLVPDGLHLVPDGNAELARALGLEIDASGSGMGLRSRRYALYADDGVVKALFVEEPGEFKVSAADYVLQHLPD


    >gi|66769571|ref|YP_244333.1| hypothetical protein XC_3269 [Xanthomonas campestris pv. campestris str. 8004]
    MSGSDDGSADRLREFTDFRQRMNQRILAEPNQVVRRFFALDTQTYQAGALDVKTKELLGLVASMVLRCDDCISYHVAQCK
    EAGVTREEFFETFSVGLVVGGSIVIPHLRRAVDFLDQLEGGAPAPAEHSHG

    >gi|66769572|ref|YP_244334.1| glutaredoxin [Xanthomonas campestris pv. campestris str. 8004]
    MRAARRVGVNRQLIHSVAVTTSKFQSPVTICQTTDPTTEFPVSQDHTGQQAATGPQITLYSTAICPYCVAAKNFLKSKGQ
    TWTEVRIDLDPAERDKMVALAKRTSVPQIFVGDIHVGGYDDMMAMHRAGKLEPLFAAAGGQA

    >gi|66769616|ref|YP_244378.1| disulfide bond formation protein B [Xanthomonas campestris pv. campestris str. 8004]
    MNPFRWGFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFATLALLFLLGALHGPRGAGGRKAYGVLAFIAA
    GVGMGIAARHVWVQIRPKDMMSS
    CGPPLSFLSETMGPFEVFRTVLTGTGDCGNIDWRFLGLSMPMWSMVWFVGLALWALY
    AGFKHRGPRKLF

    >gi|66769671|ref|YP_244433.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
    MTLRSLMRGACALLLPLVLLTACKPTGEGTSTTASPAPTPANQAPATPPAGTDPAAVSTTSSVVQKTAEMPTLSLPTVSG
    ETYDLAAHRGKWVVVNFWATW
    CAPCLKEMPELSALHTMRDSIEVVGLAYEDITTADMQSFLKDHPVSYPVAILDPYQPPQ
    DFATPRGLPMTYLIGPDGKVAKQFLGPVTARDIETAVGITGKAG

    >gi|66769698|ref|YP_244460.1| alkyl hydroperoxide reductase subunit C [Xanthomonas campestris pv. campestris str. 8004]
    MSLINTQVQPFKANAYHNGNFIEVTEASLKGKWSVLIFMPAAFTFNCPTEVEDAADNYAAFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAQFPLIGDPAHKLTRAFGVHIEEEGLALRGTFIINPEGVIKTLEIHDNSIARDVTETLRKLTAAQFVAN
    NPGQVCPAKWKEGAKTLAPSLDLVGKI

    >gi|66769699|ref|YP_244461.1| alkyl hydroperoxide reductase subunit F [Xanthomonas campestris pv. campestris str. 8004]
    MLDANLKTQLTAYLERVTRPIQIHASIDDIPKAREMLELLEDLVLLSDKISLDVHRDDNQRKPSFALTTPGQDISVRFAG
    LPMGHEFTSLVLALLQVGGHPSKATAELIEQVQHLDGDYQFETYFSLS
    CQNCPDVVQALNLAAVLNPRIKHVAIDGALFQ
    DEVETRQIMSVPTVYLNGELFDQGRMTLEQIVAKLDTNAAKRDAAKIAAKDAFDVLVVGGGPAGSAAAVYAARKGIRTGV
    AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADGLVEIKLANGASLKSKTVILS
    TGARWRQMNVPGEDQYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLR
    SLHNVRIITSAQTTEVLGDGQKVTGLVYKDRTGGDTQHIDLEGVFVQIGLLPNTEFLRGTVELSPRGEIIVDDRGQTNVP
    GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRSSAPVSADVAQAA

    >gi|66769704|ref|YP_244466.1| methionine sulfoxide reductase A [Xanthomonas campestris pv. campestris str. 8004]
    MLGIGAFKQRMPRSGEALPGRTQALPLHNTHLINGHPLRGEFTGLAQVQFGLGCFWGAERKFWNVPGVYTTAVGYAGGKT
    PNATYSEVCSGQTGHTEAVLVVYDAQAVSFEQLLRTFWESHDPTQGMQQGSDVGTQYRSAIYCSTQAQYDAAIASRDAYQ
    QQLTAAGYGDITTEILYPAPTFYYAEDDHQQYLAKHPNGYCGLGGTGVSCPIGLDA

    >gi|66769849|ref|YP_244611.1| arsenate reductase [Xanthomonas campestris pv. campestris str. 8004]
    MHAVIYHNPACGTSRNTLALIRHVGIEPQIIEYLRDPPTRATLQALIAEAGLSVRDALRQKGTPYLELGLDDPALDDAAL
    LSAMLAHPILINRPFVRTDRGVRLCRPSEQVLELLPAATSGFIKEDGERVLDEAGRRVSQ

    >gi|66769879|ref|YP_244641.1| disulfide isomerase [Xanthomonas campestris pv. campestris str. 8004]
    MYRLAIAALLGAISLTACAQSSQPAASNTAAKPAAAPATGNVDQRVGAALKALDPDFKPDYIGAAPFPGFREVVVGGQVL
    YVSDDGRYLIQAQPFDIQNKQFAASEGLLAYRRKQLQTVPKADRIVFAPANPKYTVTVFTDVE
    CGYCRKLHSEIGELNKQ
    GIAVEYLAFPRMGLGSQDHKEMIAVWCAADRKQALTAAKSGQPVNAKDCKNPVSMEYTLGQRLGVNGTPAIFAPDGTQLG
    GYLPPAQLREALEKRAVTTAGGSR

    >gi|66769987|ref|YP_244749.1| dihydrolipoamide dehydrogenase [Xanthomonas campestris pv. campestris str. 8004]
    MPAPPVKPQEKQMAVIEIKVPDIGDYSDVPVIEVLVAVGDSVVKDQGLVTLESDKATLEVPSSAAGVVKELKVKIGDNLS
    EGAVVLLLETEGEAAAAPAAPKAETKAETKAAAPAAAPAAAAPGSKPPVTPSHRAPAEPAASKPALASGKAADIECKMVV
    LGAGPGGYTAAFRAADLGLDTVLIERYASLGGV
    CLNVGCIPSKGAAARRRGDR

    >gi|66770020|ref|YP_244782.1| methionine sulfoxide reductase B [Xanthomonas campestris pv. campestris str. 8004]
    MSQFDLTPPSPAQRDALIAGLSDEEQRVLLHHGTEAPFCGVFLDNKLDGVYTCRLCGLPLFRSNAKFDSGTGWPSFFAPY
    DPAHVREIRDTGYGMIRTEIVCARCDSHLGHVFPDGPPPTGERH
    CLNSVSLAFTEDGQPLPNPLQRAGADTQPA

    >gi|66770147|ref|YP_244909.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
    MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGKLKVAKVNVDQNRALAIKYHVRSIPMLL
    LFKDGEVQASQIGAVGKGQLTQMIDKTLGGAAA

    >gi|66770193|ref|YP_244955.1| disulphide-isomerase [Xanthomonas campestris pv. campestris str. 8004]
    MKLSCRRPRPLSIALLAVLATLTACDKPTPSAHAQASPTAAPAAHAGIAWREGGLEAAFAEARDSGKPILLYWGAAWCAP
    CNRLKATLFQDPAFIAQTRHFVAVHLDGDAEGTLDWGERFGIKGYPTIIVLRSDRSEVTRLAGNSDTARLADVLRVVATS
    TTTVKQLLDKAQHAPQELSADDWAVLGNYGWGMDDSLVKSGELPALLARLSERAPQPSLRRRFALAAIVAPEDPPTPSPA
    NRAVLEAILADPAEVRANLSTLNYVPAWLVKAGSTDAGQRASLSAKLDQALDAVYADPGVPINDRLETAFAKIELARLAQ
    GQPTETAPKEPQPPLPAAVVETVHQRVQTIVAAARTAEEHQSITDSAAALLSEVGDSSGAEQLLLAEVGRSKTPYYYMPR
    LSQLAEERGDRKTALSWLKKNYTTASSPVARAQSGARYADGLIRLSPEDSAAIEAVATQAIGALAAQSDADRQRSRKRFA
    RLGSALKTWSKQHQQEGTAVLARLRQKMQASCGGKNTSECTSWLS

    >gi|66770276|ref|YP_245038.1| mercuric reductase [Xanthomonas campestris pv. campestris str. 8004]
    MTATRYDAIVVGAGQAGPSLAVRLAERGQRVAVIERHLVGGTCVNTGCMPTKTLVASARVAHLARRAGDYGVRIAGPVEV
    DLPQVMARAHAISDAARTGVEQWLAQTPGVQLIRGHARFVAPDRLRVGAQELGAPRIFLNVGGRARTPELPGLDQISPLN
    NTSILQLRTLPQHLVVIGGSYIGLEFAQIFRRLGAQVTVVEQHAHLIGREDADISEAIAQMLQDEGIAVRTDARCIAFAA
    HADGAAVQLECAQGAPQIVASHVLLALGRQPNTDDLGLEAAGIATDAQGYVQVDMQLATNVPGVWAMGDCNGRGAFTHTA
    YNDYEILAANLLDGAERRLSQRVPAYALFTDPPLGRVGMSETQARASGRPLLVAQRPMQQVGRARENGETIGMMKLVADA
    QTRRVLGAAILGLHGDEAIHGIIDLINADQPIDTLEWAVPIHPTVSELWPTLARALAPAQ

    >gi|66770370|ref|YP_245132.1| thioredoxin [Xanthomonas campestris pv. campestris str. 8004]
    MQTITVTSPEHYTEVLAAHPRALVDFYKDNCPGCKMLDMSLDKFSASDAAAGVALLKVKLEVVGEEFFRDLGLRQTPTLA
    LYRDGSEVARLPGFQSPAQVETAVKTSL

    >gi|66770449|ref|YP_245211.1| cytochrome C biogenesis protein [Xanthomonas campestris pv. campestris str. 8004]
    MARRFPWLWLGLLAACILVAVLAWQNQQLRTQQQWLQTRVTAPYAGMYVPTIAAPGVDGRSYTLGAAQGQPQVLFFFTTT
    CPYCRRSAPTVVRAARQLQANLPGRPQLLGVCHCDPAQAARYAHVHGFDFPVVTLTDRRALMLFRARNVPLVMAVDGEGR
    VRHSHVGLFDTTERVQDLVAALRRTDAPAALATVKE

    >gi|66770595|ref|YP_245357.1| glutathione peroxidase [Xanthomonas campestris pv. campestris str. 8004]
    MSQSIHDIPVTDINGGATSLAAHRGKVLLVVNVASKCGLTPQYEGLEALYRDKQAQGLEVLGFPANDFNGQEPGSEAEIA
    QFCQLTYDVTFPLFSKIAVTGAEIHPLYQALTSAQPQATGDGPMREKLAGYGIAANPAPGVLWNFEKFLIGRDGQVIERF
    APDVAADDVRLRQAVDAALAH