Xanthomonas axonopodis citri 306 uid57889

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|21240883|ref|NP_640465.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
    MGFVREYAAQAPERSAVEAQAGLQVLEFGTDWCGHCIAAQPLLQKLLGGYDAIDYRKIEDGKGRPLGRSFRVTLWPTIIL
    LRDGQELARAVRPQTREDLQDLLSVLDAA

    >gi|21240994|ref|NP_640576.1| hypothetical protein XAC0220 [Xanthomonas axonopodis pv. citri str. 306]
    MNFEELQAFVGRNPMLSLALVGLTIALIVTEVARLFRGYRALKPAELTRLINSENALVIDLSPTADFEKGHIAGSRNVAL
    AKFDPAGKLLANAKASPVVVV
    CRSGTTSAGAAKTLKKAGFEQVYWLEGGVAAWQMAELPLIKGR

    >gi|21241056|ref|NP_640638.1| organic hydroperoxide resistance protein [Xanthomonas axonopodis pv. citri str. 306]
    MASPEKVLYTAHATATGGREGRAVSSDKALDAKLSTPRELGGAGGDGTNPEQLFAAGYAACFIGAMKAVAAQDKLKLPGE
    VSIDSSVGIGQIPGGFGIVVELRIAVPGMDKAELQTLVDKAHQV
    CPYSNATRGNIDVTLTLA

    >gi|21241270|ref|NP_640852.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas axonopodis pv. citri str. 306]
    MSTLVSLPTAAPAPDYQSIDRPLNFSVAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFDENRAEDDLAVATDG
    VTLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV

    >gi|21241305|ref|NP_640887.1| C-type cytochrome biogenesis protein (copper tolerance) [Xanthomonas axonopodis pv. citri str. 306]
    MRNRKPMTVLHRIAALCLLALAAFPALAISEKDLLPVDQAFALSATADSRDRIALNWKIAPGYYLYRHRISVKAGKGFAA
    GELALPEGESKHDEFFGQVQTYRKQLQATLAGKADPAVQTAVLQVQYQGCADAGVCYPPQRREIRVDLPAADATGAQATA
    APRENLGALVPRSAAGPRLFGAPGQTAGVDALPLPAEQAFNFEAIVGDGNSLLLRFTPAPGYYIYRDRTSLALEGASGVR
    TGLPRWPQGKAHRDEHFGDVVVYFDQAEVTLPLLRDHPDPAHVTLVATFQGCQTDGICYPPMTRRVALDVPAGIVSPQNQ
    AQASPLMISPLAAGQAPVEPAPAASTAGPVADASAGNPERTPPPHTDKGLLGMLVLALLGGLVLNLMPCVLPILSLKVLG
    LAHSGESRGHARSHATWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQQPWFVAALAYLMFAVGLSLSGVFTLGTNLG
    GIGQSLAARNGPLGDFFTGVLACVVASPCIAPFMGTALAYAFTAPALLAMLVFLALGLGLALPFLLIGFVPSLARRLPTP
    GAWMETLKQVLAFPMYLTAIWLLWVLGKQRGVDALALMLVGATLLALGLWCFERSRWKSHRLGMGLATAMLVLALVPVVA
    VTRLSLPAATATEGVVAFSPQLLDRLRADNRVVFVNMTADW
    CVTCKANEKNVLSSAEFRDALRRVDAVYMKGDWTNVDPA
    ISTFLDQHQAVGVPLYVVYGPGAPPAILPTVLTGAITEDALLRAAR

    >gi|21241493|ref|NP_641075.1| thiol:disulfide interchange protein [Xanthomonas axonopodis pv. citri str. 306]
    MKTRFALTLMALLPILVACKAQDGSSDTAPAATTPAAETAPAPPAVATPAADPAAPPAVGESATTPPPAAPSAAPRAPNG
    PEPVAGTDYLDIDGGQPYQQAAGKIEVAEVFGYV
    CPACNAFQPLIGPWKAGLPSDVHFVYVPAMFGGPWDDYGRAFYAAE
    TLGVQEKTHEALYKAIHVDQTLKGERGKDSVQDIAAFYAKYGVDQKTFIDTMSSFGVSAKTNRAKQFATRSKITGTPSLI
    VNGKYLVKGQSFPDMLRIADHLIARERATLAK

    >gi|21241494|ref|NP_641076.1| disulfide oxidoreductase [Xanthomonas axonopodis pv. citri str. 306]
    MKLLSRLPLLLLLLLPLVACAADKNAAPVEGEDYTLIDGGQPYAPLAGKVEVTEVFGYTCPHCAHFEPVLEAWVAKQPAY
    VRFTPVPAAFGGFWDAFARAYFAADILGVAKRSHRAMFDAIHEKQTVPTQNVAPEELAAFYASYGIPQQRFIETYKSEAV
    DAKLKAAREFALRSKIPGTPAIIVNGRYLIGARNYPDMLRIADYLIAREHAAPAKR

    >gi|21241670|ref|NP_641252.1| methionine sulfoxide reductase A [Xanthomonas axonopodis pv. citri str. 306]
    MLGIGAFKQRLPRPGEALPGREQALPLHNTHLVNGHPLRGEFTGLAQVQFGLGCFWGAERKFWNVPGVYTTAVGYAGGQT
    PNATYSEVCSGQTGHTEAVLVVFDDHAVSFAQLLRTFWESHDPTQGMQQGNDMGTQYRSAIYCTTQAQYDAALASRDAYQ
    QQLTAAGYGEITTEIRFPAPTFYYAEDDHQQYLAKHPNGYCGLGGTGVSCPIGLDA

    >gi|21241676|ref|NP_641258.1| alkyl hydroperoxide reductase subunit F [Xanthomonas axonopodis pv. citri str. 306]
    MLDANLKTQLTAYLERVTRPIQINASIDDSAGSREMLDLLEELVLLSDKISLDIHRDDNQRKPSFALTTPGQDISLRFAG
    LPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLDGDYQFETYFSLS
    CQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQ
    EEVEARQIMSVPTVYLNGELFDQGRMTLEQIVAKLDTNAAKRDAAKIAAKEAFDVLVVGGGPAGSAAAVYAARKGIRTGV
    AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADGLIEIKLANGASLKSKTVILS
    TGARWRQMNVPGEDQYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLR
    SLHNVRIITSAQTTEVLGDGQKVTGLVYKDRTGGDIQHIELEGVFVQIGLLPNTEFLRGTVALSPRGEVIVDDRGQTDVP
    GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRTSAPATADSVAQAA

    >gi|21241677|ref|NP_641259.1| alkyl hydroperoxide reductase subunit C [Xanthomonas axonopodis pv. citri str. 306]
    MSLINTQVQPFKANAYHNGNFIEVTEASLKGKWSVLIFMPAAFTFNCPTEVEDAADNYAAFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAQFPLIGDPTHKLTRAFGVHIEEEGLALRGTFIINPEGVIKTLEIHDNSIARDVTETLRKLTAAQFVAN
    NPGQVCPAKWKEGAKTLAPSLDLVGKI

    >gi|21241708|ref|NP_641290.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
    MTVRLVRSACGLLLPLLLLTACKPASEATPAAGNGAAPAATPQAPTTPATPATPADPAAPPNSSVVQQTAQMPRLSLPTV
    TGETYDLAAHRGKWVVVNFWATW
    CAPCLKEMPELSALHTMRDTVEVVGLAYEDITSADMQAFLKDHPVSYPIAILDPYQP
    PQDFATPRGLPMTYLIGPDGKVAKQFLGPVTARDIEAAVGITGKAG

    >gi|21241763|ref|NP_641345.1| disulfide bond formation protein B [Xanthomonas axonopodis pv. citri str. 306]
    MNPFRWSFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFAALAVFFLLGALHGPRAAAGRKVYGVLSFIAA
    GVGMGIAARHVWVQIRPKDMMSS
    CGPPLSFLSETMGPFEVFRTVLTGTGDCGNIDWRFLGLSMPMWSMVWFVGLALWALY
    AGFKVRRSSVHH

    >gi|21241809|ref|NP_641391.1| glutaredoxin [Xanthomonas axonopodis pv. citri str. 306]
    MEIPVARYHVSDLTPTTEFPVSQDHTDQDAASGPQITLYSSAICPYCVAAKNFLKSKGKTWTEVRIDLDPAERDKMVALA
    KRTSVPQIFVGDVHVGGYDDMMAMHRAGKLEPLLAGSAGGQA

    >gi|21241810|ref|NP_641392.1| hypothetical protein XAC1045 [Xanthomonas axonopodis pv. citri str. 306]
    MSGSDEGSADRLREFTQFRQRMNQRILAEPNQVVRRFFALDTQTYQAGALDVKTKELLGLVASMVLRCDDCISYHVAQCK
    EAGVSREEFFETFSVGLVVGGSIVIPHLRRAVDFLDQLEGGAQAPAQHAHD

    >gi|21241904|ref|NP_641486.1| peroxiredoxin [Xanthomonas axonopodis pv. citri str. 306]
    MTIHVGDRIPEVVLKRLRDGIEAVDTHSLFAGRKVLLFAVPGAFTPTCSAKHLPGYVEHFEQFRKRGIEVLCTAVNDPFV
    MQAWGRSQLIPDGLHLLPDGNAELARALGLEIDASGSGMGLRSRRYALYADDAVVKALFVEEPGEFKVSAADYVLQHLPD


    >gi|21242030|ref|NP_641612.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
    MTDAPLLIACPSCAAMNRIAPTRLRDAPNCGSCHKPLFPGTPVALSAADFDKHAVRSALPLVVDFWAPWCGPCLSMAPQF
    AAAAAALEPQVRLAKVDTDLHPALGTRFGIRSIPTLLVIQGGQELGRHSGAVSSTQIVTWVRSVLSKR

    >gi|21242084|ref|NP_641666.1| polyketide synthase [Xanthomonas axonopodis pv. citri str. 306]
    MLCQSRITTNEPQLMRIDIWSDVVCPWCWIGKRRFQAALAALGAQAPALDIHYHAFQLDPDAGLEPTPLREALALKFGGT
    ARVEQILAQTQATAQAEGLPLDFGRGQVQVSTLRAHRLIWLASHEGDVDAVMEALFHAHFAEGRNVGATDTLVRAGAAGG
    LAAARVQAMLESDEGSVEVQAQLAQAAALGIRAVPSFVIDGRALIQGAQPPESFAQALLQLAAESTPVGGPDACGPDGCA
    V

    >gi|21242184|ref|NP_641766.1| hypothetical protein XAC1431 [Xanthomonas axonopodis pv. citri str. 306]
    MTTLYGLKNCDTCKKATKWLDRFGVAYTFVDYRDHKPEPQTLAEWAEQVGGFDVLINKSSTTWRQLPDNRKAAGSAAEWK
    LLLREYPQLIRRPLVIADDGALHQGFSDNGFKKLFGIG

    >gi|21242209|ref|NP_641791.1| glutathione peroxidase-like protein [Xanthomonas axonopodis pv. citri str. 306]
    MSDISTFAFTDLEGRTQSMRDYAGNVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVIGFPCDQFGHQEPGDAAQIRQ
    FCSLDYAVDFPLAAKIDVNGNGAHPLWQWLKHEQRGVLGSEAIKWNFTKFLIGRDGRVLERYAPTTKPEALATEIERALD
    A

    >gi|21242284|ref|NP_641866.1| dihydrolipoamide dehydrogenase [Xanthomonas axonopodis pv. citri str. 306]
    MSEQFDVVVIGAGPAGYHAAIRAAQLGMKVACIDAALGKDGKPALGGTCLRVGCIPSKALLDSSRQFWNMGHLFGDHGIS
    FNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPYYGFGQLQPGNIVKVTQHEGGEIELKGTNVILAAGSESIELPF
    AKFDGDTIVDNVGGLDFTAVPKRLAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALADAEVAKTALKEFKKQGLDIK
    LGAKVGKTEITGSDDAKQVVLSYTDATGEQTLTVDKLLVAVGRKAATKNLLADGTGVKVTDRGQIEVDGHCHTGVDGVWA
    IGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWVIYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAM
    GEPAGFVKVIADAETDRVLGMHLVGVGVSELVHEGVLTMEFSGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN

    >gi|21242300|ref|NP_641882.1| ABC transporter vitamin B12 uptake permease [Xanthomonas axonopodis pv. citri str. 306]
    MLLNRLLALVLTGFFATPAFAAGTPVLDVEYRPLAGKTPINLNRTYGGKVVMVVNTASKCGFTPQYEGLEALNHRFGSRG
    FTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKVHVLGAEATPLYQRLTQATGVAPGWNFHKYLIGRDGRVVAQ
    FPSKIKPDDPSVLAAIERELKAPAR

    >gi|21242337|ref|NP_641919.1| thiosulfate sulfurtransferase [Xanthomonas axonopodis pv. citri str. 306]
    MSADPNWTTLVDAAVLAAALQHPQLRLLDARAAPPTAPDPHAARKAYAQGHLPGAYYADLDQDLAALSRPAQGRHPLPHG
    AAFAKRLGEWGIDPHTQVVVYDAADGSMAAARAWWMLRLMGHRRVAVLDGGLAAWRAAGFAESTESPAVRDGAAYPGSFD
    TAEVVDAEQIVQRLQQAPGWLLDARAGERFRGEVEPIDPVAGHVPGAVNRPLGLNLRDGRFKPAAELRAELSALLGAYRP
    EQAVVM
    CGSGVTACHLLLALEVAGLSGARVYAGSWSGWLQDAARPVATGA

    >gi|21242369|ref|NP_641951.1| hypothetical protein XAC1619 [Xanthomonas axonopodis pv. citri str. 306]
    MAVSLTPAALERVQRFVQQTPGALGLRFGVTKTGCSGWGHVTDLAREVRDDDAVFEQDGVRIFVDPASLPLVDGTCIDFG
    KHGLSETFTFSNPNATAECGCGESFTTADEHR

    >gi|21242424|ref|NP_642006.1| C-type cytochrome biogenesis protein/thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
    MNRLLPLLGFVLLAALFGVGILRTMQHSPRDVPSPLIGKPAPAFSLPRLDQPEQRVSRDQLLGNPYVLNVFGSWCAECVH
    EHPVLMAQASRLGVPLIGYNYKDVPADATAWLARLGNPYAVVIADEAGQTAIDFGVYGAPETFLIDAQGVIRYKHIGVLT
    PDAINDELLPAIASLPKAAP

    >gi|21242497|ref|NP_642079.1| hypothetical protein XAC1749 [Xanthomonas axonopodis pv. citri str. 306]
    MQGLIEQYGLALVFANVLALSLGLPVPALPTLVLVGASYALQGGSDAWLAGLAALAVSVAASLLGDLVWYLAGRRFGNRT
    LQSLCRLSLSRDSCMKQTERFFSRWGVRVLAVAKFVPGLSMVSVPMAGAMRVRPAAFLRYDAVGASLWALVGLSVGAAFA
    PQVQDVLALLSELGAGAIVVLAALLAGYVGWRWWRRQSLLQSLEHARIAVDELVPLLAGEESLRPTVLDIRAPGYRQLQP
    YTIPGAVFADERQLAQILASVPRDRSVVIY
    CACPDEVSAAWLAARMRERGYRDVRPLLGGLDAWRDAGHPVTSLVPVMVV
    ADANAAAATA

    >gi|21242503|ref|NP_642085.1| bacterioferritin comigratory protein [Xanthomonas axonopodis pv. citri str. 306]
    MTDAVFELPAATFDLPLALSGGTQTTLRDYAGKWLVLYFYPKDSTPGCTTEGLDFNALLPQFKKAGAMVLGVSRDSVKSH
    DNFCAKQGFTFPLISDSDEALCRAFDVIKEKNMYGKQVLGIERSTFLLSPEGHVVLEWRKVKVAGHAEAVLAAVKAHAKQ


    >gi|21242749|ref|NP_642331.1| thioredoxin reductase [Xanthomonas axonopodis pv. citri str. 306]
    MSASSASPAKHSRLLILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPGDPHGLMGPDLMSRMQAHAER
    FETEVIFDHIHTADLSQRPFRLIGDGAEYTCDALIIATGATAKYLGIPTEEAFKGRGVSA
    CATCDGFFYKDQDVVVVGGG
    NTAVEEALYLSNIARKVYLVHRRDTLRAEKIMQDKLFAKVAAGKIETVWHHAIDEVLGNDAGVTGVRVKSTIDGSTRDID
    AHGFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLNGAATETSVAGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDK
    SA

    >gi|21242767|ref|NP_642349.1| molybdopterin biosynthesis protein MoeB [Xanthomonas axonopodis pv. citri str. 306]
    MSSHDISPADARARALQGALLVDIRQLHERASGQAEGALAIAQNSLETEPAVHLPEQTRAIVLICQSGKRSAHTAAILRT
    HGYAHVASVAGGTSAWASAGLPLVRPTLPADEQDFLERYSRHLRLSQVGLEGQRRLARARVLLIGAGGLGSPAAFYLAAA
    GVGYLRIADDDVVDRSNLQRQILHTEDSVGTAKVDSAARRIAALNPRVDIEAVQTRVAADNVEALLQDVDVVVDGADNFP
    ARYLLNDACVKFAKPLVYGAVQQFEGQVSVFDAGRHRGHAPCYRCLFPEPPPPEFAPS
    CAEAGVLGVLPGVIGLLQATEA
    IKLLLGIGDGLTGRLLSFDALAMRFRDIRLPPDPHCPVCAPGAVFTGYADYAAFCGSAVG

    >gi|21242830|ref|NP_642412.1| hypothetical protein XAC2091 [Xanthomonas axonopodis pv. citri str. 306]
    MAAGRHCRAPHRCQTHPRLIALGHNHRMNAQLTQELPEFPTWLNARPSTLQEHRGRALVLAFVNASSVWCAERLAELAHW
    QARSPGRLQVIVVQVPRFDSERLPQRSLKQLRGHGVSAPILLDKDWETWRRFGIESWPTLVLLDAYGRERQRLVGVTGDL
    DKALTALCEGQPPPSDADLHGVAEREPEPHLALRFPTGLAATEDRLYVADTGHHRVLECTHSGRVLRQFGHGNADLIDGG
    VGEAAFRRPQGLALERDQLYVADTGNHALRRINLRSGQVDTLCGTGRSGEPVEGPLASPGGSALNYPQGLAIADNQVLIA
    MAGDNRIWSYHLGRAALTARAGTGALEIRDGSGHLAAFAQPAGLASVQQVAYVCDGLGSSIRTMQLRGDLVQTLVGGQGT
    WQFGDQDGPRSTARLQFPQAIALAADSPLLWIADTGNGRLRCLRLGGGELTTVALPRRLHGPAGLAVAAGAVWIAETDAH
    AILRYDLASGALSDVSIDE

    >gi|21243010|ref|NP_642592.1| hypothetical protein XAC2275 [Xanthomonas axonopodis pv. citri str. 306]
    MLRFTRHLARWRAAFATTRWFIAAAVVLLVAALLLAIWPKETQVPAAPGDSAQPAPPLLQGPPWTHGRSDARFTITVYAD
    LE
    CPFCQTYVPELVRWIDTHPDVNLQWQHLPLAMHEPAASREARLAECAGETQGHAGFWQAVAWIYSHTQAEGRGVPADA
    RYPGETPALRACLDSPHSLGIVQRQAQQAQRDGIGGTPTLRLREGRTGRTMVLSGAVSADVLLSAIDLLASQAPLR

    >gi|21243064|ref|NP_642646.1| C-type cytochrome biogenesis protein/thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
    MVESRSPRLPTAVLVGAIVLLLALAALLVYAVVRSGQDDRDALPSALIGKPAPEFALPLLHDPAIVVHARELRGAPYIIN
    VWGSW
    CPACREEHPVLSRFALTKRVRVIGYNWKDERNDALRWLEQLGNPYLLVVADQDGRTAIDFGIAAAPETFLVDGRG
    VVRWKYSGMLTQSIIDTQLIPALSQIERSPTAAPDLHAKQ

    >gi|21243126|ref|NP_642708.1| hypothetical protein XAC2392 [Xanthomonas axonopodis pv. citri str. 306]
    MTHLRFDNRLRQQLPGDPEEGSRRREVSVAWSAVLPTPVAAPSLIAHSAEMAQVLGLDAAEIASAQFAQVFGGNALYPGM
    QPWAVNYGGHQFGHWAGQLGDGRAISLGEAIGTDGGRYELQLKGAGPTPYSRGADGRAVLRSSIREFLCSEAMHHLGVPT
    TRALSLVGTGDAVVRDMFYDGHPQREPGAIVCRVAPSFIRFGNFELPSARGDIALLRQWVDFTIARDFPALAGAGEALYA
    GWFAQVCERTAVMVAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWVDDYDPDWTPNTTDAQGRRYRFGTQPQVAYWNLG
    RLAQALAPLFPDQAPLQHGLDRFRDTYLACDRHDTAAKLGLAECRDEDLQLIDALRALMRESEMDMTLTFRGLIDLSPDH
    PDPAQLREAFYDEDKRVADAPQLQQWLQRYAARLQQDPLPPDARRARMRLANPRYVLRNYLAQQAIDRAEQGDPSGVQEL
    LEVMRHPYDDQPGRDAFAARRPEWARDRAG
    CSMLSCSS

    >gi|21243187|ref|NP_642769.1| stringent starvation protein A [Xanthomonas axonopodis pv. citri str. 306]
    MATSVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTYDLVPVDPQNPPEDLIDLNPYHSVPTLVERDLVLYAASVVSEYLD
    ERYPHPPLMPVDPLSRARLRLAMLRIEHDWVPQVQAIQLGNKTQAEAGRKRLKELLTASVPLFKASKFFLNPEMSLADCA
    MAPIIWRLDALEISLPKDGKAIEDYGNRIFRNPGFIRSLTDQEKKLRDLPG

    >gi|21243405|ref|NP_642987.1| hypothetical protein XAC2676 [Xanthomonas axonopodis pv. citri str. 306]
    MPVMERIQAEVEQHPIVLFMKGTPQFPMCEFSSRAVQALVAAGADQLRTVNVLEEPEVRANLPRYSNWPTFPQLFIHGEL
    IGGCDITLELFEAGELKRIVSEAYQP

    >gi|21243477|ref|NP_643059.1| reductase [Xanthomonas axonopodis pv. citri str. 306]
    MSARYDYDVVILGGGSGGLAAGFRAAKHGARVAIMEPDELGGTCVNLGCVPKKAMWLAADLAGKIELASALGFDVPRPTL
    VWQELVTHRQGYIANIHASYRRRLNEDGVVLIPQRGVLQDRHTVMGSDGVPVTAGHIVIATGAHALRPDVEGAEHGEVSD
    DFFNLCHAPEQVAIIGGGYIAVEIAGLLQALGSRVHLFVQGERLLERFDAELTLQLADNLRHLGVRLHFGFTTTALERDM
    HGALRVHGHSVHPREQGNDVFDKVFFAVGRRANTAGLGLDTVGVALGDKGEVVVDDRQTTNVPNIHAIGDVGGKVGLTPV
    AIAAGRKLMDRLFGHQPDARMDYENVPSVVFSHPPLGNVGLTEEQARARYNGAVRVYRSNFRPMLHALADAPQRSLFKLV
    CVGEEERVVGVHLLGESADEMLQGFAVAVKMGATKRDFDETVAIHPTSSEEIVLMH

    >gi|21243510|ref|NP_643092.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
    MSDKPHVFDATTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQIAAAFQIRSV
    PTVFLVKGGEIVDGFPGAMPEGQVREFLTQHGVLPAEPQVAEEDVPLAPLDPQAQAAALREAIAAEPDKDELKLDLALAL
    LKTGDTAEAERLIDALPANLATDDRAVRAKARLSFANVLKDAPDAGTLQSAVDANSADLRARHLLGVRHLLDGNDEAALE
    QFLEMLRQDRTFDDNLPRRSLIDAFRVIEDEDLVGRYRRKMSALVF

    >gi|21243550|ref|NP_643132.1| 6-O-methylguanine-DNA methyltransferase [Xanthomonas axonopodis pv. citri str. 306]
    MSTLHYDTFPSPIGALSVAADDKGVHHILFAQNRYDAIGRARWLHDPDAPLVREAREQLLDYLHGGRRSFDLPLAPVGTP
    FQLTVWRTLAQIPFGQTWSYAQLAQAVGKPAASRAVGAANGRNPLPIVLP
    CHRVIGANGALTGFGGGLPTKQALLQLEGW
    SPRSAARADDLFAPASAMRTG

    >gi|21243606|ref|NP_643188.1| hypothetical protein XAC2879 [Xanthomonas axonopodis pv. citri str. 306]
    MSDRPVSVRTGAVPYTVSIHDGLHTWGGDTQLANGGSDAGPDPGSQVLGALGACTAITVSMVAARKQWPLTAVHVHLHYT
    QRGAAGTAITRDVVLDGALDDEQRARLMEVADKCPIHRLLTGEVRIETRLQAVGGGGDMAIRHD

    >gi|21243642|ref|NP_643224.1| osmotically inducible protein [Xanthomonas axonopodis pv. citri str. 306]
    MGISRHATAHWEGDLKTGKGQLSTPQSGLMDNTRYAFSSRFGDEKGTNPEELIAAAHAGCFTMALSAQLTEAGFPPASLD
    TRADVDLSMEGGPQLSQIRLKLKAVVPGIDEAKFRELADTAKKN
    CPVSKALSAVPISLETEFSS

    >gi|77748722|ref|NP_643807.2| glutaredoxin-like protein [Xanthomonas axonopodis pv. citri str. 306]
    MSLDPALRSRIDTLLQSSRVVLFMKGQPGMPQCGFSAKAVGVLDGLGIDYAHVNVLADQEIREGIKAYGDWPTIPQLYVD
    GELIGGSDIIVQMADSGELSSMLGLQAPDRSPPKITITPAAVEMLKGALADAPDASLTLAIDANFQPNFQLAPTNPNAIA
    AESNGLRVQFDLASARRADGITIDWVDDIRGRGLAIDNPNAPKPVQELSVRDADDRLKAGSLTLVDVRPADERALATVAA
    PFRTLDAHERAAIEQLPKDTPLAFL
    CHRGGRSLQAAEHFRGLGFTNVYNVTGGIDAWSDEVDNGVAKY

    >gi|21244237|ref|NP_643819.1| arsenate reductase [Xanthomonas axonopodis pv. citri str. 306]
    MHAVIYHNPGCGTSRNTLALIRHTGVEPQIVDYLQHPPSRQTLQSLIAAAGITVREAIRQKGTPYLELGLDDPTLDDATL
    LSAMLAHPILINRPFVQTARGTRLCRPSELVLDLLPPATHGFIKEDGERVLDEAGQRIGR

    >gi|21244275|ref|NP_643857.1| disulfide isomerase [Xanthomonas axonopodis pv. citri str. 306]
    MYRLAIAALLGAISLTACAQSSQPAASTAGAKPAAAPAATGTGTVDQRVSTALKALDPDFKPDYIGAAPFPGFREVVVGG
    QVLYVSDDGRYLIQAQPFDIQNKQFAASPGLLAYRRKQLDTVPKADRIVFAPANPKYTVTVFTDVE
    CGYCRKLHSEIGEL
    NKQGIAVEYLAFPRMGLGSQDHKEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYNLGQRLGVNGTPAIFAPDGT
    QLGGYLPPAQLREALEKRAVSTAGGSR

    >gi|21244384|ref|NP_643966.1| dihydrolipoamide dehydrogenase [Xanthomonas axonopodis pv. citri str. 306]
    MAVIEIKVPDIGDYSDVPVIEVLVAVGDSVAKDQGLVTLESDKATLEVPSSAAGVVKELKVKVGDTLSEGALVLLLETEG
    EAAAPAKAEPKAAPAAAAPAAAPGSKPPVTPSHRAPAEPAAPKPALASGKPADIECKMVVLGAGPGGYTAAFRAADLGLD
    TVLIERYASLGGV
    CLNVGCIPSKALLHAAAVIDEVAHAGDFGVDFGQPKITLDKLREYKEKVVGKLTGGLASMAKQRKVR
    TVTGVASFVSPNELEIVGDDGKTQLLRFEHCIIAAGSQAVKLPNFPWDDKRVMDSTDALELHDIPKTLLVVGGGIIGLEM
    ATVYSALGSKVTVVEFMDQLMPGADKDLVKPLADRLKKQGVEVHLKTKATDVKADKSGITVSFEAAVEGEKPGLQATAYD
    RVLVAVGRSPNGKKIGAEKAGVTITERGFIPVDRQMRTNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAGEKKEWVAR
    VIPSVAYTNPEIAWVGVTETEAKAKGLKVGVAKFPWAASGRAIGIGRTEGFTKLIFDEQTHRVIGGAIVGVHAGDLLAEI
    GLAIEMGAEAEDIGHTIHAHPTLSESVGMAAEVYDGTITDLYIPKKK

    >gi|21244416|ref|NP_643998.1| methionine sulfoxide reductase B [Xanthomonas axonopodis pv. citri str. 306]
    MSQFDLTPPSPAQRDALIAGLSDEEQRVLLHHGTEAPFCGVFLDNKLDGVYTCRLCGLPLFRSSAKFESGTGWPSFFAPY
    DPAHVREIRDTSYGMIRTEIVCARCDSHLGHVFPDGPPPTGERH
    CLNSVSLGFTENGQALPNPLHRRGAEAQAA

    >gi|21244554|ref|NP_644136.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
    MSDKVQHVGDADFDTAVLQAGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQNRALAIKYHVRSIPMLL
    LFKDGQVQATQIGAVGKGQLTQMIDKTLGGAAA

    >gi|21244602|ref|NP_644184.1| disulphide-isomerase [Xanthomonas axonopodis pv. citri str. 306]
    MTLSLRRPSPSLIALLAVLAALAACNKPAPPAAPPQPKTASTPTAAAGIAWREGDVEDAFAEAKDSGKPILLYWGAAWCP
    PCNRLKATLFKDPAFIARTQQFVAVHLDGDSEGAQAWGERFGVKGYPTIIVLRSDHSEITRLAGDADNARLAEVLRVAAK
    STSTAQQLLDKALHTPQQLSADDWAVLGNYAWGTDDRLVKPDDAADVLTRLSASAPQPALQRSFALAAISAAKHPPAASS
    ANRTLLETVLADPAEVRANLGTLNYVPARLVTAASNEAGVRSALSNALNQALDKVYADPSLPISDRLGTAYARIQLARLA
    QGQPTETEAEGPQPPLPKDVVEVVHQRVQWATDTAKTDEERQSTISTAAALLSEVGDRSAAEQLLLAELSRSKTPYYYMP
    ELADLAEQRGDKKTALLWLKRAYDSAQGPATRVQWGVMYVDGLIRLSPDDTAGIESAAAQVIGELAGQPDGYRQRTRQRF
    TTLGTALKTWSKQHRREGSAVLARLQQKMQSSCNSKTTSECASWLS

    >gi|21244789|ref|NP_644371.1| thioredoxin [Xanthomonas axonopodis pv. citri str. 306]
    MQTITVTSPEHYTQTLAAHPRALVDFYKDNCPGCRMLDMSLDKFANSDAANGVALLKVKLEVVGEDFFRDLGLRQTPTLA
    LYRDGAEVARLPGFQSPAQVEAAVRSGL

    >gi|21244899|ref|NP_644481.1| cytochrome C biogenesis protein [Xanthomonas axonopodis pv. citri str. 306]
    MARRFPWLWMGLLVACALIAMLAWQNRQLRMQQQWLQTRISAPYDGMYVPRIEATDGDGRRHLLGAPHGPAQVLFFFTTT
    CPYCQRSAPTVLRAARELQANLPGRPQLLGVCHCDTAQAARYAHVHGFDFPVVTLTDRRALMLFRARNVPLLMAIDGEGR
    VRHSHLGVFDTTERVQDLVAALRRTDAPAAFATVKE

    >gi|21245058|ref|NP_644640.1| glutathione peroxidase [Xanthomonas axonopodis pv. citri str. 306]
    MSQTLYDIPVTRIDGQPTTLADYRGKVLLVVNVASKCGLTPQYEGLEALYRDKRAQGLEVLAFPANDFNGQEPGSEAEIA
    QFCQLTYDVTFPMFAKIAVAGDQAHPLYGALTSTHPHTTGEGPMREKLAGYGIAPNPAPGVVWNFEKFLIGRDGKIIDRF
    APDIPADDARLRAAIDAALATRS