Xanthobacter autotrophicus Py2 uid58453

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|154243709|ref|YP_001409282.1| heavy metal translocating P-type ATPase [Xanthobacter autotrophicus Py2]
    MTEQDAHAGHHHHHGAHPGPQAGSAPGETVKDPVCGMEVNPATAPFRSSYAGKPFFFCSAKCHDTFEANPSAYAPGAAQP
    QATGKAPPAGVIYTCPMHPQIRQLGPGT
    CPICGMTLEPEVATAETGPSAELVDMTRRFWVGLILALPVLALEMGGHLTNL
    HMLLGAQAANWAQLVLATPVVLWAGWPFFVRAWQSLVTRHLNMFTLIAMGTGVAWLYSVVATAAPQIFPSTFRAADGSVA
    IYFEAAAVITVLVLLGQVLELRAREQTGGAIRALLDLAPKSARRVRADGSDEDVALEQVAVGDRLRVRPGEKVPVDGELV
    EGRSSVDESMITGESMPVTKEVGAKVIGGTLNQSGGFIMQAGKVGRDTMLAQIVHMVAEAQRSRAPIQRLADEVSGWLVP
    VVIAIALLAFAAWGIFGPEPRFAHGLIAAVAVLIIACPCALGLATPMSIMVGVGRGASMGVLIKNAEALERFEKVDTLVV
    DKTGTLTEGKPKVVALKAAGDLDEGELLRLAATLERASEHPLAAAIVAAATERNLPLGEARDFDSPVGKGVTGTVDGRKL
    VIGSHRIMGEESVDLSPLSAPAEALRADGATVIFVAIDGRLGGLVAIADPVKATTPAAVAALREAGVRVVMLTGDNRTTA
    EAVARRLGIAEVEAEVLPENKAQVVARLRGEGRIVAMAGDGVNDAPALAAADVGVAMGTGTDVAIESAGVTLLKGDLQGI
    VRARQLSHATMSNIRQNLFFAFIYNAAGVPVAAGVLYPWLGLLLSPIIAAAAMALSSVSVIANALRLRSASVGAGK

    >gi|154243741|ref|YP_001409314.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Xanthobacter autotrophicus Py2]
    MKVWNARNDHLTINQWATRIDEILEAPDGGEVIYNVDENDPREYDAIFIGGGAAGRFGSAYLRAMGGRQLIVDRWPFLGG
    S
    CPHNACVPHHLFSDCAAELMLARTFSGQYWFPDMTEKVVGIKEVVDLFRAGRNGPHGIMNFQSKEQLNLEYILNCPAKV
    IDNHTVEAAGKVFKAKNLILAVGAGPGTLDVPGVNAKGVFDHATLVEELDYEPGSTVVVVGGSKTAVEYGCFFNATGRRT
    VMLVRTEPLKLIKDNETRAYVLDRMKEQGMEIISGSNVTRIEEDANGRVQAVVAMTPNGEMRIETDFVFLGLGEQPRSAE
    LAKILGLDLGPKGEVLVNEYLQTSVPNVYAVGDLIGGPMEMFKARKSGCYAARNVMGEKISYTPKNYPDFLHTHYEVSFL
    GMGEEEARAAGHEIVTIKMPPDTENGLNVALPASDRTMLYAFGKGTAHMSGFQKIVIDAKTRKVLGAHHVGYGAKDAFQY
    LNVLIKQGLTVDELGDMDELFLNPTHFIQLSRLRAGSKNLVSL

    >gi|154243753|ref|YP_001409326.1| rhodanese domain-containing protein [Xanthobacter autotrophicus Py2]
    MPEEAVVAPQVCITVGVTRCAVPGPDGPLDIRRIADPKHRLSPEWAHTSRPAPPAVLQPLVPVPGVVPLGELELIEALQD
    PYILIVDSRKPEQFARYTIPGAINLPFTDPETALEALGCRRTGDGWDCSGARPVAMFCNGVW
    CGQSPTLIHKLTAAGFPP
    GHIYYYRNGLQGWLLQGLSVWTPGEADVFHI

    >gi|154243909|ref|YP_001409482.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Xanthobacter autotrophicus Py2]
    MKVWNARNDHLTINQWATRIDEILEAPDGGEVIYNVDENDPREYDAIFIGGGAAGRFGSAYLRAMGGRQLIVDRWPFLGG
    S
    CPHNACVPHHLFSDCAAELMLARTFSGQYWFPDMTEKVVGIKEVVDLFRAGRNGPHGIMNFQSKEQLNLEYILNCPAKV
    IDNHTVEAAGKVFKAKNLILAVGAGPGTLDVPGVNAKGVFDHATLVEELDYEPGSTVVVVGGSKTAVEYGCFFNATGRRT
    VMLVRTEPLKLIKDNETRAYVLDRMKEQGMEIVSGANVTRIEEDANGRVQAVMAMTPDGEIRIETDFVFLGLGEQPRSAE
    LAKILGLDLGPKGEVLVNEYLQTSVPNVYAVGDLIGGPMEMFKARKSGCYAARNVMGEKISYTPKNYPDFLHTHYEVSFL
    GMGEEEARAAGHEIVTIKMPPDTENGLNVALPASDRTMLYAFGKGTAHMSGFQKIVIDAKTRKVLGAHHVGYGAKDAFQY
    LNVLIKQGLTVDELGDMDELFLNPTHFIQLSRLRAGSKNLVSL

    >gi|154243926|ref|YP_001409499.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Xanthobacter autotrophicus Py2]
    MSDRLVIVGGVAAGAKAAATARRRNPAANILVLQQETDVSYSSCGLPYHLAAPEEIPRSRLVARTSETFRADGIDMRTRH
    RVEEIDAKQAIVTIRDLNSARRYTESYDKLLIATGAEASRLKTAASLTAPPIVQLRTLADADHLVTCLTGVRKLVILGGG
    YIGLEMAEAACKLGLDVALVEMAPRVIPSFDEAVARMVEAMLRKHGVELFTGARVVELDRGHVVLDNGVRIQTDMVLAAT
    GVRPCTALATAAGVDLGSTGAIAVSPQMTTNVEHVYAAGDCVESRHVLTDRPVWMPLGDVANRQGRVAGINMAGGHASFP
    GVLGTAIFKVFELAVARTGLGLAEASAASFFPVRETIRMPSRARYIRESKTLQLHLTVDQHSGRVLGCEAVGEDAVDKTI
    DIMAAAIWGKLTAADLFDLDLAYAPPFSPVLAPVQAAGEVLNKAISTTRLSAEPSVSRDTP

    >gi|154244020|ref|YP_001414978.1| OsmC family protein [Xanthobacter autotrophicus Py2]
    MPVNVLYSTSARATGGRDGHSATLDGAVDVKLSTPKELGGAGGDGVNPEQLFATGYAACFLGAMKFVASQGGSAKVPADA
    SVTSTVGIGPRSEGGFGLEIALEVSLPGVDRAAGEELIAKAHQV
    CPYSNATRNNIDVKLTLA

    >gi|154244058|ref|YP_001415016.1| rhodanese domain-containing protein [Xanthobacter autotrophicus Py2]
    MSTVLPGPLVSTEWLAEHLEAPDVKILDCTWLHESSNMDGKTQYRGRHLPGSVHFDIDHVADKTNPLPHMLPPAAEFAKK
    VGLLGIADGDKIVVYDRLCGGAAAARVWWMFRSFGYDDVAVLDGGYGKWVKEKKPSDMSPVRPEPKTFTATFNPALVRNL
    GEMVANVASKADQVVDARGPAKFAGTQDDVFPVKKKGHIPGSVNLPWGDLIVEESGELIQPDALAARFSAAGIDIAKPVV
    AT
    CASGTISAVVLLALFILGNKTAALYDGSWAEWGLAEDTPAAAAA

    >gi|154244064|ref|YP_001415022.1| iron-sulfur cluster assembly accessory protein [Xanthobacter autotrophicus Py2]
    MINLTDSALHAVRDAILGADQPVSGLRIMVETGGCAGYQYKMGLVSDAEPDDTVVEREGVKVFVDNQSHELLAGTVIDFV
    VALEGSGFTFENPNATSSCSCGKSFG

    >gi|154244071|ref|YP_001415029.1| HesB/YadR/YfhF-family protein [Xanthobacter autotrophicus Py2]
    MNFTMTRSAQRFIRMMIMADGGPSAGFRMHVTPGGCSGLNAEIAVLQEPSPGDAVVEKDGLKLFLPAESRLLLDGVTIDF
    TDTAAKTGLVFQDPKATTCSSHAH

    >gi|154244081|ref|YP_001415039.1| glutaredoxin-like protein [Xanthobacter autotrophicus Py2]
    MASSAERIQDIISSADVVLFMKGVPAAPQCGFSSAVVQVLAQVGVPYRAVDVLQDPFVREGIKAFSNWPTIPQLYIKGEF
    VGGCDIVREMFQAGELTALLAEKGVAAPVA

    >gi|154244103|ref|YP_001415061.1| nitrogenase-associated protein [Xanthobacter autotrophicus Py2]
    MAIVTFYEKPGCGTNARQKLALANAGHTLEVRSLLTEPWTAERLRGFFGDTPVAAWFNPAAPKVKSGAVDPSAVDAEAAI
    ALMLAEPLLIRRPLVETENGRCAGFDREPVLSLLGPSDPGARPLEGCSSPLAPCPDPAERKAS

    >gi|154244105|ref|YP_001415063.1| rhodanese domain-containing protein [Xanthobacter autotrophicus Py2]
    MRERIPFRCIGVEEAASIVGQGRALLLDVRDANAYAAGHVEGARNLAYSALSDVIGTTPKAQPVVIYCYHGNASREYAQT
    LSDFGFAAVFSVDGGYEAWRAFESVPAPTAPLDAALSSWLVDHGFPADGVNATAENGMTPLMKASQEGLADVVAALIAAG
    ATLDARNGDGNTALWLACVGNHPHIIDALVDAGITIDSLNDTGASSLMYAASAGKAEALEKLLARGADPRLETQDGFCAL
    DLAANLECLKLLRAATRREAAPA

    >gi|154244117|ref|YP_001415075.1| dihydrolipoamide dehydrogenase [Xanthobacter autotrophicus Py2]
    MSYDLTIIGTGPGGYVCAIRAAQLGLKVAVVEKRGTHGGTCLNVGCIPSKALLYASELFEEAGHKFGEMGIGVPAPKLDL
    KAMLAFKDKGVDGNVKGVEFLLKKNKVDVYMGAGKILGTGKVEVTLNADGKVEVLETKNIVIATGSDVAPLPGVTIDEQR
    IVSSTGALSLPKVPGKLLVVGAGVIGLELGSVWRRLGAQVTVVEFLDRILPGMDSDVAKSFQRILDKQGFAFKLGTKVTG
    VDTSGKTLKVSVEPAAGGAAEVIEADVVLVAIGRIPYTAGLGLDEAGVAKDGRGRVVTDHHFATNVPGIYAIGDVIVGPM
    LAHKAEDEGVALAELLAGKAGHVNYDVIPGVVYTFPEVASVGKSEDDLKAAGVAYKVGKFPFTANGRTKVNNTTDGFVKI
    IADAATDKVLGAHIIGPEAGEMIHECAVLMEFGGSSEDLARTCHAHPTRSEAVKEAAMAVEKRAIHM

    >gi|154244422|ref|YP_001415380.1| heavy metal translocating P-type ATPase [Xanthobacter autotrophicus Py2]
    MAEAIDYSVFVARSEDGLAQMSLAVDGIDCAACIAEIEDGVKALPGVVRARLNYSTHRLTVAWREETSPDRVVSQLEALG
    YRAHPFAGRAEESEARHARWLLRCLGVAGFAAMNIMLLSVSVWSGNVTDITPETRDFFHWVSALIALPAAAYAGQPFFQS
    AFRAVRSGRLNMDVPITIGVTLALGMSVLETALSQPHAYFDSAIMLLFFLLAGRYLDHEARRRTRATAGNIAALRGEMAH
    RLGTDGVPVLVPVQALQPGDTILVAPGERVAADGVIASGQSSIDESLVTGETLPRALKAGDAVYAGSLNGEGALHLTVTA
    GGENTLVDDVQRLLDGALAEKGAYVRLADRVARLYAPMVHLTALVSAIGWLLAGADLHHAVMIAVAVLIITCPCALALAV
    PAVQVTATGRLFRAGLLINAGDMLERLAAVDTVVFDKTGTLTLPEPALALPRGADRALVGLAGRLALSSRHPLARALAPR
    ADGPAIEGVTEVSGQGVEALVDGAVVRLGSLAFCGAAPPADLPAGASLIALRRGGQTLVMGVEQALRPDAPEVVAALKAR
    GLDVRILSGDREAAVTPVAQALGIAHWDAGLKPADKIAALDHLKAEGRRVLMVGDGLNDAPALAAATVSLSPATGAAVTQ
    AHADAVFLGRRLAPVMAAVDGAGVAARLMRQNLAIAVLYNVIAVPLAIAGFVTPLVAALAMSGSSILVTVNALRAARPGR
    KDEATDAAAPAGGDARTLEEAAA

    >gi|154244615|ref|YP_001415573.1| redoxin domain-containing protein [Xanthobacter autotrophicus Py2]
    MSAPAGRGSQRVSSFPSKDQGMGGCAPGVARAAVNAACRALLAAVLAGPVAALPAGASPDASATVPHQAPQPLRPVDGRP
    LAPALRLEALDGPAFDLAEAHGVTVVHFFATW
    CAPCRTELPALARFAARTPQVKVVLVDVAEVPARVRRFFADQAPPGPV
    LMDLDRATARAFGVSLLPASFVIAEGRIALAAEGEVAWDSPETDTAIAALNGSGGRPQVRSTHTVSNKASNTESQEEP

    >gi|154244617|ref|YP_001415575.1| selenide, water dikinase [Xanthobacter autotrophicus Py2]
    MLDVPSVRLTSLAHGGGCGCKLAPSVLQDLLAGQAHGGPFERLLVGTETGDDAAVWDLDGTTAIIATTDFFMPMVDDPDH
    FGRIAATNAISDIYAMGGTPLMALAILGMPLGKVDTATVRAILGGGAAICAQAGIPVAGGHSIDCPEPVYGLAVIGSAPR
    GRIRRNSTARPGDALILTKALGVGVYSAAFKKEALGKDAYDEMLASVTRLNRIGTELAKDEAVHAVTDVTGFGILGHGLE
    MARGSGATLRLSRAALPLLSEAESLVQQGFVTGASHRNWASYGHEVDLPEGTPDWQRHLLTDPQTSGGLLVACAPEAADR
    LLAEIHAAGYASAARIGMVEAGPGRVVVEG

    >gi|154244746|ref|YP_001415704.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Xanthobacter autotrophicus Py2]
    MAKRYDLAIIGTGTAAIVTAHRVRAAGWSVAVADFRPFGGTCALRGCDPKKMMVGGAEAADHAWRMSGRGIEGDATLDWT
    GLMAFKRSFTDPVPQKREKAFADKGIHAFHGHVRFIGPNALEFGGERIEADRIVIAAGAEAVPLGIPGEQHLITNEGFLE
    LESLPERIVLVGGGYIAAEFSHIAARAGAQVTILQHGKRMLKQFDPDLVGWLMDKFSERGINVRTQAGVTAIEKVSDGYR
    VRADCPDGELDMDADLVVHAAGRAPALATLDLDAGSVKHHNGRLALNGFLQSVSNPAVYAAGDAAGLGPPLTPVSSHDAK
    VVSANLLNGNTVRPEYTGVPSVAFTIPPIAAVGMSEAKAREKGLNVRVKTERVDGWFTARQQAETVYGFKTLVDADTDRI
    LGAHLVGPHADEVINIFALAIRQGLTAEQLKTTMFAYPSGASDIGEML

    >gi|154244747|ref|YP_001415705.1| mercuric reductase [Xanthobacter autotrophicus Py2]
    MNDCCTSSASRDKATVSTSATVPSLAVRPGVTFPDWSVVSSPVVKEALLAMVGSDHVLNRWSGYEAATDRVRVALLQLYA
    EHGRAPTPSALAKRAGLSEEAVRALLEELRRRDLVVLDGDMIVGAYPFTDRDTGHRVTLDGRTLTAMCAVDALGIGAMTD
    QDISIVSRCRHCGAPVRITTQERGRALADVEPTTAVVWLSVHYEGGCAANSL
    CTATSFFCSDDHLAAWRRQRPADEPGFR
    LSIEEALEAGRAIFGPSLAGIGTIAGHGNNAAETQGEPQSSGDTASPDRPVTHRRLGTNGRNNGSYDLAIIGAGSAGFSA
    AITAADQGAQVALIGSGTIGGT
    CVNIGCVPSKTLIRAAETLHNARAAARFAGITAEAELTDWGGTVRQKDALVSELRQAK
    YADLLPAYNGIAYREGPARIVDGGVQVDGTFVSAGKIIIATGARPAVPVIPGIETVPYLTSTTALDLEALPRSLLVIGGG
    YIGAELAQMFARAGVEVTLVCRSRLLPEAEPEIGTALTGYFMDESIAVISGITYRTIRKTADGVALTVHRDGKDVTIDAD
    QVLVATGRAPNIEGLGLAEHGIALSPKGGIFVDDRMRTTRSGVYAAGDVTGHDQFVYMAAYGAKLAAKNALNGDSLRYDN
    SAMPAIVFTDPQVASVGLTEAAARTAGHAVRVSTIGLDQVPRAIAARDTRGLIKLVADAGSGRLLGAHILAPEGADSIQT
    AALAIRHGLTVDDLADTLFPYLTTVEGLKLAALAFDKDVAKLSCCAG

    >gi|154244748|ref|YP_001415706.1| heavy metal transport/detoxification protein [Xanthobacter autotrophicus Py2]
    MKKSLSALALIMSVMTAPAVFATERTVTFAIDNMTCASCPYIVKTSMAAVPGVSTVAVSFEAKTATVTFDDAQTTPDAIA
    AASMNAGYPARPTQEQGS

    >gi|154244749|ref|YP_001415707.1| mercuric transporter MerT [Xanthobacter autotrophicus Py2]
    MRISARKARSDMDISRPSTAGMTSATTDVLASDRAEVGRQRLVAVGGILGALAASSCCIVPLILFSLGIGGAWIGNLTAL
    APYKPLFVAGTTGVLGYGFYLVYWKPRRACAEDAACARPIPSRIVQIALWFATVLVAAAFAFDYVAPLLLSA

    >gi|154244826|ref|YP_001415784.1| arsenate reductase [Xanthobacter autotrophicus Py2]
    MRPAMDVIIYHNPACGTSRNTLAMIRNAGIEPHVIEYLKTPPSRTLLAELIARAGLTVRGALREKGTPYAELGLADEALS
    DDALLDAMMAHPILINRPLVVSPKGVRVCRPSELVLDLLPPQKGAFTKEDGERVVDAAGQPVAAG

    >gi|154244920|ref|YP_001415878.1| alkylhydroperoxidase [Xanthobacter autotrophicus Py2]
    MSRIPALDPATATGKAKDLLAAVAAKFGATPNLFKVAARSPASLEALIGLSGALGGGALPAKIRESLAIAVAEVNGCDYC
    LSAHSLIGKGAGLSDADISQARSGRATDGKAEAALAFARAVVASRGKVSDGDLSQARQAGLGDGDIVEIVAHVAMNIFTN
    YLNNVAETEIDFPVVRSGAPRAA

    >gi|154245022|ref|YP_001415980.1| DSBA oxidoreductase [Xanthobacter autotrophicus Py2]
    MRRRDFIRIAALTALMPAAVAGAGRAQAEGVDVNAILRDPAAPNSGNPDGDVTIVAFLDYNCPYCKKSAPDLARVVKEDG
    HIRLIYKDWPVLTEASVYGAQLALAATYQGRYETVHDALMAIPGRRIDEQTMLKAVAASGVDLDRLMADLKAHIADIGGL
    LKRNAAQADSLGLSGTPTYLVGPLLASTLDYASFKRAVAEARRRQTAGE

    >gi|154245023|ref|YP_001415981.1| cytochrome c biogenesis protein transmembrane region [Xanthobacter autotrophicus Py2]
    MVANPPRSPLSPLRRALATLVVVVLWATGAAPVLAQGGILKADEAFTVSATRATDGTLSLSWRIAPGTYLYRESLKAGKD
    GTAVPLTLPPGEEKDDPNFGPVDIYHRSVTASAPALPETGALELSFQGCAEQGVCYPAVTRQIDLATLTITAARPRVEAS
    PVDQWGTAAPPPKPAAAPGTPAQPAALDALFRRDLLPLLGAFFGLGLLLAFTPCVFPMLPILSGILAGGGAKPTPARGLV
    LSGSYGLAMAAAYGVLGMGAAWTGANLQAALQTPWAIGLMAAVFAVLAGAMVGLFDLAIPSALAARLPSGGSGSIAGAAG
    LGFASALVVGPCVTPPLAAAMLYAAQTGDAARGASALFMLGLGMAAPLVAVGAFGAQILPRSGRWLLAVKQGCGVLFLAI
    AAWLAARVLPDSAGLALYGLLAIGLGVFAGGFDALASDADAGRRIGKTAGIAAVAAGLLLLVGAAGGASDPLRPLAFLAA
    PARPAAAAEREVRVSSPPALARALAAAGQHGRPTLVSFTADW
    CTVCKSNETTMAEPAVAARLSGLERIAVDVTRYGDGAR
    ALMGRYEVIGPPTLFLLDPDGRELPGSRRVGALTLADIDRLATQAGL

    >gi|154245115|ref|YP_001416073.1| hypothetical protein Xaut_1167 [Xanthobacter autotrophicus Py2]
    MSAPFPFDNSYARDLPGFYAPATPTPVTAPGLVKVNAPLAEELGLDPEALATPHAVEMFAGQHVPEGADPIALAYAGHQF
    GQFTPQLGDGRAILLGEVVDRAGRRRDIQLKGSGPTPFSRRGDGRAALGPVLREYIVSEAMAALGIPTTRALAAVTTGEP
    VLRDRPLPGAVLARVAASHIRIGTFQFFAARKATDAVRQLADYTIARHYPELAGTPEPYLALLNGVIGRQAALVARWLLV
    GFIHGVMNTDNMSVSGETIDYGPCAFMDAYDPETVFSSIDQMGRYAYGNQPDIAHWNLARLAECLIPLLGEDKEAAVAAA
    NGALKEFPARFRAAYHSGLVAKIGLAGPDGEASEEDTTLALELLSVMAESKADFTLTFRRLGALAADPEAGGPVRDLFLD
    RDAFDAWTTRWRERLAATGRDGAATRAAMDRVNPLFIPRNHLVEQVIASATEGDFAPFETLNTVLAHPFEEQPAFAAYAG
    LPPSMEGYQTF
    CGT

    >gi|154245118|ref|YP_001416076.1| DSBA oxidoreductase [Xanthobacter autotrophicus Py2]
    MLERHGFHRRGALSRSYPCFALNSFGDMAHPAPARAGPPDPTPDLSEMSMILDRRRFLAGAGLAALAAGLGLGLTVPFEP
    AAAQTVEQAKLMAPAASPLPEKAIGSATAPVTVVEYASAT
    CSHCAAFHTTTFPELKTKYIDTGKVRFIFREFPFEPVATA
    AFMLARCMPDDKYFPMVSTLFETQKAWAYSQDPAAGLLAVAKQAGMSQADFEKCLTDQTLGEKVQESALYANKELGVNAT
    PTFFINGKKISGALGIAEWDKELAPLLAGK

    >gi|154245380|ref|YP_001416338.1| uncharacterized peroxidase-related enzyme [Xanthobacter autotrophicus Py2]
    MRRASKTPVAKAVAPAPARVRDDLPAIALPLSPAELDPANRAYFDKCLEKIGFVPNVLQAYAFDMAKLSAFAAMYNDLML
    APSGLSKLEREMIAVVVSAVNRCYY
    CLTAHGAAVRQLSGDPILGEQLVMNYRAARLDPRRRAMLDFAAKLTERPNEVEEE
    DREALRRVGLSERDIWDVSAVVGFFNMSNRIASATDMRPNEAYHAQARTLPE

    >gi|154245471|ref|YP_001416429.1| hypothetical protein Xaut_1524 [Xanthobacter autotrophicus Py2]
    MSDASHLTRRGFLRGAASLSGTIAATALTPGAAKAVTRLGDDGLYTQDWYLDSFLDLSEDLSAATSKGRHFALQWSQRGC
    VYCKTLHTVYFADPALVDPIRAAFDIVHLDLFGAREVTAFDGARLTEKAFGQRERIRATPTFQFFALDGGTAKEVARLPG
    LLPQTEFAAMFRYVAQGAYKDATFDAFLARQDRT

    >gi|154245681|ref|YP_001416639.1| redoxin domain-containing protein [Xanthobacter autotrophicus Py2]
    MNRLPGNAQAPQVTSAPAAEPAAFKVSDAACQGTVERARAFVPLAKGGLAAFSPATEPRRLPPLAFTGANGKEVTLADFK
    GRVVLLNLWATW
    CVPCRKEMPDLDRLQGSLGGPDFEVVAVNLDTRDPDKPRAFLDEIGVKRLAFYADPATKTFQALRGVG
    RGFGLPTTVIVDRDGCEMGYLAGPAEWGGAEAEALVRAAIGTGASTSPVR

    >gi|154245752|ref|YP_001416710.1| glutathione S-transferase domain-containing protein [Xanthobacter autotrophicus Py2]
    MLTMFGRPPGCIMPIAKCCTAVEPIGKNRALKLVEAGDWPSPHLTPGENCIMYLHHHPFCPHSRFVRLLLAEYGLEPELV
    EERVWERRPGFLALNPSGETPVIVEEMAASVPGASIIAEWLDETRGLALGDHRLLPDSPAARVEVRRLTQWFNEKMYVEA
    TEPLVRERIHKRYMTREQGGGSPDATSLRMGRSNLRYHLKYIGWLAKARKWLAGEKLSQADLAAAAHLSVADYLGDVPWD
    EDDHARDWYARIKSRPTFRALLNESIPGMPPSKTYADLDF

    >gi|154245776|ref|YP_001416734.1| hypothetical protein Xaut_1832 [Xanthobacter autotrophicus Py2]
    MSENRLSRETSPYLLQHKDNPVHWWAWGPEAFAEAQATGKPILLSVGYAACHWCHVMAHESFENADVAGLMNALFVNIKV
    DREERPDVDQIYMSALQQLGQSGGWPLTMFLDPEGKPFWGGTYFPPAASYGRPGFTDVLQQVSTVFTQNKDKVEKNTATI
    LARLKKAATPVAGAAIGREDLNDAAARLPAMFDPVHGGLKGAPKFPQSGLLEFLWRVGTRRKDDALKAIVALTLNRMCEG
    GIYDHLGGGFARYSVDEIWFVPHFEKMLYDNALLLELLALAYSDTGDALFLTRARETVGWLKREMLTPEGAFAASLDADT
    EGHEGRFYVWSEAEITAVLGAEDAAFFNRLYDVSRAGNWEVGNILNRTEAGVVSAEDEARLAPLREKLLLAREKRVRPGR
    DDKVLADWNGLMIAALARAGGFLGEAEWVALAQRAFDAVVSHMVVEGRLAHSWCGTKIVLPGLASDLAAMARAGIALHEA
    TGAPEPLAQAAHFLEVLETHHRDPETGAYFLTAYDGDSLILRPLATHDEAVPNANAVAADALIRLAALTGNDAFRTRADR
    VLTGVSGATAKNVLAHGATLNAIDTRLGLAEMVAVGANREALAAAALKVPFPLRVVARAGDGVASGSVMAARIASAPAEG
    AAFVCVGERCSLPVSDPAQIAAVVGEMLS

    >gi|154245925|ref|YP_001416883.1| thioredoxin [Xanthobacter autotrophicus Py2]
    MLLNQAGAKGAAGTGAGAGASTGAGNGAAGGDIIDTTTQTFMAEVMEESKRRPVLVDFWAPWCGPCKTLTPVIEKVVKAA
    KGKVRLAKLNIDDHPVIPGKLGIQSVPTVYAFVNGQPVDGFQGALPEGQVKAFIDRLIGPSDDGLEEALAAADAALAQGD
    LTAAAEIFVGVLGEEPDNLKALTGLVRTQVAAGALEQAKATLAMVPADKQNDALVNAARAALDVAEQAAALGDLATLEAR
    LDLDPADHQARFDLALALNGKGRREQALIHLLDIVKRDRAWNEDAARKQLVQLFEAWGPTDPLTLSGRKKLSAIMFA

    >gi|154246210|ref|YP_001417168.1| rhodanese domain-containing protein [Xanthobacter autotrophicus Py2]
    MPEEAVVAPQVCITVGVTRCAVPGPDGPLDIRRIADPKHRLSPEWAHTSRPAPPAVLQPLVPVPGVVPLGELELIEALQD
    PYILIVDSRKPEQFARYTIPGAINLPFTDPETALEALGCRRTGDGWDCSGARPVAMFCNGVW
    CGQSPTLIHKLTAAGFPP
    GHIYYYRNGLQGWLLQGLSVWTPGEADVFHI

    >gi|154246305|ref|YP_001417263.1| peroxidase [Xanthobacter autotrophicus Py2]
    MATLRLGDVVPDFEAVTTEGPIKFHEWLGDSWGILFSHPKNFTPVCTTELGQASHLKPEFDKRGVKLIGLSVDTIENHPA
    WVGDIKDATGASLNFPLIADSDKKVSDLYDLIHPNASDTATVRSVFIIGPDKKLKLSLTYPASTGRNFDEILRVVDSLQL
    TAKHSVATPVNWKHGEDVIIVPSVTDEAAKEKFPEGWKTVKPYLRVVRQPGA

    >gi|154246321|ref|YP_001417279.1| electron transport protein SCO1/SenC [Xanthobacter autotrophicus Py2]
    MSQIKLSQRTKIIALFCAFAAGALVMVTAVTMLVGSPAPRVTSTGTAAVGGPFKLVDQTGAPVTEAALKGKPSLIFFGFT
    H
    CPDVCPTALFEMSEILTALGPDAGKAQVFFVTVDPERDTPEALKSYLSSFAPQIRGLTGTPEAVDAIKKEYRVYSKKVP
    LTGGDYTMDHTAVVYLMDKSGTFVAPFNSKRPPADAAAELKRYL

    >gi|154246391|ref|YP_001417349.1| OsmC family protein [Xanthobacter autotrophicus Py2]
    MAIIRTGSAQWSGGIKDGKGAISTESGALSAYPYGFASRFENQKGSNPEELLGAAHAACFTMALSLILGGAGLTATDLQT
    SAKVSLEKKEAGYEITAVDLTLTGIVPGATPEQFAELADTAKAN
    CPLSKVIRAAISLDATLKS

    >gi|154246435|ref|YP_001417393.1| peptide methionine sulfoxide reductase [Xanthobacter autotrophicus Py2]
    MFWLKKSLDLPTKADALPGRSTPVPTAETHFVNGHALKGPYPAGFETAVFALGCFWGAERKFWQTPGVWATAVGYVAGIT
    ENPTYEEVCSGRTGHTEAVLVVYDPKAVSYDELVRLFFESHDPTQGMRQGNDVGTQYRSGIYVTNAGQRVAAEAAKAAYE
    PALKAKGFGPITTEIAELGPFYFAEGYHQQYLAKNPAGYCGLGGTGVSCPIGTGVAAQ

    >gi|154246531|ref|YP_001417489.1| rhodanese domain-containing protein [Xanthobacter autotrophicus Py2]
    MSERNPFGGTITHLSPAEVRQGLADGTILLVDVREANEIQAERIPGATPFPLSKFDPAALPDPAGKRLVFSCRSGQRSQQ
    AAAYAQKAGLPYEEHMKGGIIGWREAGFEVERG

    >gi|154246537|ref|YP_001417495.1| redoxin domain-containing protein [Xanthobacter autotrophicus Py2]
    MPISVGDKLPNATFRVPTEDGPVPKTTDEIFKGKKVVLFAVPGAFTPTCHKNHLPGYVHEADAIKAKGVDAIAVVSVNDP
    FVMGAWEKASGADGKIVFLADPDAAFSTALDLTFDGSAAGLGVRSKRYSMVVEDGVVTSLNVEDVPSKADISGAPALLAQ
    L

    >gi|154246553|ref|YP_001417511.1| OsmC family protein [Xanthobacter autotrophicus Py2]
    MWHRLCIRQTGLSISAEEIRMSQSNTVLTGCLLPEATTGCLAPIDKDGLEKLIAAGKADPKVIKTLKCKTVAEGRFRHAN
    YIRNLAPYIVDEPPGLLGDDTAPNPSEASLAALGS
    CLAVGLHANAVHRGWTVRKLELQLEGDLNITAVWGTGDVSEKPVG
    FTDVRVKVEMECDGVPKEEVDALISHVTKWSPVANTFVRPVNLEVALA

    >gi|154246555|ref|YP_001417513.1| rhodanese domain-containing protein [Xanthobacter autotrophicus Py2]
    MSTILISPPDLSALILSEPTVVIDTRNPESYAAGHIPGAVNLHEIFTFLATSTPEGYAELRAKFADAFGKAGLSGNETAV
    IYEQSMNSGFGQSCRGYFLLTFLGYPKIKVLHGGFAAWEAAGLPVTTAVPEPKAVTFPVDEAAGAVIIDAAAMLSAVEDP
    AVAKLDVRDVDEWIGESSSPYGKDFCPRKGRIPGAKWIEWYRMMKPTAEGPRFKSAPEILAECATVGISPETPVYLY
    CFK
    GARASNTFLALKEAGVKDVKMYFGSWNEWSRDPALPIEEGHPAAATA

    >gi|154246661|ref|YP_001417619.1| thioredoxin domain-containing protein [Xanthobacter autotrophicus Py2]
    MFTRRATLALSLAAALVAGASAMAFAEPEHTTYTPAAFQAAQHAGKPILVEIHASWCPVCAAQAPILSELLSQPQFKEMV
    VFRVDFDSQKDAVKSFKARDQSTLITFKGTTETGRSVGDTHKGSIEALLSHAI

    >gi|154246692|ref|YP_001417650.1| thioredoxin reductase [Xanthobacter autotrophicus Py2]
    MTAHTVKVVIIGSGPAGYTAAIYAARAMLEPVLFEGIQPGGQLTITTDVENYPGFADPIQGPWLMEQMRAQAEHVGTKIV
    TDHVASLDLSHRPFRMVTESGDTYVADVVILATGAQARWLGLESEAAYRGSGVSA
    CATCDGFFYRGKDVVVVGGGNTAVE
    EALFLTNFASNVTVVHRRDSFRSEKILQERLFAHPKVKVVWNAELAEVVGQDDPFTKVTGAKLRDVRTGVLTELPADGIF
    IAIGHAPATELVKDQLKLKESGYVWTAPDSTATSVPGVFAAGDVADDVYRQAVTAAGRGCMAALEAERFLAHQGVAKAAE


    >gi|154246752|ref|YP_001417710.1| methylated-DNA--protein-cysteine methyltransferase [Xanthobacter autotrophicus Py2]
    MLALDCPALDLSASGGRMTATPATPLAIAARDYDVVRRAVEYISRHVRQQPEVEEIAAAAGVSARALTDLFRRWCGLTPK
    AFLQAVTLDRARRIVSECPNVLDAAFELGLSGPGRLHDLFVVHEAMSPGEWKTGGAGLVVRFGFHPSPFGLALAMSTPRG
    LCGLAFADVGEEAAALADMRARWPNATYVEDPAATAPLVARIFDPTSWQGDQPLRIVFIGTDFEIKVWETLLRIPMGLAT
    TYSTIAEHVGRPKAARAVGAAVGKNPISFVVP
    CHRVIGKSGDLTGYHWGLTRKRAILGWEAGKVEPAGE

    >gi|154246779|ref|YP_001417737.1| methionine-R-sulfoxide reductase [Xanthobacter autotrophicus Py2]
    MPNPAPSPAAEGHGDAKVVKSESEWRSCLTPEQFRITREHGTERAFTGPYWDEKRAGLYSCVACGTPLFRSEAKYDSGTG
    WPSFFAPISPDSVVTHEDTSHGMRRIEVRCASCESHLGHVFPDGPAPTGLRF
    CLNGTALKLAPDDGDTRGA

    >gi|154246827|ref|YP_001417785.1| rhodanese domain-containing protein [Xanthobacter autotrophicus Py2]
    MTTKSAKDLVAEASRDIETLSGPEAAKLVGDPSVMFVDVREAEELQKTGKLRGAVHVPRGFLEFQADPTSPTHKPELGGG
    KKLVLY
    CGSGNRSALGAKALKEMGITNVAHVAGGFPALQQAGGLVEEVNR

    >gi|154246831|ref|YP_001417789.1| protein of unknown function DUF395 YeeE/YedE [Xanthobacter autotrophicus Py2]
    MDNFTPVSALLGGLLIGASAALFLFLNGRIAGVSGILGGFIHPARNEIGWRLAFVAGLFLAPFLYAALGGALPQITLTPS
    IELLAVAGLIVGFGTRLGAG
    CTSGHGVCGVARGSPRSLAATAVFMATAIATVFITRHVLGG

    >gi|154246837|ref|YP_001417795.1| mercuric transporter MerT [Xanthobacter autotrophicus Py2]
    MDTARPGTVAVTSGEAGVAASERSEVGRQRLVAVGGILGALAASSCCIVPLVLFSLGIGGAWIGNLTALAPYKPLFVAGT
    TGVLGYGFYLVYWKPRQACADDAACARPIPSRLVQIALWIATVLVAAAFAFDYVAPLLLRA

    >gi|154246838|ref|YP_001417796.1| mercuric transport protein periplasmic component [Xanthobacter autotrophicus Py2]
    MKTYLSALALIASVMTAPAAFAAERTITFAVDNMTCASCPYIVKTSMAAVPGVTKVAVSFEAKTATVTFDDGKTNPDAIA
    AASMNAGYPARPTQQQGS

    >gi|154246839|ref|YP_001417797.1| mercuric reductase [Xanthobacter autotrophicus Py2]
    MNDCCASTASRDKVAASASATLPSYAVRPGVTFPDWPVVSSLVVKDALLAMVGSGHVLNRWSGYDPATDRVRVVLLQLYA
    EHGRAPTPGALAKCAALSETAIQPLLQDLRRRDLVVLDGDKIVGAYPFTDRDTGHRVTLDGRTLNAMCAVDALGIGAMTG
    HDIAIASSCRYCGAPIRIATRDRGRALAQVEPRTAFVWLSVRYEGACAANSL
    CAATSFFCSDDHLAAWRQERRSAEPGFR
    LSIEEALEAGRAIFGPSLAGVTAGERAVDLAAEARGAFPSSVDTVSKNTPTAGRRVASNGRNGGGYDLVVIGAGSAGFSA
    AITAADQGAQVALIGSGTIGGT
    CVNIGCVPSKTLIRAAETLHNARAAARFAGISAEAEVTDWRGTVRQKDALVSGLRQAK
    YIDLLPAYNGIAYREGPARLMDRGVEVDGTRIPAGKIIIATGARPAVPAIPGIETVPYLTSTTALDLEELPRSLLVIGGG
    YIGAELAQMFVRAGVKVTLVCRSRLLPETEPEISAALTAYFADEGITVTSGIAYRAIRKTEDGVSLIVARDGQDTTIEAD
    RVLITTGRTPNIESLGLAEHEIAVSSRGAIVIDDRMRTTRAGIYAAGDVTGRDQFVYMAAYGAKLAAKNALNGDSLRYDN
    SAMPAVVFTDPQVASVGLTEAAARTAGYAVRASTIGLDQVPRALAARDTRGLIKLVADAGSGRLLGAHILAPEGADSIQT
    AALAIRHRLTIDDLADTIFPYLTTVEGLKLAALSFSKDVAKLSCCAG

    >gi|154246840|ref|YP_001417798.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Xanthobacter autotrophicus Py2]
    MAEQYDLVVIGTGTAAMVAAMRVRAAGWSVAIIDYRPFGGTCALRGCDPKKMLVGGASALDHARRMRGNGVAGDVHIDWP
    ELIAFKRTFTDPVPEKHEHRYDEKGIHTYRGHARFTGRNSLTVDGESLEARHVLIAAGAEPIRLGIPGEEYFATNEDFLA
    MERLPRRIVLVGGGYIASEFSHIAARAGVQVTILQRGKRMLGHFDPDLVGWLMDKFREIRVDVRLRTTVSAIEKDHAGFV
    VRASSEGGDATFDADLVVHSAGRAPALDALDLEAGGVAAEKGRLKLNEYLQSVSNAAVYAAGDAAQEGPPLTPVSSHDAK
    MVAANLLEGNRHRPDYRGVPSVAFTIPPIAAVGLSEEQARQQDLKFQTKSQKASDWFTARQAVEKTYGFKVMVEDDTGRI
    IGAHLVGPHADEVINLFALAIRHDLTADNLKTTMFAYPTGASDIGYML

    >gi|154246868|ref|YP_001417826.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Xanthobacter autotrophicus Py2]
    MSLQAKLDAFKADFETGKPPYNVPPAVIETMRRATAELIASGAARQALKAGEKIPAFTLADPEGNEVSSADLLAKGPLVI
    TFYRGVW
    CPYCNMELQALQEALPQLQALGANLIAISPQNPVNSRKSVRQNKLSFPILSDPRNEVAAAFGLRFALPDYLVE
    LYKSLKNDLPSFNGDPSWTLPMPARFVVGQDGTILYAEVNPDYTRRPEPADMLPALRRAAGATAA

    >gi|154246898|ref|YP_001417856.1| methionine sulfoxide reductase B [Xanthobacter autotrophicus Py2]
    MTAYKKTEAAIAKLSPEEYRVTQQSATERPGTGALLHNKEPGVYVDIVSGEPLFASSDKYESGCGWPSFTKPIEPANVNE
    LRDNSHGMIRTEVRSTYGDSHLGHVFPDGPSDRGGLRY
    CINSASLRFVPRGEMESQGYGEYLNQVEDI

    >gi|154246899|ref|YP_001417857.1| methionine sulfoxide reductase A [Xanthobacter autotrophicus Py2]
    MTTERAVLAGGCFWGMQDLIRKLPGVISTRVGYTGGDVPNATYRNHGTHAEAIEITFDPSQTTYRRLLEFFFQIHDPTTL
    NRQGNDRGASYRSAIYFTNDQQKAVALDTIADVEASGLWPGKVVTEVEPVGDFWEAEPEHQDYLERIPHGYTCHFARPDW
    VLPRRAGAAA

    >gi|154246900|ref|YP_001417858.1| hypothetical protein Xaut_2968 [Xanthobacter autotrophicus Py2]
    METGIVGLPAPPLENIRWIDENGDERSSLTLAELGQGFKILYFFQDWCAGCHAHGFPTFVTLAEEFRDKGVGLAAIQTVF
    EGSEVNTFDRLRENQRRYGLRLPFGHAVAGSGSVDAAPAIMEAYRSGGTPWFVVIAPDGRVVYNGFQLDAESLIQKLRPL
    TA

    >gi|154246909|ref|YP_001417867.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Xanthobacter autotrophicus Py2]
    MLQNGDVFPSFIFGRAGGGEIHLPGDLAGGFGVILFHRGSWCPYCNAQLAEFARAADKFAEDGIRVVSVSTDDREKSEAL
    VDKHKLGFPVGYSADARAVSAATGAFVNENPLALQATGFVIDPEGRIVTAVYSTRAIGRLMPADVLNFVRHFKSLAGN

    >gi|154247018|ref|YP_001417976.1| glutaredoxin 3 [Xanthobacter autotrophicus Py2]
    MKPIEIYTKSWCPYCHSAKELLRRKGLTFTEIDVTTDKDGQEEMTRRAGGRTSVPQIFIGETHVGGCDDLYALEDAGRLD
    QLAA

    >gi|154247152|ref|YP_001418110.1| glutathione-disulfide reductase [Xanthobacter autotrophicus Py2]
    MSRREVDLFVIGAGSGGVRAARIAAQHGARVMMAEEYRVGGTCVIRGCVPKKLFVYAGRFAHDIEDMAGFGWRVTEPEFD
    WLTLVANKDKEIARLEAIYRRNAENAGVEVVASRAVVVGPNSVRLLATGEEIGARYILLATGARPALGPAIPG
    CELAITS
    NEAFNLTHFPNRILVQGAGYIAVEFAGLFRALGADVTLVYRADKVLRGFDGEIRDHLEAEMTRAGIHLKPGRTLTSIEVI
    NGGKRVTLSDGSVVEVDDVMLALGRIPNTAHLGLDTVGVKLDEVGAVVVDETGATNVPSIYAVGDVTNRINLTPVAIREG
    HAFADTVFGNKPWTVDHSLVATAVFSEPEIGTVGLSEEAARALGRPIDIYSTSFRPLKATLSGRETRTFMKLVVDKESDV
    VLGCHIMGDAASEMIQLAGVALGLKAKKADFDRTVAVHPTSAEELVTLRTPTRSV

    >gi|154247200|ref|YP_001418158.1| alkylhydroperoxidase [Xanthobacter autotrophicus Py2]
    MADPLSRPTYKAFTERAPDVYAGLSALTKAVDASGLDKGLTELVKLRASQINGCAFCLKFHLGVARKAGVSQDKLDLLAA
    WRDAPAFSARERAALAYAEDLTQLEAEAASDAAWAALLKEFSEDEAVFLTVTIASINAWNRIGIALRFAPPA

    >gi|154247229|ref|YP_001418187.1| thioredoxin [Xanthobacter autotrophicus Py2]
    MSVEKVSDQNFEQDVLQSSAPVIVDFWAEWCGPCRMVAPILEEVSGEMGEKIRIVKLNVDENPATASKYGIMSIPTLLLF
    KDGKIASRQVGAAPKAKLVQWINGAI

    >gi|154247266|ref|YP_001418224.1| heavy metal translocating P-type ATPase [Xanthobacter autotrophicus Py2]
    MQADAKKGRIMTAPLVQSRFRVTGMDCASCAAKIEGTTLRIAGVAEAEVSVAAGTLVIRHAPDADLAPLAGRLSPMGYAL
    APLASGGGQRKAHDHGESCAGHDHAGHDHAAHDHSDHDHSGHDHAEVGGHDHGAAPAAEGRWWSTGKARLTLLSGLALVA
    AFGVGTFVPAVQSWLYLAAMLVGLVPIARRAVAAAANGMPFTIEMLMTIAAAGAVIIGAAEEAAAVVFLFLVGELLEGVA
    AGRARASIRALTALVPKTALVERNGATIEVPAASLKVGEVILVRPGDRISADGLIVAGESGIDESPVTGESVPVRKGPEA
    TVFAGTVNGEAALRVRVTATAEDNTIARVVKLVEEAQEKRAPTERLIDRFSRYYTPGVVAVAALVAVIPPLLFGGAWDAW
    IYKGLAILLIGCPCALVISTPAAIAAGLSAGARRGLLLKGGAVLETAGKITTVCFDKTGTLTAGKPQVTDVIGFAQPQAE
    VLRLAAALETGSSHPLAKAILDRAAADAIPIPPAEAAQALGGEGVSALVEGREVFLGSPPAAAARAPLTVVQADQIAALN
    DAGKTVSLLVADGAIAGAIAMRDEPRPDAAEGLAALKREGIRTVMLTGDNRRTAEAIGRQLGIEVRAELLPQDKLRIVGE
    LQREGAVVAKVGDGINDAPALAAADIGIAMGGGTDVALETADAAALHGRVKDVASMIALSRRTMGNIHQNIAMSLGLKAV
    FLVTTIAGITGLWPAILADTGATVLVTLNALRLLRVRLE

    >gi|154247348|ref|YP_001418306.1| thiol-disulfide isomerase and thioredoxin [Xanthobacter autotrophicus Py2]
    MKDVKVLGPGCSRCEATAQMVRDEAAKLGLDVTVEKVTDYALIAGYGIASTPGIVIDGKVVHAGGLPKPDDVARWLAA

    >gi|154247427|ref|YP_001418385.1| DSBA oxidoreductase [Xanthobacter autotrophicus Py2]
    MPPHLGSPLTSLRRLAPRLFTLALAALSAVVLVARPAAAFTDDEKKELGGIIREYLIQNPEVLQEAISVLESRQMVQEAS
    QRSKAVGDVRELLVNSPRGIVAGNPKGDVTLVEFFDYN
    CGYCKKALSDLQDLIKQDPNLRVVLKEFPVLGQGSVEAAQVA
    VAVRMVAPDKYMAFHQALLGGRGQADRAKALAAAKEVGIDTALLQKQATSPELNATLDESMKMAEALALNGTPSYVIGDQ
    VVIGAVGFDKLKAAIAEARKHPPVAK

    >gi|154247435|ref|YP_001418393.1| glutathione peroxidase [Xanthobacter autotrophicus Py2]
    MARAPRQGIGGCASLRTDENSSRQDPMSQALFDIPLKRIDGTAATLGDFRGKVLLVVNVASKCGLTPQYAALEKLYEARH
    GDGLEILGFPANDFGAQEPGTESEIASFCSLTYGVTFPMFEKISVVGATRHPLYDALVAARPETTDEEGRRPSGRSASPS
    DVSWNFEKFVVGRDGRVIARFSPRVTPDDPRLTKALDAALEAKA

    >gi|154247500|ref|YP_001418458.1| arsenate reductase and related [Xanthobacter autotrophicus Py2]
    MATTIYGIKACETMKKARGWLEAHGVDHAFHDYKTAGIERKTLEGWVKKVGWEKLLNRSGTTFRKLPDADKEGIDEAKAI
    GLMLEKPSMIKRPVLETGRDLLVGFKPEEYAAKFG

    >gi|154247757|ref|YP_001418715.1| redoxin domain-containing protein [Xanthobacter autotrophicus Py2]
    MTTYNSLPDSLPAPEDDGHAAHLPGLELPIIQLPATDGRLVDLSGLSGLAVVYAYPRTGVPGEPLPTGWDEIPGARGCTP
    QSCAFRDHFADLKAAGAEHVFGLSLQDTAYQQEVAERLHLPFPLLSDHRHELTHAIRLPTFTVEGATLLKRITLIIEDGA
    ISHVFYPVFPPDRNAADVLAHLHAKRSQDGE

    >gi|154247767|ref|YP_001418725.1| disulphide bond formation protein DsbB [Xanthobacter autotrophicus Py2]
    MVQRLDETAALLLVTGSALALAAAWYFQLVVGLAPCPLCLDQRLPYYAAIPLGLLAFAAARSGRTTLARVLLGVIGVAMV
    GNMGLAIFHAGVEWKFWSGPTA
    CTGAPVMTGNILSALKGARVPRCDEAAWRLFGISMAGWNALIAAGLAVVAFGGATTRR
    KA

    >gi|154247817|ref|YP_001418775.1| dihydrolipoamide dehydrogenase [Xanthobacter autotrophicus Py2]
    MADSYDIIVIGGGPGGYVAAIRAAQLGFKVAVVEKSHLGGICLNWGCIPTKALLRSAEIYHYMEHAKDYGLSAEKIGFDA
    AAVVKRSRGVSAQLAGGVAFLLNKNKVDVIWGKATFTAPGKIKVEASQNPPKGAKGGGDYTAKHIIVATGARPRALPGLE
    PDKKLIWTYFDAMVPEKMPKSLLVMGSGAIGIEFASFYRTMGTEVTVVEVLPQILPVEDEEIAAVARKRFEKLGMKILSG
    AKVTGVTKHADSITAHVEDAKGAKHDITVERMISAVGVVGNVEGLGLEAIGVKIERGCVVIDGYGRTNVPGVYAIGDIAG
    PPMLAHKAEHEGVICVETIKGLHTHPMDKNKIPGCTYCTPQIASVGLTEKKAKEAGREIKVGRFSFIGNGKAIALGEPDG
    LVKTIFDAKTGELLGAHMVGAEVTELIQGFVVAMNLETTEEDLIHTVFPHPTLSEMMHESVMSAYGRAIHS

    >gi|154247822|ref|YP_001418780.1| rhodanese domain-containing protein [Xanthobacter autotrophicus Py2]
    MPQTITRGFKLLLEEANARVETLTPQDAQRRIAEGALLVDVRDPRELEREGRIPGAFHCPRGMLEFWIDPESPYFKPPFG
    EDRAFIFL
    CAGGWRSALSAVTAQDMGLDPVAHVGGGFKAWKDAGGPVEA

    >gi|154247866|ref|YP_001418824.1| thiol-disulfide isomerase and thioredoxin [Xanthobacter autotrophicus Py2]
    MRCFLEAGKAGVMKDVKVLGPGCSRCEATAQMVRDEAAKLGLDVSVEKVTDYAVIAGYGIASTPGIVIDGKVVHAGGLPK
    SDDVARWLAV

    >gi|154247889|ref|YP_001418847.1| arsenate reductase [Xanthobacter autotrophicus Py2]
    MTEHSLVTIWHNPACGTSRNTLALIRNAGIEPTIVEYLKTPPAREEVAAAIAAAGLTVRAATRQKGTPYAELGLDDPALT
    DDTLLDAMMAHPILINRPFVFTPLGARLCRPSERVLDILPAPQKGPFTKEDGEVVIDAEGRRVC

    >gi|154247901|ref|YP_001418859.1| heavy metal translocating P-type ATPase [Xanthobacter autotrophicus Py2]
    MQADAKKGRIMTAPLVQSRFRVTGMDCASCAAKIEGTTLRIAGVAEAEVSVAAGTLVIRHAPDADLAPLAGRLSPMGYAL
    APLASGGGQRKAHDHGESCAGHDHAGHDHAAHDHSDHDHSGHDHAEVGGHDHGAAPAAEGRWWSTGKARLTLLSGLALVA
    AFGVGTFVPAVQSWLYLAAMLVGLVPIARRAVAAAANGMPFTIEMLMTIAAAGAVIIGAAEEAAAVVFLFLVGELLEGVA
    AGRARASIRALTALVPKTALVERNGATIEVPAASLKVGEVILVRPGDRISADGLIVAGESGIDESPVTGESVPVRKGPEA
    TVFAGTVNGEAALRVRVTATAEDNTIARVVKLVEEAQEKRAPTERLIDRFSRYYTPGVVAVAALVAVIPPLLFGGAWDAW
    IYKGLAILLIGCPCALVISTPAAIAAGLSAGARRGLLLKGGAVLETAGKITTVCFDKTGTLTAGKPQVTDVIGFAQPQAE
    VLRLAAALETGSSHPLAKAILDRAAADAIPIPPAEAAQALGGEGVSALVEGREVFLGSPPAAAARAPLTVVQADQIAALN
    DAGKTVSLLVADGAIAGAIAMRDEPRPDAAEGLAALKREGIRTVMLTGDNRRTAEAIGRQLGIEVRAELLPQDKLRIVGE
    LQREGAVVAKVGDGINDAPALAAADIGIAMGGGTDVALETADAAALHGRVKDVASMIALSRRTMGNIHQNIAISLGLKAV
    FLVTTIAGITGLWPAILADTGATVLVTLNALRLLSWGRE

    >gi|154247962|ref|YP_001418920.1| alkylhydroperoxidase [Xanthobacter autotrophicus Py2]
    MSEQSISNELKSMNLRFATLGKALPQAMGAFRNLMSEASKSATLSTKVKELMALAIAVHKGCGDCILFHVSNAKSHGASR
    EELAETLAVAIEMGGGPAAVYAGKALAAYDALTNDK

    >gi|154248009|ref|YP_001418967.1| glutaredoxin-like protein [Xanthobacter autotrophicus Py2]
    MKHAGPHSADQNGFETMGIREDIDAIVKSGDVVLFMKGTPQFPQCGFSGQVVQILDHVGVPFKGVNVLENDAVRQGIKDY
    ANWPTIPQLYIKGEFVGGCDIVREMFQAGELTTFLEEKGVAIRDRAIG

    >gi|154248049|ref|YP_001419007.1| UBA/THIF-type NAD/FAD binding protein [Xanthobacter autotrophicus Py2]
    MAFSPDEIERYARHIVLHDVGGPGQQKLKAATVLVVGAGGLGAPVLLYLAAAGVGRLILVEDDVVSLSNLQRQVIHRTQD
    VGRPKTDSASDAIAALNPHVELVTHAVRLDAGNALDLIARADVVVDGSDNFATRYLVSDACVLAKKPLVTAALGAFDATV
    TTLRAHETAPDGTPNPTYRCLFPEPPPAGTVPA
    CAEAGVLGALAGIAGSLAALEAIRAVVGFGEGLVGRLLMIDARAMRF
    ETLSYGWDPDNPLTGTGERITDLSAHVRTR

    >gi|154248050|ref|YP_001419008.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Xanthobacter autotrophicus Py2]
    MSTPDETPAPARPRRRLWLVALPLVLFLALAGLFFSRLETGGDPSRIPSALVGKAAPRIALPPLDGLNGPGGTPLPGIDL
    AALAGKPTLVNVWASW
    CGPCRDEHPVLMQLAKDGRFNLVGINYKDAPENARRFLGQYGLPYQAVGVDPKGRAAIDWGVYG
    VPETFVVARDGTIAHKFVGPLTTEAVNTTLLPLIARLSGN

    >gi|154248115|ref|YP_001419073.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Xanthobacter autotrophicus Py2]
    MSQFPEAGAKAPAFSLARDGGGTVALKDFKGRKLVLYFYPKANTTGCTKEAIAFNGLKAAFAAADTDILGVSADAVSAQD
    KFKAKYDLAFPLGSDPDKAMLEAYGVWVEKSMYGRKYMGIERATLLIGRDGKVARTWPKVKVAGHAEEVLKAAQELG

    >gi|154248140|ref|YP_001419098.1| peroxiredoxin [Xanthobacter autotrophicus Py2]
    MSLVNTPVKPFKTTAFKQGKFIDVSEADLAGKWSVFFFYPADFTFVCPTELGDLADHYEDFKKLGVEIYSVSTDTHFTHK
    AWHDSSETIGKVQYAMLGDASGAITNNFEVMRAGQGLADRGTFIVDPNGIIQAVEVTAEGIGRDASELLRKIKAAQYVAS
    HPGEVCPAKWQEGEATLAPSLDLVGKI

    >gi|154248141|ref|YP_001419099.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Xanthobacter autotrophicus Py2]
    MLDTAMKTQLKAYLERLVRPVEITAFVDDGAKSKEMLELLSDITDCSPKVTVAERRDGDAAGARVPSFALSSPGESIALT
    FAGLPMGHEFTSLVLALLQTGGYPPKLEAEVIEQIKALDGDFVFETYFSQS
    CQNCPDVVQALNLMAVLNPKIRHVAIDGA
    LFQKEVDARQVMSVPTVYLNGEVFGQGRMGVEEIVAKLDTGAAARDAKRMAEMNRFDVLVVGGGPAGATAAIYAARKGIR
    TGVAAERFGGQVLDTMAIENFISVPYTEGPKLAAALEQHVREYEVEILNLQKAVKLVPGADIVEVEFANGASLRSKTVIL
    ATGARWRQMNVPGEDTYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLMEFDSALRADDVLQRKL
    KSLPNVTILTSAKTTEVLGDGQKVSGLTYENRNTGESVKVELEGIFVQIGLLPNTEWLKGTVELSPRGEIVVDAHGQTSV
    PGVFAAGDCTTVPYKQIVIALGEGAKASLSAFDHLIRSSAPKEEAVKAA

    >gi|154248163|ref|YP_001419121.1| iron-sulfur cluster assembly accessory protein [Xanthobacter autotrophicus Py2]
    MDLPYGPLPASIRKVDIMETSLAPTAAADLPAPDAEFTVTDAAARRICQILSPEPAGTFLRISVEGGGCSGFSYKYDVTR
    EQGEDDLVIEKEGAKIVVDRISIDYIKGSQLDYKADLMGSAFKISNPMATAKCGCGSSFGV

    >gi|154248176|ref|YP_001419134.1| alkylhydroperoxidase [Xanthobacter autotrophicus Py2]
    MSHTTQRHAFGAASLGIAVAIACLPVWPGPAQAQSPSQGMTRSVSAEETYRDIEQTLGLVPSFFKAFPDAGIAGAWAEFK
    AVQLNPQTQLSGKEKELIGLAVAAQVPCHY
    CVYFHTAAARLHGASEAEIREAVAMAAITRHWSTVLNGMLVDEAQFMKET
    DTAMAMAAAKMKGGTAPTSAKGQ

    >gi|154248533|ref|YP_001419491.1| iron-sulfur cluster assembly accessory protein [Xanthobacter autotrophicus Py2]
    MSVASETSTAAPAPSPAKRSLPPVIRITDAAAEQLREILAAAEPGTALRVGIENGGCAGMSYKMDFTTEIAPFDSVVEDK
    GVKVVVDTKAVLFLLGTEMDYKTDKVSSQFVFNNPNQTSSCGCGESVAITPVDMSAASGQG

    >gi|154248597|ref|YP_001419555.1| rhodanese domain-containing protein [Xanthobacter autotrophicus Py2]
    MSETVDTPASPFVSTEWLAANLGAPDLVVVDASWHMPNSGRSGAKEYLERHIPGAVHFDIDTIADHSTPLPHMLPDAHAF
    AVAVGALGIGDGLRIVVYDSVGLFSAPRVWWTFRAFGARDVKILDGGLPKWLAEERPVEDGPVRRLPATFNPRFDHSLVA
    DIERVDQALKSGSAQVLDARQDTRFRGEAPEPREGLPSGHMPGSFNLPHGRLVKDGRLVSPEEIRTVVEASGLDLSRPVI
    TS
    CGSGVSAAILWVALELIGKTPLALYDGSWTEWGASGKEIAVG