Bacillus tusciae DSM 2912 uid48361

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|295694983|ref|YP_003588221.1| glutaredoxin [Bacillus tusciae DSM 2912]
    MSYSVAAKDERPQVTLYTSSFCGKCRFAREFLNRLGIPFEEVPVYTPGVVEELLSRTGMMAAPTLRVGQDYVTGYDPGRF
    TLALIKNGWIEDKEDN

    >gi|295694992|ref|YP_003588230.1| dihydrolipoamide dehydrogenase [Bacillus tusciae DSM 2912]
    MVVGEFTTEVDLLIIGGGPGGYVAAIRAAQLGKKVTLVERDKLGGVCLNVGCIPSKALIAAAHRYEDVKKLDEIGIQAGD
    VRVDFAKVQTWKQGVVDKLTGGVASLMKANKVEVIKGEALFANDREARVINGYEANRYRFNQCIIATGSRPIELKDLPFG
    GRVISSTEALSLQEIPRRLLVIGGGYIGIELGTVFAKFGTQVTVLEGTESILPTFEKEVLRLVERRLKKLNVTVVTSAMA
    KGVEETADGVTVTASVKGEEQRYEADYVLVTVGRRPNTEDLGLDMAGVRTEKGLIQVDKQGRTSVGHIFAVGDVVPGPAL
    AHKASYEGKVAAEAAAGEASEVDYRVIPAVVFSDPEIAVVGLSESEAKEKGLDVVTGRFPFAANGRALSLTDAEGFVKLV
    ADKSSGELLGAQIVGPEASDLIAEAALAIEMGATLEDVALTIHAHPTLGEVMMEAAEVGLGRPVHIAPR

    >gi|295694997|ref|YP_003588235.1| Rhodanese domain protein [Bacillus tusciae DSM 2912]
    MREWSGEDLWRRMQEGTAPRIIDVREPVEYYEHGHIPGAELIPMGEISAALGRISKHEEIVFVCRSGSRSGYVCQFLQRL
    GYERVINLAGGMIYWPGAVNYGPESEGA

    >gi|295695001|ref|YP_003588239.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus tusciae DSM 2912]
    MTGKRKSGMGFTIFVVVVLLIAVAVVINVTKSNGSEAGAGGGAALPIKGYQAPDFTLKTFDGQAVTLSQMKGKPVFLNFW
    ASW
    CPPCQAETPDLVEMHKKYGDKIAFYGINLTQQDDQQKALDFIKNYKIDYPVLSDAEGKVSDLYRVQAIPTSVFIAPD
    GKIVELVQGLMTKQDMDRLFGELASAK

    >gi|295695029|ref|YP_003588267.1| hypothetical protein Btus_0351 [Bacillus tusciae DSM 2912]
    MPGEVNLDPAAYTASDLPGDKNVTLVFYCKDPGCGAARHAARRAERMGYPHVFVMPDGIEGWVRAGNAVEQG

    >gi|295695037|ref|YP_003588275.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Bacillus tusciae DSM 2912]
    MAANVIVYTSTGCPYCHNVKEQLKEWNVPFEERNVSEVREYFEELRSRKIFGTPATLINGKIILGFQPKKMRQALGLDER
    SNAAGAGQETPVRPDEIFQTVTPEILNEVYDFVAIGGGPAGSSAAVYAARGRLKTLVIDKAPASGTLAITHKIANYPGVR
    KTVTGLELLSEMQLQAKEFGATFARTQVLSVDFSDPHEKKIHVPEGVIRAKSVLIAVGAKAPPGKIKGEEEFTGRGVSY
    C
    STCDAAFFENRVVAVAGDSEEAVHEAEALAKFCKEVRLLIPGSSLKGEVDLSGLEQRPNVRIYRRHRIKEILGNHAVERI
    VVLDDGRREQTWEVDGVFLYLAGMKPGTDFLQDQVRRDEEGYVIVDEFLRTNVPGVFAGGDARRTPAKQAVVSAADGCVA
    ALGADQFVHQREKMRVQYS

    >gi|295695038|ref|YP_003588276.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus tusciae DSM 2912]
    MTTPFVGKSSPDFTMETALGNGEGFGKASLSDYKGKWLVLFFYPLDFTFVCPTEITALSDAHEQFAALDADILGVSVDSQ
    FTHRAWIHTPREQNGLGPLNFPLASDITKQVSRAYGVLVEEEGVALRGLFIIDPEGIVKYQVVHHNDVGRSVDETLRVLQ
    ALQAGGLCPANWNPGDKLL

    >gi|295695073|ref|YP_003588311.1| protein of unknown function DUF255 [Bacillus tusciae DSM 2912]
    MTTTNKPNRLAREKSPYLLQHAYNPVDWFPWSEEAFEKAQQENKPVFLSIGYSTCHWCHVMERESFEDPEVAELLNRHFV
    AIKVDREERPDVDHLYMAACQALTGQGGWPLTVFLTPEKEPFYAGTYFPKRSRYGRPGLMELLTRVAQLWEKGADRVKDA
    GRHLTGQIGEALGRAAQGEVDAGTLTRAFEQLLASYDHTFGGFGHAPKFPRPHDLLFLLRYGVRSGRREAFDMVQGTLEG
    MRRGGIWDHVGFGFARYSTDRRWLIPHFEKMLYDNALLVLTYLEAYQALGDQRWAQTAREIVTYVRREMTDPGGGFYSAE
    DADSEGEEGKFYVWTPQEITEAVGPEDGEVLCRYFGVTEEGNFEGGRSVLNEIDTDVDLLARELGMTPEEIDRKVRRGLE
    ILHSVRDRRVHPHKDDKILTAWNGLMIAALARGARVLGDADYLVSARRAAEWLWRTLRQGDGRLLARYRDGEAGILGYLD
    DYAFYIWGLLELYQADGDVAWLRRAIRLAQDVRTLFWDEKEGGCFLTGSDAEALWSRPKTAEDGALPSGNSVLALDLLWL
    GRLTGDPAWERWAEAQLRAFAGAVSRYPAGYTFFLTAWDFALGPSEEIVVAEPMRNEEGSSGEGFPGVPQAQGSLAAARW
    PAEVRRLYLPRALWVVRPDGAEGDRVSEVLPWVSGHRSKGGETQVYICRGNACERPLPWGHAVARLQSIGSGFVDE

    >gi|295695135|ref|YP_003588373.1| arsenate reductase and related protein [Bacillus tusciae DSM 2912]
    MVTFLGYPRCGTCRKAKAWLSEQGVAFVERDIVKHPLNREELGSLVAAAGVAPGELANPKGTRYRELGLKDQTLSDEEWL
    ALLSEDGKLYKRPILWTDRAVVIGFAPDRWVEVLKN

    >gi|295695278|ref|YP_003588516.1| Rhodanese domain protein [Bacillus tusciae DSM 2912]
    MVFSISTDELYRRIEQGEPIFLLDVRNTDEYSNWKIEGPNVQSINVPYFDFMEDEDKAVSQVPKDKDLVVICAHQGSSAY
    VADVLDRRGYRAVYVQGGMAAWGNTYHVVPVVEEADWTLLQINRVGKGCLSYFMFSKGEAVVVEPLRNVNLYTELAEKYG
    VTIRHILDSHMHADHISTGPELAARTGATYYLNSSEGSKVRFEPLEKYEKLQSGNIEVEVLVVKTPGHTPGSLSFFVNRK
    YLLSGDTIFVGGLGRPDLGGKAREWAEDLYDTVFGKVAALADDVIVLPSHYASFAELNDKGVVADTLGNIRSRNEMMHVT
    DRQRFIEMVVESDSALKPPNYLDVLAINRGDFQVDAARADELEMGPNRCAAHHAAAS

    >gi|295695287|ref|YP_003588525.1| thioredoxin [Bacillus tusciae DSM 2912]
    MSKEVTDATFASRVEQVAGPVLVDFWAPWCGPCRMLAPVLDELEKEWAGKLEIYRLNVDDNPSTAGRFGIMSIPTLLLFK
    NGQVVQQVIGYQNKARLSATLRPHLS

    >gi|295695419|ref|YP_003588657.1| thioredoxin reductase [Bacillus tusciae DSM 2912]
    MVYDTIILGGGPAGLSAAVYALRSGLKMLLVERGLYGGQMQNTEEIENYPGFTSILGPDLSEKMREHAESLGLQTERGEV
    ESLEFGPPVHRVHLSGGEVLETKTVIIATGCEPKKLGIPGEKEFSGRGVSY
    CAVCDGAFFKNKNLYVIGGGDSACEEGVY
    LTRHAAKVTIVHRRDKLRAQPVLQERARSNEKISFLFNRRPVEVQGERKVERLVLENAVTGEQETVEADGIFIYIGLKPN
    TEFLKGTPIVNAEGWIPTDDRFRTAVPGVFAAGDVRETWLRQVVTAVAEGAMAAMSAYYYVEEQS

    >gi|295695428|ref|YP_003588666.1| HesB/YadR/YfhF-family protein [Bacillus tusciae DSM 2912]
    MTVSPEARRYILDLARAEERPWRGVRLQVIPGCGGPRFLLSLDDPRPGDTEITASELTILADPFSATFLDELVVDYSAEE
    DDLTFRHPDRFGSIC

    >gi|295695582|ref|YP_003588820.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Bacillus tusciae DSM 2912]
    MRKRFVIIGGDAAGMSAASQIRRLQPDAEILAFEKGSTLSYAQCGLPYLIGGVVPEARNLIARTPEEFRDKYRIEVFIRH
    EVTKILPEENAVIVKDLAEGSEKRFSYDTLLIATGGHAIFPQWEGRDLEGVFPLKDMDDALRIQGWVRKEHVSKVVIVGG
    GYIGLEMAEAFHHLKKEVAVLDLAPQVAGTFDPEMAHLAQQELEQNGIRVALNEEVVALRGEKGRVTGVETKTGFHPADL
    VLVAIGILPNSELAKNAGIELGVKGAIRVDDRLRTNRPNIYAAGDCAVHHHRVKEAEDYIPLGTTANKQGRIAGTNMGGG
    DAHFAGVVGSAIMKVLNVAMGRTGLSEREVKQLSVPYEVVSIRSRDHAGYYPNGEQLHLKLLYHKENRKLLGAQIVGKHG
    VDKRIDVIATALYAGLTIDQLQELDLSYAPPFNSVWDPVQQASTVAGRS

    >gi|295695798|ref|YP_003589036.1| nitrite reductase (NAD(P)H), large subunit [Bacillus tusciae DSM 2912]
    MSKKKLVLVGNGMAGIRCIEEILAADPEAFDIIVFGAEPHPNYNRILLSSVLAGDTRLQDIVLNDWSWYEQHGITLYTGH
    PVSRIDIPNKRVCTSTGIEEPYDELILATGSLPILLPVPGSDKEGVIAFRNIED
    CRTMIEASKTYSKAVVIGGGLLGLEA
    ARGLLHLSMDVSVVHLFDCLMERQLDPTASKMLQAELERQGMRFLMEKQTAEILGDRRVTGVRFSDGTEEPADLVVMAVG
    IRPNTALAKEAGIAVNRGIVVDDELRTSEPNVYAVGECAEHRGVVYGLVQPLYEQARVLALSLCGRTPAPYTGSVTATKL
    KVSGVDVFSAGEFLDGPDTRAVRIHDEMEGIYKKVLVRGGKVTGAVLFGDTRETTRLVNWIREGVEVSPGDIWSLLSVPA
    ASPSAATGSPVTGMSADEIVCGCNGVTKGAIVHAIEEYGLKTVEEIKAATHASRSCGGCRSLVQQILESVLGSDVPSAGA
    QGICPCTTLSREVLIEEIRAKHLTNVKEVMNVLGWANPDGCSKCRPALNYYLSMLWPEEHADDPASRFVNERLHANIQKD
    GTYSVVPRMYGGVTTPGELRRIAEVAEKYGVKMVKITGGQRIDLLGVGKQDLPRIWEDLGMPSGYAYGKAIRTVKTCVGT
    DFCRFGTQNSIGMGIQIEKRFERLNTPAKVKMAVSGCPRNCAEATVKDLGVVGIEGGWEIYVGGNGGVHVRKADLLCKVI
    TEEEVLEIAGAYLQYYRETAHYGERTSQWVERVGLDGIRQVILDPQQRSALVKRLEQALAVTTDPWKTVAESPELQRLYQ
    EIPVAP

    >gi|295695904|ref|YP_003589142.1| NADH:flavin oxidoreductase/NADH oxidase [Bacillus tusciae DSM 2912]
    MYELLLSAGRIGRLVLPNRVIMGSLHLGFENFPKGAEYLASFYAERAKGRVGLIITGGSAVTPEGASDLQFSRIWDSTES
    DKFVRITTAVHQAGGRIALQLFHAGRYAREDKTGLQPVAPSAVPTRMSPTLARELREDEVEAIIEAFGRGAALAKEYGFD
    AVEIMGSEGYLINQFLSPVTNRREDGWGGTFEKRARFGLEVARSVRRCAGEDFPVIFRMSGLDLIPDSTTWEETVRFARL
    LEENGVDALNIGIGWHESAIPTVQAHVPHAAFAHVAGEIKRAVSIPVVVSNRINRPELANRLLAEGVADFVSMARPFLAD
    PHFVRKVEEGRPESINTCIACNQACLDKTFTHRPVSCLVNPQAGRESLLPVVRTENPMRVAVVGGGPAGMEACRVLALRG
    HRVTLFEKERSLGGQFRWAGRVPGKGDFVRTIEYYSHELNRLGVDVRLHTAVSGSVLQSFDACVLATGVVPRSVSMPGSD
    LPHV
    CYYTDYFEDRAVVGEKVVVIGAGGIALDVALRLTEGKISPEVALFLLEQAVEDVSSISERLRPRRKVTLLRRGRRV
    AEHVGRTTRWVVLNELARRGVDIRTEIRYKAIVPGGVEIEEKGKSVVLPADSVIIAAGQESNRTLLEELTALGFIRLQIP
    DAQTWLNGERLEPLVPSLPPVQEGKPLFVIGGANDPEALDAERAILEGTLAGRLI

    >gi|295695924|ref|YP_003589162.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus tusciae DSM 2912]
    MPLVGRPAPDFEMLSTKNMKTLDEKVRLSDYRGKWLVMFFYPMDFTFVCPTEITAMSDRAQEFFDLDAEILGVSVDSVHV
    HKAWINTPRDKNGLGEIRYPLASDITKSVSRAYDVLIPEQGVALRGLFIIDPEGILRYQVVHDLNIGRSVDETLRVLEAL
    QTGGLCPADWKPGDKLLEV

    >gi|295695925|ref|YP_003589163.1| hypothetical protein Btus_1294 [Bacillus tusciae DSM 2912]
    MPMRLGTPFPGLEGATEWLVVDRPPNIEIGRPILIHFWAVSCHICHETLPNLLAYRDRYVPKGLQLVSIHMPRQEADTDV
    EMVKKDIQEFGIHHPVAVDNLHRIADLYQNQFVPAFFLFDTEGHLKFRAAGDRGLQNVEKKLEELFAESAPSQP

    >gi|295695932|ref|YP_003589170.1| UBA/THIF-type NAD/FAD binding protein [Bacillus tusciae DSM 2912]
    MISDQERYSRQFLFPPIGVAGQEKLRASRVVIVGLGALGSALSQHMVRAGVGFVRLIDRDYVEPSNLQRQMLYDEQDALQ
    SLPKAEAAAIHLRAFNSSVHVEPLVTDVTWRNAEKLLTDVDLILDGTDNFEIRYLINDVAIKHKIPWIYGGAVSARGVLL
    PVIPENGPCLRCLFPEPPGPGDAPT
    CDTVGVIGPVVDVVASLQAAEALKWLVGDRDHLRRTLLHLDLWDNEWSEISVSHA
    RRPDCPTCGLRRFDFLSPRERQAISLCGRNTVQVTLGSPLDLDALEPRLSALGRVRRNPFLLRAEIEGKRLTLFPDGRVL
    VQGTDDPAVARSLCARFVGV

    >gi|295696261|ref|YP_003589499.1| DSBA oxidoreductase [Bacillus tusciae DSM 2912]
    MFTMRITSYFDYNCVFCYIGRYRLREAAKRTGASIEWVAWSMPEGASPPPKPDDYREGVKRYVRAASEDLGLDIRLMRPV
    DTRDALTGMYYAREEGVEEAYHQQVFDARFLKGLDVSDRRVLTECAEAAGLSGSRYLNTLDQEKYRALLEADFQRAAGAR
    IWTIPVYEADHRRLEVHHYDQLPTAGGLVDSLKLTGVKAED

    >gi|295696334|ref|YP_003589572.1| DSBA oxidoreductase [Bacillus tusciae DSM 2912]
    MKIEFFHDVLCAWCYVISPRVRQLAEEFPDVEIVHRSFALAPGPEDIGRMFGSKERAKREILNHWKAANANDDERRIRAE
    LMETRDFDYPHSLPGLMACKAAEFQGGQRAHWDYFDRVQKAHLTECRNIADGEVLLDCAGEVGLDVERFEQDFQSDRARQ
    AVEDDVRRARELGIRAVPSLVGTGSLLVGAQRYDSLKTWYINQQDPR

    >gi|295696477|ref|YP_003589715.1| iron-sulfur cluster assembly accessory protein [Bacillus tusciae DSM 2912]
    MITLTQEAAGKLRELIADKGSEDLAVRVFIKAGGCSGFSYGMALDEPKNEDNVVESEGVRVVIDPMSAPYLTGAEIDYVD
    TLTGAGFKIHNPNAVSTCGCGHSFRTADQADEPGYCDH

    >gi|295696571|ref|YP_003589809.1| copper ion binding protein [Bacillus tusciae DSM 2912]
    METKVLHIKGMSCSHCVHAVKSALSALAGVHEVDVDLDKGKASVKFDGSKVGETQFRKAIEEAGYELTGMSDR

    >gi|295696578|ref|YP_003589816.1| glutaredoxin-like domain protein [Bacillus tusciae DSM 2912]
    MMIPEKDRQKIRERFSAMTEPVVLRFFESSIDCPTCPQIKDLLQEVADLSDKLTLEVFNLYTDEEKAKEIGVDKAPTLAI
    LGGSGQDYGIRFYGAPAGYEFAAFLEAILMISRGDSGLKAETKTKLATIDQDVTLNVFVTPT
    CPYCPSAVHLAHQFAFEN
    AHIRGHMIEATEFPEWANRFDVYGVPKTVINDLDSIEGAVPEAVLLDQVMAVASKA

    >gi|295696681|ref|YP_003589919.1| heavy metal translocating P-type ATPase [Bacillus tusciae DSM 2912]
    MAVPNDRLLDRNPGIAEKPGQPANRPDPVRPQEHVYRLANLSCADCAAKFEDKVKRASGVVDARVLFGSSQLIVVGQPLS
    VDELERLGAFDNIKVVAGADAAAPELAGRGVLSAERSPWWAEPRVGRAAMALLLIAAAHVLQGSGAAPVIATTAYAAAVL
    LGGWGTFKKGIPGIFRLDFHMNALMTVSVAGAMAIGYWSEAATVAFLFGVSEALENHAMDRARRSIRSLAEMAPTRAMVR
    REGKEMIVPVEAIRVGDVMIVRPGEKIALDGRVIRGRTEVNQAAITGESLPVAKEAGDAVFAGSLNHSGAIEVEVTSRAG
    DSTLARVIALVERAEAERAPTQEFVNRFARIYTPAVTVLAVGMALIPPLVWGAAWLPSIYEALALLMVACPCALVVSTPV
    AVVTAMGVAARSGVLIKGGIHLENIGRLRAIAFDKTGTLTSGEPVVTDVIGFQTMTEEDILRVAAGIERYSEHPLAGAIL
    RAAADRGLTPGEVEDFESFPGRGARGTVGGTEYWIGSPRWFRERGVNLESVNNRIGGFQEEGKTLVLLGRRDTVTALIAV
    ADRVRPSAREVVANLKMAGIGPTVLLTGDNPATARAIGRTVGVDEVRAGLLPEDKVRAVSELRQRYGRVGMVGDGVNDAP
    ALAAATTGIAMGTSGTDLALEAADVALMNDDLSKVPFAVRLGRATLRIIQQNIFIALFMKTAALLLAFPGWLTLWLAIVG
    DMGATLLVTANALRLLRVRPRS

    >gi|295696864|ref|YP_003590102.1| transcriptional regulator, ArsR family [Bacillus tusciae DSM 2912]
    MAANSRPFKEAVYAELARLGKAMGNPRRMELLDLLSQGPKSVEALARETQQSLANVSQHLQTLLDARLVKFYKRGNYSVY
    QLADDRIMDLLLKVQELGEWLYRAIETERETWIQPLDSHMPLTADQLSVLMKDSDVVLIDVRPRDEYEFDHIPGAWSIPI
    EELEQTMAKLPKDKQIVAY
    CRGRYCLFAAEAVQILRRHGYRAVRVEQGVREWRRATSVSGGRIVR

    >gi|295696964|ref|YP_003590202.1| Peroxiredoxin [Bacillus tusciae DSM 2912]
    MVAQGQKAPDFTLPTGTGETVSLADFRGKPVVLYFYPRDNTPGCTQEACGFRDLHEAFSEVGAVILGVSTDSPSSHKKFA
    EKYQLPFPLLSDEDAAVSTAYGVYKEKTRYGKKSMGIERTTFLIDGDGVIRKIYPRVKVEGHMEQVLEDVRQLSNG

    >gi|295697025|ref|YP_003590263.1| Rhodanese domain protein [Bacillus tusciae DSM 2912]
    MSTGSAKDGPLVSVQWLKERIGSPDVAVMDCRFTLNEPDAGEARYREGHIPGAVYLHLERDLCGPKGQGGRHPLADPDRL
    ARVFSEAGIGSGTVVVAYDDQTGEFAARLWWTLRYLGHEQVRVLDGGYAEWQKAGYPVTLEIPTPAPANFVPRVRPEMMV
    DAEYVSRVVSGQAPGALLIDSRAPERYTGEQETIDPVGGHIPGAVNIYWKDGVDEDGRWKRPEEQRRRFSGVTGERELIV
    Y
    CGSGVTACANLLALEIAGISGARVYVGSWSEWCADPGRPVGRGPKP

    >gi|295697032|ref|YP_003590270.1| methylated-DNA/protein-cysteinemethyltransferase [Bacillus tusciae DSM 2912]
    MAVYDELETPLGTLRVVMDSVGVSRVALTEEDWGEIQREFHDLVRDPESCRDAVRQLDEYFSGRRRAFDVALSLPEDSPF
    RRRVWAALCEIPYGEVRSYGEIAAALGNPRAVRAVGQANRANPLPIFIP
    CHRVVGKKGDLVGYAGSRTDLKAHLLRLEGA
    LAE

    >gi|295697052|ref|YP_003590290.1| hypothetical protein Btus_2486 [Bacillus tusciae DSM 2912]
    MSEETKKCVYIHTSGVEAPYRAASPFFLATTAALMDYDVSMVFTIKATGLLKKGVAETLQVKEGGEGANLQFFIDQARDA
    GVKFYV
    CAPSLDLNDVTVEDLIEIDGVVGGTAVNEMLLEADLVVSF

    >gi|295697077|ref|YP_003590315.1| glutaredoxin [Bacillus tusciae DSM 2912]
    MLELYGTQGCPYTRELRENLLWEGKEFQEYDVEEDLEALKRVLDLTGGRTVPVLVEDGRVVQVGYQGRGCIVSLPSVEE

    >gi|295697148|ref|YP_003590386.1| electron transport protein SCO1/SenC [Bacillus tusciae DSM 2912]
    MTVKGSISKRPKVRRAALWWAAGSVAVTVLAGCGATASPDSGTAAQGQGGVIQNTSQAQDLRQANWHIQPYQATDQDGKP
    FNTDQMKGKIWLADVIYTN
    CPTMCPVMTPNMAQVQKKLKEAGTSAEIVSFSCDPDTDKPEVLKKYAERYNADLKTWHFVT
    SPGFDITKDFVFKSFHSALTKNPPEVSGGITMYNHTTQFFLINRNGQIVKMYDGLKPPIDQIVQDVKALE

    >gi|295697156|ref|YP_003590394.1| copper-translocating P-type ATPase [Bacillus tusciae DSM 2912]
    MEKGKAKLRITGMHCAACATRIERVVKRQEGVLDVNVNLALERATVTYIPGAVDLEELIDRVEKLGYGAHLDQPTKDSAG
    DRRRQWEMFVFSLILSLPFLWVMAHMAGFPYIPRAFLNPRVQWVLATEIQFVAGWAFYVGAWKSLRSGSANMDVLVALGT
    SAAYGYSVWMILRGSGHLYFETGALIITLVRLGKILEAHAKTRTADALAELVSLQVKLAHLWTRQGERDVPVQQLQVGDV
    VVVRPGEQIPADGRVVAGESDVDESMMTGEMLPVVKRAGDLVYGATLNQQGTLRIQVQRVGADSALGRIIGLIEEAQASK
    APVQRLADSICNVFVPVVIAISAGTFGVWFFAGGGTTSALPTALMNAVAVLLIACPCPFGLATPTAVMVGTGRAAQMGIF
    FKGGEALEQLHRVQVMLLDKTGTLTRGRPAVTDVRVIRPGPLRSRNDLIRLAASAEGPSEHPLGRILAEGATGLGPLPEP
    EGFVSSGGGGVRAIVEGRTVVIGSGRFLEECGVEGVVPPEKDLWESEGKTVIQVGVDGRLAGLIAVSDVLLEESRRAVKA
    LQAMGIELVMVTGDNRHTAEVVSRQVGIRHVLAELSPEDKVRVIRKYQKRGRKVAMVGDGINDAPALAAADVGIAVGTGA
    DVALDAADVALIGTGLEGVVRAVRLSRATLRNIRQSLFWALGYNIIGIPAAAAGWLSPLIAGASMAFSSVMVVLGALRLK
    RVRI

    >gi|295697219|ref|YP_003590457.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus tusciae DSM 2912]
    MNGAGEGSSASSGPGAPTPQAFKWALLIPVVLLGAALAYAAWHLAGGGGPKAAVGQSAPELTLTDLEGRTFHLSDYRGRV
    VVLNFFTSW
    CPPCQQEAPDLARFAQSAGPGTVLVMVDRGEAEGPVRRFIQQYGIDAHVVMDPDNRASQAFGVTGQPETFI
    IDRQGIIRQHVIGPTTATGLEQMTAPWE

    >gi|295697231|ref|YP_003590469.1| heavy metal translocating P-type ATPase [Bacillus tusciae DSM 2912]
    MATEIKEHAASGSAEGRRPDRAKVTLAIQGMTCAACANRIEKGLNKLPGIEEAFVNLALEKATVEFDPRQVSVKDIEDKV
    RSLGYNVAKQRLELDLSGMT
    CAACANRIEKGLNKLPGVEATVNYALERAALTYYPGAVEIDDIVKTVRDLGYDAKVHEEE
    GTAVDDFRRKESVEKRNRLLISTLLSLPLLYTMVGHIPGLHGIPVPGLLMNPWFQFALATPVQFLIGWVFYRGAYKSLRN
    GSANMDVLVALGTSAAYFYSLWGTLRWVAAGSTGHSPALYYETSAVLITLILVGKWLESAAKGRTSEAIRHLMGMQAKTA
    TRVRNGREEQVPVDAVIPGDWLRVRPGEKIPVDGRVLEGLSTVDESMLTGESVPVDKKPGDAVIGATVNGNGTLLIEAVK
    VGKETALAQIVRAVEEAQGTKAPIQRIADTVSAIFVPVVVGIAVVVFLLWFWLIDPGNFTRALENGIAVLVIACPCALGL
    ATPTSIMVGTGKAAELGILFRGGEHLERAQKINAVILDKTGTLTTGKPALTDIVVKNGDEGELLRLAASAEGPSEHPLAQ
    AIVRGAMERGMTTESADSFEAIPGYGVRAVVAGHKVLVGTRALLRQEGIEISAVEGAAQELEGLGKTAMFVGIDGKVAGV
    LAVADTVKEKAAEAVRRLKDLGIQVVMATGDNRRTAEAVARQVGIDEVWAEVLPQGKADRVKALRDRGKVVAMVGDGIND
    APALAAADIGIAMGTGTDVAIETADITLVGGDVTGVARAVELSRKTMRNIRQNLFWALAYNSVGIPVAAAGLLAPWVAGA
    AMAFSSVSVVLNALRLKRVKVA

    >gi|295697258|ref|YP_003590496.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Bacillus tusciae DSM 2912]
    MTKHYDRFQPTICINEDDHREFDAIFIGGGAAGRFGSAYLRAMGGRQLIIEKGDHLGGQCCKNACVPHHLFFDLTVQLDQ
    LRRFGGTYVWPKLDFKPKLADIIQMYLNGRENLYDFMFEQSKEQLGIEFILNHEPRIIDNHTVEVAGRAFKTKNIVLALG
    SRPNRPDIPGLHLKGVIDHTSLVEGVLDYEPERMVVIGGGHTMAPYASFFCALGMETTVVNRSPVLKKMDLETKAYVLDM
    MRERGVKFYENCPPLAILGEDRVTGVKIRTPEGEKVIPCDTVFLATGMRPNSDYPRQALGIEVDAKGTVIVDEYLRTNVP
    NVYAVGDLIGAPMEMFKARRSGMVASRNILGVPTRWQVGMFAEQFHSFYEVTYLGLTEEKAREMYGDDLMFIRMPPGDRS
    IALPAAERSITYSFLAPELSGFQKAIIQKSTRKVLGLHHVGFGAKEGFQYLSWIMQNGELTIDDFAEMNELFLNPSHFIQ
    LARLRAGQRELVNL

    >gi|295697338|ref|YP_003590576.1| mercuric reductase [Bacillus tusciae DSM 2912]
    MSNKLQVRLAVRGMTCTDCEEHVKKALHSAGAEKISVNFRRGEATFEISDASGIEAAKRAVADSGYEPSNAEILHPLRSD
    STFHRTSGDDYDLLIIGSGGAAFSAAIEAVSRGAKVGMIERGTIGGT
    CVNTGCVPSKTMLRASEIHHLAAQHPFPGLETS
    AGPVNLHQLVGAKDELVAELRQHKYIDLIDEYGFDLIRGEARFADPSTIAVAGRMIRAGRYLVATGASPAVPDIPGLADV
    DYLVSTAALELTEVPQRLAVIGSGYIGMELGQMFHRLGSEVTLMQRSGRLLRAYEPEVSEAVSLALAFEGIHILTGVTYE
    RVEQHGDLKRIYITVDGQQRVVEADALLVATGRTPNTAALNLEAAQVRVGSRGEVLVNEYLQTSNPNVYAAGDVTLGPQF
    VYVAAYEGAIAAENALSGERRKVDLSVVPAVTFTSPSIATVGMTEARARSKGYEVITSVLPLDAVPRALVNHDTAGVIKL
    VADGRSRKLLGVHVVADNAGDVIYAGVLAVKFGLTIEDLTSTLAPYLTMAEGLKLAALTFDRDVAKLSC
    CAG

    >gi|295697762|ref|YP_003591000.1| protein of unknown function DUF395 YeeE/YedE [Bacillus tusciae DSM 2912]
    MVSVIVLGLLCGALLGFVLQRGRFCWVSAYRDVYVLGDTRLFVATMVAIAVQSIGVYALAALGAIRIAPVPFTWVGAIAG
    GFVFGIGIVMAGG
    CATGTWYRVGEGLIGSWIALFGYMLGAAVMKYGALKPLYDRLTAAKGPDSFVYQSLGVSPWVPIAAF
    ALVTAWAVRWHLRREGGPMPGLPAKKRGLNHLLFERRWHPFFTGILVGLIAVLAWPLSEATGRIYGLGITTPSANLLRYL
    VTGDLKSIDWGVFLVLGIALGSFLAAKGSGEFRWRVPPAKTAVISLIGGLFMGFGAGLAGGCSIGNGLVNTSLWSWEGWA
    ATPAMILGTWFAAYFAVVRPMRAAGAPGRGAALRQGA