Wolinella succinogenes

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|34556486|ref|NP_906301.1| putative formate dehydrogenase iron-sulfur subunit [Wolinella succinogenes DSM 1740]
    MESQARVKFYCDEARCIDCHGCDVACKEAHHLPVGVNRRRVVTLNEGLVGKEKSLSIACMHCSDAPCAQVCPVDCFYVRA
    DGIVLHDKEKCIGCGYCLYACPFGAPQFPKSGIFGSRGPMDKCTFCAGGPEETHSEKEYKLYGQNRIAEGKVPVCAAMCS
    TKALLAGDSDSISLIIRERVLKRGSGTASVPYTWSQAYKD

    >gi|34556527|ref|NP_906342.1| putative lipoprotein thiredoxin [Wolinella succinogenes DSM 1740]
    MTKTLLSSLALVTLLVLAGCDDKEGIKSEVISQKRDTEATKFSLELTDGHKLKVDRHEKGLHFEGEKGKVVLLNFFATWC
    PP
    CKAEIPHLVNLKSNYKDQFEVVGVLMEDSKTKGEIQKFIDTFDINFKIAISNENQKLAKALGGVKSIPFMILYDPQGN
    YFTHYVGAVPEEMIEFDIKRAMEKQ

    >gi|34556641|ref|NP_906456.1| bacterioferritin comigratory protein [Wolinella succinogenes DSM 1740]
    MESAPAFCLKNQDEAEICLRDLKGAWIILYFYPKDSTPGCTQEACDFTESLPRFETLQAIVLGVSPDSPRSHQNFIAKSD
    LKITLLSDPTKEVAKAFGAWGEKKLYGKVSEGIIRSTFIIDPQGRIAHAWRRVKVAGHAKEVLETLEKLQKS

    >gi|34556762|ref|NP_906577.1| putative thioredoxin reductase [Wolinella succinogenes DSM 1740]
    MKKVYNIAIIGGGPGGVASAVEAVILGIDDVILLEKGENHSTTIRKFYKDNKRVDKDYKGQRVELNGNIYFVDGTKESTL
    DLFDEILNLHRIEERFNTEVESVVKKGELFLITTTQGDEVWAKFVIISIGKMGQPNKPSYEIPLALKDRVHFNVSD
    CKEN
    EKILVVGGGNSAVEYAYFLADLNKVTLNYRKTTFTRVNEPNMALLNEYAQGGKLELRLGVDIVSLEEAEGKPKVNFSDGK
    SEMYDRVVYAIGGMAPMDFLRKCSLEVDEHGVPLTSETHEGSVSGIYIAGDILFKSGGSIAAALNHGFSIVQEIKKQLV

    >gi|34556813|ref|NP_906628.1| putative nitrite reductase, formate-dependent, Fe-S centers [Wolinella succinogenes DSM 1740]
    MEQDGRRRLFLKYIGAGTAVVGSALSGVRANQEVESVGEKPHYGMVFDQNKCVGCTECEVMCKKVNSVPQGQARLYVQNK
    TNPETPMEKRYTRVSCQQCEDAPCVSVCPTKACHKDEQTGIVTMNPEDCIACKYCIVACPYDVRFINHETKAAENCNFCL
    GTKLAKNEEPACVQACKYKALVFGDLNDKDSYINQILGVKDSVRMKPFFGTKPSLRYIPVVKVGV

    >gi|34556824|ref|NP_906639.1| hypothetical protein WS0393 [Wolinella succinogenes DSM 1740]
    MRLFWRSLWMGCLLGSVWLHAESLESGSIRALKENKLLLVSIESEACPYCKKMKREIFEEAKYRQEIEKRYVHLVFNNRD
    SSLPPDLRAPYVPANAILSPKDQSILDAYVGYIAPERFMKILEETHKGVQ

    >gi|34556879|ref|NP_906694.1| thioredoxin [Wolinella succinogenes DSM 1740]
    MGKYIELNASNFDEVTKKGVSLVDFWAPWCGPCRMVAPVIEELAADFEGKANVCKVNTDEEQELAVKYGIRSIPTILFFK
    DGEIVDQMIGASSKQAFKEKLDSLIG

    >gi|34556881|ref|NP_906696.1| thioredoxin reductase [Wolinella succinogenes DSM 1740]
    MVLDVAIIGGGPAGLSAGLYATRGGAENVVLFEKGMVGGQITSSSEMENYPGVAHVMSGLDFMEPWREQCFRFGLQHEMA
    EVSRIARQSEGNFAIHLSDGRIFEARSVIVTTGGKPKKAGVKGELEFFGRGVST
    CATCDGFFYRNRDVAVIGGGDTALEE
    ALYLANICSHVYLIHRREEFRAAPLSVEKVKKNPKITLLTSRVIEEIVGDASGVNGVKIRHKESKEVETLSVMGVFVFVG
    YDVNHQVLKQEDGSFLCEVNEKGEVVVDLSMKTNIPGLFAAGDLRIEAPKQVVCAAGDGASAALSALAYLEHLKES

    >gi|34556999|ref|NP_906814.1| cytochrome C biogenesis thioredoxin [Wolinella succinogenes DSM 1740]
    MRIWLSGALFSLLLTLAGCDVNSIIKPGTPPPPLSTHNLQGAPMDLQKLQGKGVIIRFWQSTCLSCLKEMPLLEELYKKH
    QGNLEVIAINVGEPKSYLLGFLEAHPYSYSIIEDEARIITKRYGVVAIPTTFFINPQGVITDVLYGESDRLGLEKRTHNI
    LP

    >gi|34557042|ref|NP_906857.1| sulfur transferase precursor [Wolinella succinogenes DSM 1740]
    MLKKVLLSLSVAGFVSSSLLASSGAGAGEVEKIIKQNKLQVVDYDYVLKRIGDGRIGSGKAIILDARPEVRYQEGRIPSS
    YPMPHPIPANMKDEYLKVLKDKPKDVEIITYCSGVA
    CEKSPDLAVELIGMGYKNVKVYTQGIPEWKKHFYTDIGAKTAKA
    LFDKDEALFIDARPLGKFRESTIPGSIGVSDGKFKELWGRLPMDPNTKVVVFCGGYE
    CELSHSVAGHMVAMGYKNFMTYS
    GGTPEWKKAGYPMTGGAAAAPAPKPAAAKEAPKNMGPIVLGEDEGTVDTAWFNSILGKKPENVTIVDIRGPADHAKGKFA
    GSINIEKKGKSAQEFVALLPKDQYIILT
    CATGTRSLEAWLEISGAGLLKDKVFYLDATIKCEGGACKGE

    >gi|34557139|ref|NP_906954.1| formate dehydrogenase subunit [Wolinella succinogenes DSM 1740]
    MESQARVKFYCDEARCIDCHGCDVACKEAHHLPVGVNRRRVVTLNEGLVGKEKSLSIACMHCSDAPCAQVCPVDCFYVRA
    DGIVLHDKEKCIGCGYCLYACPFGAPQFPKSGIFGSRGPMDKCTFCAGGPEETHSEKEYKLYGQNRIAEGKVPVCAAMCS
    TKALLAGDSDSISLIIRERVLKRGSGTASVPYTWSQAYKD

    >gi|34557156|ref|NP_906971.1| hypothetical protein WS0755 [Wolinella succinogenes DSM 1740]
    MKIEILGTGCTKCKALFEATKEAVAQSGKFAQIEKVEDIQKIMGYGVMSTPALVVDGVVKLSGKVPSVDELKRVLLEGKE


    >gi|34557206|ref|NP_907021.1| hypothetical protein WS0808 [Wolinella succinogenes DSM 1740]
    MPKSGSRTLRNTSSTFFSRSLFMFQKILFWLLFGITFLMAERIDITPSELEALQNQGVRVVDIRTEPEWQQTGVIPQSER
    LTFFDARGNYDALGFLKRLEQRGITPQTPLILV
    CRSGNRTLSVANYLSSQGFEKVYNLKNGIIEWIKLSKPLEKPAP

    >gi|34557385|ref|NP_907200.1| selenophosphate synthetase [Wolinella succinogenes DSM 1740]
    MPLKSNSQHSKSAILSRFIHFCDNLLCKSKRSESNANAMNETTKITQFVKVAGCAGKVGPGDLHHLSSLLHQPHDPSLLV
    GFEGNEDAGVYQISPECALVQTADFITPVVNDPYLYGQIAAANSLSDVFAMGGRVKTALNLLMWDKCHLDEKMISEVLQG
    GLSKIIESQGILIGGHTIDDREQKYGLSVTGFVHPQKIWRNHTTQEGDALILTKPIGMGILTTSIKADMLSPQSTHEAGE
    LMATLNLYAAQIASEFEIHACTDVTGFGLLGHALEMCGNRSIRLFASQTPYLSEALEMAKMGIIPAGSYANKSYLEPLTS
    IEASLSAEEAMLFYDAQTSGGLLFSLSAKEAPKLLEALRQGGISHASLVGEVLPRGEKPLYIG

    >gi|34557393|ref|NP_907208.1| molybdopterin biosynthesis protein MOEB [Wolinella succinogenes DSM 1740]
    MREFSEEELERYSRHIILEEVGIEGQEKIMNSKVLIIGAGGLGSPIAFYLAAAGVGEIGIIDGDVVDRSNLQRQIIHTTD
    EIGIPKVESARRKLKALNPNIRVQTWQIMINAENISRIIAPYDFIIDGTDNFAAKFLINDACVMAGKPYSHGGILKFAGQ
    SMTIKPGESACYACVFDQPPPAGSIPT
    CSSAGILGAIAGMLGTIQAAEALKVITGVGEPLYNRLLSFDAKSMNFRTVKFT
    KNPHCRVCGGEGVKILREYEQPICEVNHAQNP

    >gi|34557497|ref|NP_907312.1| heavy metal-transporting ATPase [Wolinella succinogenes DSM 1740]
    MEKLEGARFCLEGLNCAHCAGKIEEEIGTLSGVKSARVDFAQQRLVLETLEGEGERIFEEAKRLIKEIEPHVTLLKQEEA
    GHGREGELALKEALKSPRFLLFALGSLFFALAVFPKADPSWDVWIYLVAYGLIGGEILLLAFRNILRGQVFDENFLMSLA
    TIGAFAIGEYPEGVAVMFFYRIGEFFQDLAVERSRKSITSLMGIRPEFARLKEGEELLEVEPASVLVGSTILVRPGERVP
    LDGVILLGNSTLDLSALTGESLPKEVSAGDEILSGAINKTGVLEVRTTKSFGESTVAKILDLVQNASAKKAKTEQFITKF
    ARYYTPFVVISAVLLAFLPPLLIEGALLEEWFRRSLVFLVVSCPCALVVSIPLTFFAGIGGASKAGILIKGGNFLEALHE
    VDTVVFDKTGTLTKGFFEVAETVAMEGFSKEEVLALASSVESHSNHPIALSIKRASQASQKVEVSDYQELSGYGVSAKVE
    GRIVLAGNAKLMKEQGVSIPSGMSDETLVYVALEGRLAGYLILRDEIKPEAASLIERLKNLGIKQLVMLTGDKKESAQKV
    AQAIGITSFEAELLPHEKVERFEALLGARATQGKSVFVGDGINDAPVLALSDVGIAMGGVGSDAAIEAADVVIMNDEIGK
    VATAIAIAQKTHTIVWQNIIFALGVKGAILIMGAFGVATMWEAVFGDVGVALIAVLNATRVMNLKES

    >gi|34557519|ref|NP_907334.1| putative formate dehydrogenase iron-sulfur subunit [Wolinella succinogenes DSM 1740]
    MESQARVKFYCDEARCIDCHGCDVACKEAHHLPVGVNRRRVVTLNEGLVGKEKSLSIACMHCSDAPCAQVCPVDCFYVRA
    DGIVLHDKEKCIGCGYCLYACPFGAPQFPKSGIFGSRGPMDKCTFCAGGPEETHSEKEYKLYGQNRIAEGKVPVCAAMCS
    TKALLAGDSDSISLIIRERVLKRGSGTASVPYTWSQAYKD

    >gi|34557554|ref|NP_907369.1| hypothetical protein WS1185 [Wolinella succinogenes DSM 1740]
    MNDANEKLESDTLTASNIFRGKARKEDATGELAELYEKITAMRGRVANSAQIFSASPELIKQQMSFIEYYMMKQKALSMP
    LLASIRMLISDKNSCSY
    CVDFNASILINRLGWTPKEVEAMRANPNDAKLEAKEKAMLLFVLKAVRTPHDVSATDVQALRE
    LGYNDGEILDATNHGARMSAIDIIFDAFKIEKDF

    >gi|34557679|ref|NP_907494.1| hypothetical protein WS1318 [Wolinella succinogenes DSM 1740]
    MMKIYGIKSCGSVKKALSFLESRKIPYEFVDLKLFHPTRPDIERWLKSLTISKIFNSQSATYRNLGLKELALDEEGKIEW
    LTKEPLLIKRPIIELGSGEVMVGFDLKEYESRFDD

    >gi|34557867|ref|NP_907682.1| methylated DNA-protein cysteine methyltransferase [Wolinella succinogenes DSM 1740]
    MNRDYFKTPFGWVEIRADARRVEGILFVPEPLEASANELTERAKEALEAFLMGKAVHPLPFPCAFASELSRRVLEELAKL
    SFGEVVTYSELGRRALGVHQRAVARVMASNKIVLLYP
    CHRVVAQNGLGGYSGGGVERKKAILEWEKSLCAREAKTE

    >gi|34557885|ref|NP_907700.1| hypothetical protein WS1557 [Wolinella succinogenes DSM 1740]
    MRIFALALVMMLWLGGCKEELGEKHHMVLNRDQGITTRFSPQQKRLQLSSPKPYLLFFFTASCGACKEAIPYLNAIEEQW
    GERFEVIGVLGGSRGIKSDLEFLKRHSIRFKVLSDPSSSDYLSRAVGGVMGVPLFFFFDETGAPKEHFLGLVPQRVLEEE
    VRSLL

    >gi|34557886|ref|NP_907701.1| thioredoxin [Wolinella succinogenes DSM 1740]
    MRFFGVGAALFLALWLGGCNPQGVALGESAPEISTKNLQGEAVKLENYRGKAVVLRFWAKGCASCVKEMPFLEELWREHE
    EELVILAINAQDSSREMEAFKEQYHLGYPLLKDDLDITTKRYGVVAIPTMFLIDKEGRLRDKIYGEQPWASTRGRILGIL


    >gi|34557896|ref|NP_907711.1| metal transporting ATPase [Wolinella succinogenes DSM 1740]
    MKPKKASNSELFSLRLEHATSKRVRYSFCYEGGCRPEPMALQIALESLEGIKSARVNPALNNLILEHEGREPKEMESAIK
    GVLERVSLRGKACASKDSCLVLREEIPSSGGVVRAGTSLLLEPFLKNPNAKLGAAAIGSTPIVWDGIKDLFEHGLTSKVL
    EAMAVAISIYRQDFRAANSASFMLALGEYIEEATVYKSDDLIKELSKPQVEEVWIEKHQKGRIETILVPIQEVKSGDIVV
    VGAGEIVPVDGHVMSGEAMLNQISMTGEAEPVRKSRGDRVLSGTVVEEGRIKIWAEHVGDETTTARIRSYIQSSLEEKSS
    LQLEASKMADGLVPITLGLAVLSYVVSQDLTRLASVLQADYSCALKLATPVAFKASIGSAGKMGIIIKGAKSLEALHEAD
    TFVFDKTGTLTKGELEVIEVHSFSSAWDETSILNLAASAEEHYFHPVAQAIVKAARKREFVHMHHDEVEFIVAHGVKTEI
    EGKSVVIGSRHFLEDDEGIDFSSHQKELKGYLSQGHMPLYIGYDRELLGVVMLKDEIRPNAQETLERLKKAGVQEVVMLT
    GDGEEKAKEVAESIGVDRYFANLLPTQKAEILERLMKEGKKVAFVGDGINDAPALMKAHSGIGMHKGADIAKASADVVLL
    RDDIAAVADAKEVANATLAKVNGNFKATLGINSAILGAAALGWLSPVRTALLHNGTTIGLLLNALGGVKIRDPKEL

    >gi|34557922|ref|NP_907737.1| putative thiol peroxidase-scavengase P20 oxidoreductase [Wolinella succinogenes DSM 1740]
    MANTKLKGHPVQLGGTELNLGDLAPKIALVAKDLSEKSVGGASGKYQIINVVPSLDTGVCATQTRKFNEKAAALPEVEVF
    VVSMDLPFAQGRFCATEGIENLTVLSDFRSKSFAQSYGMLLADGPLAGVTARAVFVVDPAGKIIYKELVPEITEEPNYEL
    ALGAIG

    >gi|34557931|ref|NP_907746.1| putative transcription regulator [Wolinella succinogenes DSM 1740]
    MIPLEHRYAQIEKAITYIDENFRAHPSVDEIAQNVGMSKYHFIRVFKEYAGVTPKQFLHCVTLNYAKEHIKESRSILESS
    LDIGLSSSSRLHELFVNLIGVTPREWRERGRGVLVTYGFGQTPFGEALIGFTDKGICYLGLMSDNKLEILGRFYELWGEA
    ILEYDEKAAQKYLGYIFDRGEEGSPWNLGTNSQVNAWKALINLSRHLEDRVEGLIP
    CCGIISRSGAMSGHRWRIERGAAL
    SLLDDIREKGSFGFSDNIDL

    >gi|34557945|ref|NP_907760.1| sulfide dehydrogenase precursor [Wolinella succinogenes DSM 1740]
    MFRLFVTALIIALGLAQAQAADMGEKFDATFKAQVKAAKADMVMLSPKDAYKLLQENPDITLIDVRDPDELKAMGKPDVK
    NYKHMSRGKLEPLLAKSGLDPEKPVVVF
    CKTAARAALAGKTLREYGFKTIYNSEGGMDKWLEEGLPSLD

    >gi|34558053|ref|NP_907868.1| alkyl hydroperoxide reductase [Wolinella succinogenes DSM 1740]
    MACDTGVKAIDSNNEKTSVSNDQNLSTKENKNMSSSLVLRKMPAFETMAYDAATGHYKKVSSQDYEGKWTLICFYPADFT
    FV
    CPTEIAAMNAHLDEITGELGVEVLAASTDTHFSHKRFVETEPILKGLKMTIAADPKGDMARAFGVMIEEEGLALRGRF
    LVNPEGVVVAQEVQAPMVGRNVQELIRQIRAWQHATQTGEVCPAGWRPGKKTLPVNTDAEKMTGRVGDYITLEELLS

    >gi|34558054|ref|NP_907869.1| protein disulphide isomerase [Wolinella succinogenes DSM 1740]
    MTKTLLKVALASSLVASLALAKSFEENLEALVQTKTGMPIKVVKSYELEGFKEMKFVSVESATSGQRFPLFASLDGNNII
    GFSNLFFTQNAKNDEIVQNAIKEIQNFNETAKGKKLNEIFKSIPENRYVNLKSTGNNVKKTLVVVTDPE
    CPYCRNEMKTI
    EEKLKDHHIKIILAPVGARTAFVKSQIAMDKIKEAKSDKEKISILREVYADSYKIPENLRNQPTKLIDENAEKIYSSGLI
    RGVPFVFEME

    >gi|34558146|ref|NP_907961.1| putative protein-disulfide isomerase [Wolinella succinogenes DSM 1740]
    MKKLPLLALSLASLLFAGEFETNLAQSVQKAAQVEVKVLSSTSLSSLNNLRLAIIQASDGSQFPLYASSDGKSFIGFSPV
    MSLSPEDVGRVDALMEELKGAQMRQSAEEKATLSKLFASLPKERFLLLPSSDKSVKKSLIVVSDPD
    CPYCKQELGNIEER
    LKSANIKIIFAPVHDDTAFIKSQLIMDEAKKLKESDVKGKVALLKKYFEKIELSEAQKKTDISKIKDNAAKIFGTGIITG
    VPFVFEAE

    >gi|34558282|ref|NP_908097.1| alkyl hydroperoxide reductase subunit C [Wolinella succinogenes DSM 1740]
    MLVTNKAPNFVATAVLGNNEIVSDFELYKNFGKSGTVVFFYPLDFTFVCPSEIIAFDKRLEEFQARGINVIGVSVDSQFS
    HFAWKNTAVKEGGIGQVRFPLVADLTKQIARDFDVLFNESVALRGSFLIDKDGTVRHAVINDLPLGRNIDEMIRMVDTML
    FVNEHGEVCPAGWQKGDEGMKADTKGVAEYLAKNSEKL

    >gi|34558295|ref|NP_908110.1| hypothetical protein WS2008 [Wolinella succinogenes DSM 1740]
    MIPAVFWLRFYLKKPKGERMRALKVGLFIGLFWLGSALWGGAFEDSLAMAKAQNKPLVVMVSSRACPYCIRTHKQVLSRP
    SIQKALEGKIWLEVNRDEERLAEAIETRFVPSFFYFSPAGELLGERLGYQLPEAFLEFLLDP

    >gi|34558421|ref|NP_908236.1| hypothetical protein WS2141 [Wolinella succinogenes DSM 1740]
    MVVSYSDSTPFGERISDSLKETQKLHTMQLNLGKVCNLACRHCHVEAGPNRREQMSQEVMKKALELFVRHGFETLDITGG
    APEMNPHFEWLIHEGSKVASRLIVRTNLVILKESPWEHLAEFYAKHKVELVASLPEVSEEEVDRVRGRGVYGDSIEVIKR
    LNALGYGKNPDLKLDFVYNPSGPFLPPRVMELERLYKEQLFEKEEIFFHRLLSMNNIPIGRFRDSLERSGELLEYETLLR
    THFNPSATPHLMCRSQISVSYEGRIYDCDFNQMLSLEAQGAKSLEEMLIQKSLKRRVVFGEHCYACTAGLGSS
    CQGVIAP
    EPL

    >gi|34558437|ref|NP_908252.1| hypothetical protein WS2158 [Wolinella succinogenes DSM 1740]
    MTLSRLSLLCLLLLAALFGGCDDSKVDASVISQGAKMSPKELEKLDNLDKASYAELADLFLDNKNIDPKGKYLLLVFGSN
    G
    CIYCEKLKQEIKENPEIKAFIQENFSPYYINGSYSKPHQLITAQKSVEMMTEELVRLYGVRPTPTLIFATPEGKTILTY
    PGYMPKDRLQATLGFITQKSWEGANDEKEILHRLNALYKEKNL

    >gi|34558447|ref|NP_908262.1| putative cation-transporting ATPase [Wolinella succinogenes DSM 1740]
    MKRLCDHCHLEYEEEALFSEEIEGQKRYFCCKGCQGVYHLLRSSGLENFYEKVGDRKLAPPKENFLESSRFDSEAFGRKY
    VKEEEGMRRISLILEGIH
    CAACVWLNEKVLYQREGVIEVSINYTNNKASILWDPQRIKLSEIIDSIRSIGYDAYPYDPRL
    QEERANSERREYYTRMVVGIFCTMNIMWIAVAQYAGYFSGMDATVRHILNFASFVLCTPALFYSGWIFYRGAYFGLKHGF
    VTMDLLVASGATLAYLYSIYAALSGIGETYFESVTMIITFVLIGKFLEVKGKKSAVDALDSLNSQIPEAVIVVRGEERIS
    LAPEEVEIGEVVEILPGERLALDGMLLSSKALMDESALSGESLPIQKSMGEMLLSGAINLQYAVQYRVSKSLNDSLLSSI
    IRLVEDSLGKKPQIEKRANELSRRFSTTILSLALLTFALWYGAIEAGFERSLVVAISVIVIACPCALALATPIASLVGLT
    ESIKKKLLFKEARFLETMAKANLLLVDKTGTLTLGRPQVVREQQWGEMDRSLWLSLVQKSTHPVSVGVASYLKMQGITGI
    REFLEFEQIDSKGLRGVLEEGEILGGSLEFLREHGVALGGYEPSERTLFAVAFQGALRGVLELEDPLKPHAKESLEGIRA
    QGIEVVMLTGDHFAIAAKVAQTLEISEFHAAMNPLEKADFVEKMRQRGRVVVMAGDGINDALALSKSDIAVAMGQGTDVA
    IAVSDVVVLDDSLLALQEAFSLSHRTYRFIKQNIALSLTYNALTIPLAAMGYVIPLVAAASMSFSSLLVVGNSLRIKKG