Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis uid57853

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|32490814|ref|NP_871068.1| hypothetical protein WGLp065 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
    MSCNIIKKISNKRYYSINYKKKTKTISFYKYCKIENIDCIQEKLFEICKKLEILGRIYISYEGINAHISIKKHKIEELKI
    FIKKTFDYLTDIRFNLYSDNKKQPFKKLKIKKKLNILNCGIKDCSFDIKNTGHKLTANDFNAILMKNDFILVDMRNSYEY
    EIGHFENALKISSKTFRQQLKLLINNLKFYKSKNIIMY
    CTGGIRCEAASAWMMHNGFKYVSFLDGGIIEYVNFIKKNNYP
    MKFLGKIFVFDDRLYEKVTSDVLSLCHQCKIQPCDNYINCKNKKCNSLFIQCIYCNKTLNEFCSNFCNEYYQSKN

    >gi|32490823|ref|NP_871077.1| hypothetical protein WGLp074 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
    MENNKLFNLKLTDLAKNKIKNLLKEEKNKNKKFRIYISGGGCNGFQYNFILDEKINKEDHLILFLDVEIVIDSISLQYLI
    GGVVDYKEELLESCFFVINPNAKTTCSCGTSFSI

    >gi|32491006|ref|NP_871260.1| hypothetical protein WGLp257 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
    MKKLILIIFLYTGFLFGHAKIIPSEGKEYYKLDYIISDEYKIIEFFSFYCSYCYKFNSIYKINENIRNIISENDKIIKYH
    TNFFGPKSVDLSLIWAISTFFNVENKISDILFQEVQNNKKILNKEDILIVFNKLGISKKQYEYAKNSFLVKCFIKKQEFF
    LKKLNIISVPTIVINGRYVINNDKIYASSIEEYSNKYIEIIKYLLNKSI

    >gi|32491053|ref|NP_871307.1| hypothetical protein WGLp304 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
    MNNKEIISVNDEDFEINVLKNKKPVLVDFWAQWCMPCKSMIPILKKISEKYVNKLEVFKINIEKNSIYQEKYLVKSIPSF
    FLFFKEKIIDKKIGIVSQKQLEIFIDENLNRL

    >gi|32491070|ref|NP_871324.1| hypothetical protein WGLp321 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
    MKENKINTEVLVIGSGPGGYSAAFRCADLGLKTVLVERFSSLGGVCLNVGCIPSKSLLHIANNLNSINKLKKIGIKFNER
    EIDMNQIRKWKCDVVLKLTNGLNMMSKARNVKIIHGYGEFIDPYTVNVKSLKENTKIKFEHAIIAVGSSPIKNHFMLQPD
    EKIWDSTDALKIKFIPKKLLIVGGGVIGLEMATVYNSFGSEVYIAEMSNQLIPAVDTDIINIFYKSIKNNFNIMLNTELK
    SVYLEDNNIYAELVNNDKKIEKICCNAVLFSTGRKSNGDLIKAKEIGIKLNNLNFIEVNNQMRTNIPHIYAIGDVTGHPM
    LAHKASYQSHIAAEVISGENHFFDPRVIPSVAYTNPEISWVGITEKEAINLNIPYETALFPWNALGRAIASDHHEGGMTK
    LIFNKENKKIIGGSIVGYNSSELLGEISLAIEMGCDVDDISLTIHAHPTLYESIGRASEIFSGTITDFLNKKSKNK

    >gi|32491083|ref|NP_871337.1| hypothetical protein WGLp334 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
    MKNSIEKIKEQIKKNKIILYMKGSPENPKCGFSSKVARILCESNFRFAYVDVISNPHIREKLPEFSNWPTFPQLWVNGSL
    VGGCDIVTKMHEKGELVPFINKEINK

    >gi|32491110|ref|NP_871364.1| hypothetical protein WGLp361 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
    MKVKNIILMIYFRKFYMKNKKIKNLEIENKNWMGFFATKSAIKHIKKLIKQNSSILGIRLNINKSGCAGLSYSITTINYF
    NSDDFIYEFKGIKLCASKKILPFINKIELDYIKQGLNYKFKFNNPNAKNICGCGKSFNTMEDIYE

    >gi|32491204|ref|NP_871458.1| hypothetical protein WGLp455 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
    MNMEGYKKKIAYKFNKASKNYDQYSKFQRECGNNLCKLTGCIIQSKLLDAGCGTGLFSRYWKSFNNQVIALDISYGMLEQ
    AKRRNSANIYILGDIENSPLIDKTVDIIFSNLAIQWCNDFSRALSELYRILRPGGFLVLSTLIKGSLIELKQSSKNIDN
    C
    SNVNCFLPISSIYNALSPYRYKLINKIKSFYYSSVLDLLKDIKGVGSSYLYDRNNLGLRSKKYLNDLEKFWPYHNKKGFK
    LSYNVVYGIIYRD

    >gi|32491236|ref|NP_871490.1| hypothetical protein WGLp487 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
    MLVANKFIDFTAPAILSNGEIVQNFNLSNYIKNKVSVLFFWPMNFTFVCPSELIAFDKRFFEFKNRNVKLVGVSLDTVYS
    HQAWRSTSTKLGGIGEVRYPMVSDIKRNIMKSYNVEHPEIGVALRASFLIDKAGIVRHQIINDLPIGRDINEMIRVIDAL
    LFHEKHGEVCPAQWKKNREGIVPSREGISQYLSENLNDL

    >gi|32491241|ref|NP_871495.1| hypothetical protein WGLp492 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
    MKIKSKLLILGSGPAGFTSAIYSSRAGINPILITGSQLGGQLTTTDKIENWPGDSKSLTGSELIKRMRDHAIKFGTKIFY
    DHINEVNFNKKPFICKGEKEYISDAIIIATGSSARYLGLSSEQLYKGKGVST
    CAVCDGFFYKNKIVAVIGGGNTALEEAL
    YLSNIASKVYLIHRRDIFTAEKILVDRIFKKRNNGNISIYNNFVVKKIIGNDKQVSSILLESTTSKKEKIISVSGIFIAI
    GHIPNTKIFENQITLKNYYICISNKYNKKYRTSTSIPGIFSAGDVSDYLYRQAITASGFGCMAALDAEKYLSSL

    >gi|32491289|ref|NP_871543.1| hypothetical protein WGLp540 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
    MKNVEIYIKSTCSFCVKAKNLLKQNNIKFKEIFVENSTANLSKMIKRSKKTTVPQIFINKVHIGGYEDLIIFLKKNI