Vibrio splendidus LGP32 uid59353

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218675905|ref|YP_002394724.1| DSBA oxidoreductase [Vibrio splendidus LGP32]
    MSKKLQLDIISDVMCPWCVVGYKNLEQAVSELGLAEQIELEWQPFELNPDMPQEGENLRDHIMRKYGSSAEESQSSREQL
    AARGKAVGFDFNFYDSMRMVNSRHLHVLLDFALAHGKQTELKLRFFTAHFTEQKDLSDLEVMAQELEAVGLNSTKALKRL
    KNTDNLKQIEAQEFEWQRMGISAVPTVVFNRKSAVTGAQTVETYKQILQELIAES

    >gi|218676089|ref|YP_002394908.1| Glutaredoxin [Vibrio splendidus LGP32]
    MKKPVKITLYRWAGSWGPFKVNIPCGECTLTKDILKDTFENELSDVDVELEVKDWLSHWWEPLKLGSWHAPILVVEGKVV
    SQGEALNRGVLVQSVIKEWTKRDSLKGNIVYGKAT
    CPFCVKAKKMLDEAGVEYQYHDVVKDSAALYRMIPEVKAHIGEKT
    PVTVPQIWLDGKYIGGADNLEAWMKENGLDTIPNNVVDLSNQSTG

    >gi|218676171|ref|YP_002394990.1| Methionine sulfoxide reductase [Vibrio splendidus LGP32]
    MNKLSKILVSLVVALPLTSLFVSQTGTANTMDKAMDSGKSEIATLAGGCFWCTESDLEKLTGVTDVISGYSGGELENPTY
    KQVSSGKSGHIEVINVTYNPDVVSYEQVLDQFFRHIDPTDDKGSFVDRGPQYRPAIFYHNQEQKDVAQNFMMEIDKAQIF
    GEPLKTELIKFEKFWPAEEYHQDYYKKSKVRYNYYRYASGRDQYLDKIFGDDRKENPKTIRQIIDGKNATANAKTYTKPS
    DAEIKASLTSLQYDVTQDDATERPFDNKYWDNKQEGIYVDIVTGEPLFSSKDKYKSGTGWPSFTQPISEAYVVTTTDYKL
    LYPRTEVRSKFGDSHLGHVFKDGPKPTGLRY
    CMNSAAMRFIPADKLAEEGYEEYMEMFEG

    >gi|218676261|ref|YP_002395080.1| Thiosulfate sulfurtransferase [Vibrio splendidus LGP32]
    MDIRRMNQPLISPEQLQQRLLEEDNIVILDASIEFQIPSESEKIKGQMIPSAIRFDYDKDFCNKHTLLPHMFPTEKHFNT
    RAQEIGINQDSTIVVYDNSGTFASPRAWWMFMAMGHNNVYILDGGLPAWIDAGYVTDTDYKTEVQAGNFDGSIQDNYFVN
    AQQIESYSDNKNANIVDARSQARFDSEVPEPREGLRSGHIPNSVCLPFAQVLNAGKLKPQEELVDIFSTLNLTPSQPMFF
    S
    CGSGVTACIILLAAKLAGYSSDMGVYDGSWTEWGANEKLPIAVTKK

    >gi|218676266|ref|YP_002395085.1| molybdopterin biosynthesis protein MoeB [Vibrio splendidus LGP32]
    MLMEILSDVEMLRYNRQIILKQFDFEGQEALKQSSILVLGAGGLGCASAQYLATAGIGKLTLIDDDIVELSNLQRQVLHT
    DADIGKKKVNSAAESLQVLNPHLTIETVDHRLDDQALGKLIETHSLILDASDNVETRNQLNRLCYASKTPLVSGAAIRME
    GQISVFTYQDTDAPCYQCLSALFGNAALS
    CVEAGVMAPVVGMVGAAQALEAIKVIAQFGQPKQGKLLILDAMSHSWREMN
    LMKMPNCSVCG

    >gi|218676305|ref|YP_002395124.1| hypothetical protein VS_II0530 [Vibrio splendidus LGP32]
    MDNHKERAFYAVVGALVGDAASMGLHWLYDQERILHVAGFEPEFRSPNQFDYQDKGYFAHQGKTSGEHSQYGAQLLTMVD
    SLVDNQKYDEASYIQHFRKWFDFGGSWQGYIDKATRMSLLNIHQLELEGAPITACGADDTQLPAVSKIIPLVACTYTSHT
    LPAMVENAVRVTNNNDKAVEWAQAITLLIQAAIQGNSPLQSVEMVRQTCSRFIHDQIDEALAEPELSITDAAKKFGLH
    CE
    LSAAFPLLIRIIAGAQSYKQGIRDNILCGGDSCGRAIVIGAVLAACFYEEDGAIPTEWLSQVELNCGVLSLPIE

    >gi|218676334|ref|YP_002395153.1| putative disulfide oxidoreductase [Vibrio splendidus LGP32]
    MFKPFTKFITALAAVLIIAGCSETDEPQKGVQYEALPTALTEFNLSPITEIFSLNCGHCRQMESAIPEIESLTDQTIGKM
    HVTFNESAQISAMIYYTAVMQLDATPDHAFMDDLFAAVQMGADATPEQRQQALETAFTSRGLVSPYQLNKEQQIALFDYV
    KKAEEISVKGQINSVPTFIINGKYQVLTAGHQDVQGIAKTINYLLTQP

    >gi|218676337|ref|YP_002395156.1| hypothetical protein VS_II0562 [Vibrio splendidus LGP32]
    MLRASDKTCVYNAANCNANFKYVERVMKFIRWFLGRVILLLNFVFSPRGVKRSQEEQSKVNEQAKTHTLYQFEACPFCVK
    VRRSMKRQSVQFELRDAKNNEQHRAELEAGGGRVKVPCLRIEKDGKTEWMYESSDIVSYLENQFA

    >gi|218676400|ref|YP_002395219.1| thioredoxin peroxidase [Vibrio splendidus LGP32]
    MIMRRLLIVATAIYSINTFAKFETTKEDAGFGESQVVTLEKTTKFDLVGNPLKVGDLMPSAKLLTSGLEHYDTSAKNQSI
    KVYSILTSVDTPV
    CVQQAIELSQYINSNKQKLQDIEFYAVSADTAFAQQRFIKQHSLKGVTYLSDSSEHRFGLNTGTQIK
    QLGLLSRSIIVVDVNNQVIFTQRVPELTTIPSLKHAINFALENR

    >gi|218676401|ref|YP_002395220.1| Thiol peroxidase [Vibrio splendidus LGP32]
    MSVTFQGVPVSISGKLPKLNQLAPKFTLCDKELNNLTLDSLKGKNVLLNIFPSIDTPICAASVRTFNKNAADLNNTVVIC
    ISADLPFAMNRFCGAEGIDNVITASFFRESSFTENYGVNLNEGALKGLSARAVVVIDQEGVVKYCELVSEITTEPNYKSA
    LTALL

    >gi|218676469|ref|YP_002395288.1| Thioredoxin 2 [Vibrio splendidus LGP32]
    MSTFNTRCPSCNGVNRVPSERISESPTCGKCKTALLDGAPIEGTSLNFQSILNSSQPVVVDFWATWCNPCVGFAPVFSDV
    AKERSGNIRFVKIDTEAQQQLAAMYQIRSIPTVMVFKDGKRVDTINGALPKGQFDQWLNQALTK

    >gi|218676472|ref|YP_002395291.1| hypothetical protein VS_II0707 [Vibrio splendidus LGP32]
    MSLIPWNALFGGMLLGASAIILMLGIGRVAGISGIVGRLLPSRKNKRLESGSESNSDSSIEKTEKHWRLAFVVGMVVSGW
    LLIPTGYQLPQLEEINFAVVIIAGLLVGFGTKMANG
    CTSGHGIVGMARLSKRSIIATCVFMGVAMATVLVKNLIGLGA

    >gi|218676934|ref|YP_002395753.1| putative suppressor for copper-sensitivity B precursor [Vibrio splendidus LGP32]
    MYNTLLTKFVDSLAFCMRTCAKTLVTALLVMTSFTALAQTTGWLSVPEHPPVKMRMMSTGEQSDDGSKIQTVLDVVLDGD
    WKTYWRSPGEGGIPPSWDWSGSTNIESVEWHWPIPKYYEQLDVMTLGYKKHVSFPVTLTLKDNTTPALFKASFTFPSCTN
    ICVLTNYDIELPIDPQTLELDEEAMFLFNQGMSQSPREANRTSVNGLFWDKSKQQLVTQLTSKEGWDKPMVLIDGQEVLD
    DFFSPPTVHITDNTMTAVFDVSNWIGEVDLTDRTVSITVSDTNFAEEMTAQVESDPIAYQTSNNSFLVMLGFALVGGLIL
    NIMPCVLPVLGMKLNSIIQNQGASNRHIRLSFLASAAGVITSFSLLALGMTVLKMGGNAIGWGIQFQNVWFIGFMLIITL
    LFSVNLLGLFEFRLPSGLNTWMATKGDDSHSGHFIQGMFATLLATPCSAPFLGTAVAYALGASYQELWAIFIALGIGMSA
    PWLIFALFPSLTKLLPKPGAWMFKVKLVFGLMMFITSLWLTSLLSPFVGKFPTILLSLFIVVSVLIWIGMKLGRKVLIPI
    MATTTLVFGAALIVGSVTADNWATPIVDNLDWQKLDAKQIPQLVEQGKTVFVDVTAEW
    CITCKANKIGVILQDPVYSHLQ
    QEDIVLMKGDWTTPSESVTQYLQSNGRFGVPFNIVYGPSYKNGIPLPVILDSDTVIQAIDAAR

    >gi|218676936|ref|YP_002395755.1| Thiol-disulfide isomerase and thioredoxins [Vibrio splendidus LGP32]
    MILIVGVVSFAMDFYHSRSMPQGDAIPIVGQSIQGEDIDVIELSKSGKPVIVYFWATWCSACKLVSPRVNSFSDSHQVVS
    VALSSGPDERVQRFLDAKEYDFPVINDLSGSISRSWGVNVTPSIVIIKDGKISSIATGVTSPIGLWLRTYFA

    >gi|218676937|ref|YP_002395756.1| putative outer membrane protein [Vibrio splendidus LGP32]
    MKKHLISTLILGSLMSTSAFAELSTEQTQQLEEINQFLKENPSTISGLHTSLEQYVAGQAQAKKAQAESHDWLYNNDTHP
    ITGNPDGKSVIVNFTDYN
    CPFCKRLEKGLVKLASENSDIKIINVYLSFKQQQVDGLDTNAALYAMKVWKDNPGAFPEVDR
    LLMAKSGIHSKSSLEAVAKKTGTEAELKTTQEQNQVLTTNHQTFSALGLTGTPTMMMNGDVLPGYVPYDRLKDIVDDAF

    >gi|218676982|ref|YP_002395801.1| glutaredoxin 2 [Vibrio splendidus LGP32]
    MKLYIYDHCPFCARVAYIAQSLGLNIELVSVDYDDAQTLIDLIGKKMVPVLQKDDGSIMAESLDIIAYFMDLKSNDEQRE
    PSEQATLFQSRAFPLTQQIGRPRWWNLDLAEYRSAGAKEAWRVSKETEGFNFEELLEKTPQYVQLINPLLKDAELLLELE
    NGESSLPLIDQALYFSMLRGFCVEPSIEWPPALEHWLEKQSKTLSIMLLR

    >gi|218676989|ref|YP_002395808.1| coenzyme A disulfide reductase [Vibrio splendidus LGP32]
    MKVVVIGGSAAGMSFAAKYKRNQPSDEVIVLDKRSYISFGACGLPYFAGGMFDDTERMISRTPEQAIKSGLDVRVETEMV
    SFDRTEKQITVRHQNEESVIDYDMLVIATGARPIVPPFGEFNPEHVYTLTSMEDGLAVKEALKDVNKPRVCVIGAGFIGL
    EVFDAAHGLDKHVTIIEREQRIMSRQFSPEIIEVVEGAIRESGAELKTGCSVSAIRDAEQGGYIVATDNGNVEADVVILS
    LGFKPNTEAFELPKAQNGALLVNEYGATEDAYIHAVGDCAVVHHMALGKPVYVPLATTANKQARMMADKLAGKDTYMSGF
    LGSSCLKVLDYELACTGVSELLAKEHNLDVKVSTISDKNQTDYYPGQEDIKVKLVYHPETKVLLGGEIVGKKGAVGRINA
    LAVAITAKMTTQQLGYMDFCYAPPFARTWDALNVAGNVAK

    >gi|218677053|ref|YP_002395872.1| Osmotically inducible protein C [Vibrio splendidus LGP32]
    MTTLYTTSATATAGRNGQVSTDDNLLSVALSYPKEMGGTGEATNPEQLFAAGYSACFSNALLHVAKEMKIKIASAPTTAT
    VGIGPNENGGFALTVALSIELDLEQEQAVTLVKTAHQV
    CPYSNAVRGNIDVKLSVNGQAL

    >gi|218677145|ref|YP_002395964.1| hypothetical protein VS_II1404 [Vibrio splendidus LGP32]
    MSQYVVCALYKFVALDDYQEIRQPLTEVLEANQIRGTLLLASEGINGTVAGKRESIDALLQWFKQDSRLADVVYKESFNE
    EQPFNRTKVKLKKEIVTMGVEGIDPRHVVGTYVKPNEWNALISDPDVILVDTRNDYEVDIGTFKNAVNPNTETFREFPQY
    VEDNLDPKKHKKVAMF
    CTGGIRCEKSTAYMKEQGFDEVYHLEGGILKYLEEVPEEESMWEGDCYVFDGRVAVNHQLEKSG
    YDVCNACRLPITDEDKASDHFEKGVSCPKCIDKHSDEQKARFREREKQVQLSNARGETHVGGDAAHLIDQRKKEKLAHKE
    QQRSGKKAK

    >gi|218677170|ref|YP_002395989.1| Methylated DNA-protein cysteine methyltransferase [Vibrio splendidus LGP32]
    MANRFTYYQSPLGAVTLQANDEGLLGLWFETHTTKPEQLGVQDDSFPIFALAIKQLNRYFAGEAIQFSVPIAAKGTPFQQ
    SVWQALMTIPYGETWSYAQLADAIGNPKAVRAVGLANGKNPVSVIVP
    CHRVIGKNGKLTGYAGGVERKQRLLVIEGRKQT


    >gi|218677237|ref|YP_002396056.1| hypothetical protein VS_II1498 [Vibrio splendidus LGP32]
    MLKRIDLAQVQPDALSAMLSIEGYLSDVALSSELKEMIKIRASIINKCAYCIQMHTAEALKIDISQQKLFALAAWQESPL
    FNDTERAILTLTDEMTLISNSGVSDATYQQCLSLLGDELLAQSMMQVIMINAWNRFALATKMTHG

    >gi|218708148|ref|YP_002415769.1| glutathione reductase [Vibrio splendidus LGP32]
    MEKVMATHFDYICIGGGSGGIASANRAAMHGAKVALIEAQDLGGTCVNVGCVPKKVMWHGAQVAEAINLYSKDYGFDVDV
    KGFNWGKLVENRQAYIGRIHQSYDRVLGNNKINVIKGFAKFIDEKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEHGID
    SNGFFDLMEQPKRVAVIGAGYIAVEIAGVLSALGTETHLFCRKESPLRSFDPMIVETLVEVMEAEGPTLHTHSVPKEIVK
    EADGTLTLHLENGNTQNVDHLIWAIGRHPATDAINLASTGVATNDRGYIKVDEFQATNVPGIYCVGDIMEGGIELTPVAV
    KAGRQLSERLFNGQTNAKMDYTLVPTVVFSHPPIGTIGLTTQEAEEQYGKDNIKVYTSGFTAMYTAVTQHRQPCKMKLVC
    AGEEETVVGLHGIGFTVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVTMR

    >gi|218708270|ref|YP_002415891.1| putative rhodanese-like sulfurtransferase [Vibrio splendidus LGP32]
    MQELVPFVQENMILAIVWIGLVVAIIANVIKTSNAAYKEITAAQTTHMINRENGIVVDIRTKDEFKKGHITDAVHILPSD
    IKANSFGSLESHKADPIIVV
    CKTGQTAQESANLLVKAGFENVSVLKSGLVAWSEANLPLVKGKK

    >gi|218708547|ref|YP_002416168.1| thiol:disulfide interchange protein [Vibrio splendidus LGP32]
    MSVLRRLPLLALPLMITACNASEAKVETTSTAVEAAPAQAIDTAALTKRFEKIGIKVDKIVPSDIDGLLEVQTNSGIIFS
    SPEGDHFLAGTLYSLDENGKFSDVLAERQAPLNAEKVAAMSDTVIEYKADNEKYVVTVFTDIT
    CGYCVRLHSQMQGYNDL
    GITVRYMAYPRQGATGQVADQMAAIWASDDPKTAMHDAKVNRQMPASGKDLAEQKQIIAKQYQLGRELGINGTPAIVLAS
    GELVSGYLPPAQLIQRLEQ

    >gi|218708573|ref|YP_002416194.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio splendidus LGP32]
    MSNEMKIMLANPRGFCAGVDRAISIVERALEMYQPPIYVRHEVVHNRFVVEGLKQRGAIFVEELSEVPDDNIVIFSAHGV
    SQAVRKEAKERELTVFDAT
    CPLVTKVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASQTGGMYLVERPEDVQNLVVN
    DPSNLHYVSQTTLSVDETADVIEELRRVFPEIQGPRKDDICYATQNRQDAIREMAGDVDVVIVVGSKNSSNSTRLKELAE
    KLGTPGYLTDCPEDIQTEWVEGKKKIGVTAGASAPEELVNQILDRIRELGATEVEEIQGREENMFFEVPKELQIKQVD

    >gi|218708615|ref|YP_002416236.1| antioxidant, ahpC/Tsa family [Vibrio splendidus LGP32]
    MVLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLEDFQAKGVEVIGVSIDSQF
    SHNAWRNTAIADGGIGQVKYPLIADVKHEICKAYDVEHPEAGVAFRGSFLIDADGLVRHQVVNDLPLGRNIDEMLRMVDA
    LNFHEKNGEVCPAQWEEGKSGMDASPQGVAAFLSEHADDLSK

    >gi|218708631|ref|YP_002416252.1| HesB family protein [Vibrio splendidus LGP32]
    MAITMTDTAASRVQAFLDNRGKGLGLRLAVKTTGCSGMAYVLEFVDELNEEDEVFEHSGVKVIIDPKSLVYLDGTELDYV
    KEGLNEGFEFNNPNAKGECGCGESFNV

    >gi|218708717|ref|YP_002416338.1| Na(+)-translocating NADH-quinone reductase subunit D [Vibrio splendidus LGP32]
    MSSAKEIKKSILAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTIAVMFVTALSNFFVSLIRNHIPNSVRIIVQMAIIA
    SLVIVVDQVLKAYLYDISKQLSVFVGLIITN
    CIVMGRAEAFAMKSAPIPSFIDGLGNGLGYGFVLITVGFFRELLGSGKL
    FDMEVLPLVSNGGWYQPNGLMLLAPSAFFLIGFLIWAIRVFKPEQVEAKG

    >gi|218708718|ref|YP_002416339.1| Na(+)-translocating NADH-quinone reductase subunit E [Vibrio splendidus LGP32]
    MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVYTHILKENALVEGVDLSFLNF
    IAFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVN
    CAIFGGVSFMVTRDYNFAESVVYGFGSGVGWMLAIVALAGI
    REKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGVQL

    >gi|218708770|ref|YP_002416391.1| cation transport ATPase [Vibrio splendidus LGP32]
    MSNALKRQILATLAINLIYSITQYSSKYQILEFMFDLTLTGRFMLGLDENWSIDMNHYTAVLNGLNCMGCAKKVRTLFDD
    LDNTTINDISPTYIDISTPFSYVQLNQQLATLGYSMGNSLHLSLSGLSCGKCVNKLTQALEQTEQISDLEVSKHELSLVT
    LLSESELIELIESVGYHAAPYSEVNEPLSNSEDDKKTAPVEQTQDKPAASQYTYHLVLEGMT
    CASCVSSVEKALKKNEFV
    DQAQINLAEQTALVFTSETRDVIESALIESVKNAGYGAEFVDDAATQQQKQQEQQLRTQKAFLKNSVSALLIGAPLMAWG
    LFGGSMTIATFNDQLAWGLIGVVCLVLLATSGRSFFTNAWQSLMHKRATMDTLVALGTGAAWFYSMLVVLIPSWFPEPSR
    HVYFEASAMIVGLISLGHYIEAKAKARTTKSLQALINLQPQKAVVIVDGKEQTIAVEAIQVGMQVRVKPGEKVPVDGVVV
    SGESYIDESMLTGEPLPNVKSINDGVSAGTINGDGSLVIEATGIGSSTMLARIIQMVRQAQSSKPAIAKLADSISAVFVP
    VVVAIAAIAALVWFFVGPQPSASYMLVVSTTVLIIACPCALGLATPLSITVGVGKAAEFGVLIKDADVLQSASKIDAVVF
    DKTGTLTQGKPTVQQAFYGDLSEQELLAYAYSVEVGSEHPLAKAVCQYAESLQVSALPHSEFENQRGLGVQAIISGKNVQ
    VGSLKYLTQLGINTDIGADFIELCRTQAWTPIFVVIDQKLEGIFGISDALKIDSKQAITQLKSAGIHTVLLTGDNDSVAQ
    AIGKNVGIDEVISEVLPEQKAQHIVQLQQQYKSVAMVGDGINDAPALAQADIGIAMGSGSDVAIESAQMTLLNSSPLSVS
    NAIELSQATVRNMKQNLFGAFIYNSLGIPIAAGVLYPFFGFLLSPVVAGAAMAMSSITVVSNANRLRLFKPTHSNINKNH
    IHEVNHDS

    >gi|218708856|ref|YP_002416477.1| cytochrome c biogenesisprotein CcmG [Vibrio splendidus LGP32]
    MNKKILFIPLIAFMVLAGIFATQLMRNQSGDDPTKLESVLIGKPVPEFGLEDLEQPGKFHDQAIFKGEPLLLNVWATWCP
    T
    CYAEHSYLNKLAGQGVKIIGLNYKDDRNKAVGWLKELGNPYLISLFDGNGMLGLDLGVYGAPETFLIDANGVVRYRHVG
    DVNPTNWASTLEPMYQELLEEAK

    >gi|218708872|ref|YP_002416493.1| hypothetical protein VS_0872 [Vibrio splendidus LGP32]
    MSVWDSISFNNRFTALPRLFYTPIQPTPLNNVQWLAWNHNLANELGFPSFECTSEELLETLSGNVEPEQFSPVAMKYAGH
    QFGSYNPDLGDGRGLLLAQVVAKSGETFDLHLKGAGKTPYSRMGDGRAVIRSTVREYLCSEAMAGLNIPTTRALAMMTSD
    TPVYREKQEWGALLVRAAESHIRFGHFEHLFYTNQLAEHKLLADKVIEWHFPECLDDDKPYAAMFNQIVDRTAEMVALWQ
    ANGFAHGVMNTDNMSIIGQTFDYGPFAFLDEYDPRLICNHSDYQGRYAFNQQPRIGLWNLSALAHSLSPLVDKADLEAAL
    EQYEPQMNGYFSQLMRRKLGLLSKHEGDSRLFESMFELMSQNKVDYPRFFRTLSNLDTLLPQDVIDLVIDREAAKLWVDN
    YLQRCELEESSVAERCEKMRQVNPKYILRNYLAQLAIDKAERGDSSDIDALMVVLADPYAEHPDYEHLAALPPEWGKAME
    IS
    CSS

    >gi|218708931|ref|YP_002416552.1| peptide methionine sulfoxide reductase MsrB [Vibrio splendidus LGP32]
    MIQKGGNMIKPDEYWRERLTDDEFSVCRQRGTEAPYSGKLLHNHKTGVYSCTCCESPLFLSDNKYDSGCGWPSFDAPVND
    EAVRYIEDLSHGMKRVEIRCTACDSHLGHVFPDGPKTTGERF
    CVNSVSLIFNKNDETTK

    >gi|218708958|ref|YP_002416579.1| putative monothiol glutaredoxin [Vibrio splendidus LGP32]
    METIDKIKQQIEENTILLYMKGSPKLPSCGFSSQASQALMACGEKFAYVDILQNPDIRAELPAYAQWPTFPQLWVEGELI
    GGCDIILEMFQKGELQPIVKEAAAKVAGDDAE

    >gi|218708968|ref|YP_002416589.1| electron transport complex Rsxe subunit [Vibrio splendidus LGP32]
    MSDHKTLIKNGMWANNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVSVSLVRNHVPKEVRIPVFVMIIASLV
    TCVQLLMNAYAYGLYLSLGIFIPLIVTN
    CIIIGRAEAFASKNEVLPAAQDGFWMGLGMTSVLVVLGAMREIIGNGTLFDG
    ADLLLGDWASVLRIQIFQFDNSFLLALLPPGAFIGVGFLIALKNIIDNQAKSRQPKQEKPVIERARVTNA

    >gi|218708974|ref|YP_002416595.1| Na(+)-translocating NADH-quinone reductase subunit E [Vibrio splendidus LGP32]
    MTEYLLLLVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVSAYLVETYILTPLGIEYLRTMSFILV
    IAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNINENHNFIQSIIYGFGAAVGFSLVLILFAAMRERIAV
    ADVPMPFKGASIAMITAGLMSLAFMGFTGLVK

    >gi|218708999|ref|YP_002416620.1| disulfide bond formation protein B [Vibrio splendidus LGP32]
    MNFFAMLKDFSKGRLSWLLLLAFIVFFEACALFFQHVMMLGPCVMCIYERVAMLAIGIAAMIGAIAPHNPISRWLGLLGW
    GLGAYKGLMLALEHVDYQFNPSPFAT
    CDLFVTFPTWAPLNQWAPWMFEAYGDCSKVVWQFLELSMPQWLVIIFAGNLVAF
    GFVVISQFVKSKND

    >gi|218709179|ref|YP_002416800.1| thioredoxin reductase [Vibrio splendidus LGP32]
    MSDVKHCNLLILGSGPAGYTAAVYAARANLNPVLVTGMQQGGQLTTTTEVENWPGDPEGLTGPALMDRMKEHAERFETEI
    LFDHINEVDLSNRPFRLKGDSGEYTCDALIISTGASAKYLGLDSEEAFKGRGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIASEVHLVHRRDTFRAEKILVKRLMDKVENGNIVLHTDRTLDEVLGDDMGVTGVRIKDTQSDKTEDIEVMGAF
    IAIGHQPNTEIFKGQVDMKDDYIIVQSGLEGNATQTSIPGVFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDGLNDK

    >gi|218709252|ref|YP_002416873.1| methionine sulfoxide reductase A [Vibrio splendidus LGP32]
    MFSRTGLQCLNACFYLRTHFYRRFFIRTGIIILIHASNRHKQTSTNTESSKRSMEQIYLAGGCLWGVQEFIKYVPGVIST
    EAGRANGSAQLTENGTTQCDSTQCNGTQSDYDGYAECVQIEFDPSITSVMILMKHLFEIIDPYSVNKQGVDVGEKYRTGV
    YSTNAEHLTEAKHYIASRDDADRIALEILPLTHYVASDDIHQHHLSHFPEDHHLCHIPWDLLHKYKS

    >gi|218709455|ref|YP_002417076.1| putative cation transport ATPase [Vibrio splendidus LGP32]
    MCESCYHCGEDVPAETDFKVEILGSVRPMCCPGCETVAQTIIDSGLVSYYQYRTAPAEKADLVPEQLLALSHYDNEDVQL
    EFVRNSENISEVTLSLDGVS
    CAACAWLIEKQVSSKLGVVSIRVNTTTNRALLSWDNTQAKLSELLSAIHRLGYKAAPFEA
    DQQEAAYHRSMKNYLYRLGVAGLATMQVMMLAVALYLEVFGSLEPEFKSYFRWVSLIFATPVLLYSALPFYINAWRSIKG
    RTLGMDVPVSIALLFAYVASLVATVTEQGEVFFESISMFTFFLLLGRFLEMRARRKAAAASGNLLKLVPAMATTLDGEQV
    PVKTLKVGDQIRVLPGEHIPADGKVLSGRVHIDESMLTGESIHVVKNEGDTVFAGTLNGDESFELEVMTSKADSVISNIV
    RLQDEAQLSKPRIAEIADVVARYFVAVILVISFGTWFYWHQTRPEDAFWIMLSVLVATCPCALSLATPTAITCSTSRMGN
    FGILLRKGHVFETLCKVNHLIIDKTGTLTEGDIRISQVETFAELDKDTCLKVAASLEQHANHPIAKAFKTHLSDDIEVES
    VNNVIGSGITGEWNGQEVAIGSSEFILGDAQTSESNGIYLSMSGRHIATFTYEDPIRKESIEFIKQFKEAGIKTTLLTGD
    SLINAKHVAAEIGITDIVANAKPEDKLAYLNSRDASDITMMVGDGINDAPILAGAHLSVAMGGGTDVAKASADMVLLGDK
    LDRLLKSRTLALKTRKIIRENLAWSLGYNLLILPLAVAGLVAPYIAVVGMSASSIIVVSNSLRLLKEQGK

    >gi|218709558|ref|YP_002417179.1| putative glutathione S-transferase [Vibrio splendidus LGP32]
    MPNEFDLPILYSLRRCPYAMRGRMGIALSQQKVLLREIVTKDKPSELLASSPKGTVPVLVLPDGQIIEQSLDVMNWALQQ
    NDPQDLLRLSNPILSEQVQQLIKTNDEEFIGHLEKYRASVRYRNIDSEQRRQACEAFISQLEALLTDQPYFFGETPSLAD
    FAVMPFVSQFVRVEKKLFVQSEYQNVGRWLRTHLDSKLYTQVMKQYPLWNETKQDCVFG

    >gi|218709618|ref|YP_002417239.1| glutathione S-transferase [Vibrio splendidus LGP32]
    MIKLISFKNCPFVQRVMGALVMKNVPFEIEYIELNNKPQWFLDISPNGQVPVLITENDTVLFESDAIVEYLDDKYTPIEE
    VSPEQKALDRAWSYQASKHYMPQCGTMASKDKETFETRLANLQKAFLKAEKKLGDTEFFKGDYISNVDIAWLPLLHRAFV
    IKERSGFNMLESFPKVQKWQAALIESGLTDKTVPADFIDKFSGFYLTNNYLASLAEVR

    >gi|218709670|ref|YP_002417291.1| glutaredoxin-like protein [Vibrio splendidus LGP32]
    MKRVVLYVADKCPHCKDAQRYLDSKKIVYRLTNAKMQRGRKELQAMGARSIPVLKIGDQVMVGWNQKNFDKMYNSKST

    >gi|218709824|ref|YP_002417445.1| glutaredoxin 1 [Vibrio splendidus LGP32]
    MFVVIFGRPACPFCVRAKEHAETLKAKRDDFNYRYVDIHAEGISKADLEKTVGKPVDTVPQIFIDQDHIGGCTEFEAYAK
    ENLGLFD

    >gi|218709854|ref|YP_002417475.1| hypothetical protein VS_1867 [Vibrio splendidus LGP32]
    MLGKHQKPYEEFYHSTHENEHLDTKTELLVGLSAAMAMNCLPCTRYYLAQSKKAGITKGEISDVTAKVMAVAAGQKKLQM
    QEVLSKYKIDLDTYE

    >gi|218709887|ref|YP_002417508.1| hypothetical protein VS_1900 [Vibrio splendidus LGP32]
    MYNMDVIVYSKPQCVQCTATVKALQSKGIEHTVVDLTCDEIAMERVQSMGYRQAPVVVANDRHWSGFRPDMISALG

    >gi|218709888|ref|YP_002417509.1| hypothetical protein VS_1901 [Vibrio splendidus LGP32]
    MEWQGVTLSESAANRISQLSHGQKHFHLTVKSSGCTGFAYEVALIDSPSDDDIKYESHDVIFYIALKALPMIDGTEIDFV
    RQGLNSNFVYNNPKVKNLCGCGESFGV

    >gi|218709914|ref|YP_002417535.1| thiol:disulfide interchange protein DsbE [Vibrio splendidus LGP32]
    MHTSVRNKLIALFSVAVALVVAFSYALDNKQQTTSVSDQKRAFPEFTAEKLVTDESFDSEALSSEILSSETAKLTDITQH
    PYQLVNVWASW
    CGICKTEHAFLLELQKKGIPIVGLNYRDNPGAALNVLSNDGNPYATVISDPQGKLALELGVIGTPETYL
    VDAEGQIVKKLLGVINESVWRKELAHYFKGKNG

    >gi|218709921|ref|YP_002417542.1| hypothetical protein VS_1934 [Vibrio splendidus LGP32]
    MKILLSLSALCIALLSSSVHASERAETGWELIEKGAFVVDVRTPAEFEQGHLDNAINYPLSEVAAHFAKLDKDQPIVLYC
    RSGNRSGQAYQFLRAQGFTQIHNAGGLIEMQENQ

    >gi|218710063|ref|YP_002417684.1| zinc/cadmium/mercury/lead-transporting ATPase [Vibrio splendidus LGP32]
    MCAKHAACRSTKVDVQPQATGASCSSPKISSITAAGTSSSCCSSSATASSSSGDDCCGSDSGEEDSQSSTQTLNAQFSKS
    WLVSGMD
    CPACAKKIEKAVSNIEGVIQAKVLFATEKLVVKFDNESLADTIEQVSIKTGFPLSEVGSKKEKQHPETFWQAH
    IQPNLQIIAIAAAMLFAALLKSTSPQLSEGLFTVTCLLGLYPVAKKAVQLARSGTPFAIETLMSVAALGALYLGETAEAA
    MVLLLFLIGERLEAFASSRARSGVQALMALVPENATKIINGDRVDVAVSELAPGDVIEVAAGSRLPADGQLITDAASFDE
    SALTGESVPVEHIAGNSIMAGAVVVDKVVRITITSKQGENAIDRILHLIEEAESRKAPLERFLDKFSRWYTPLMMLVALL
    VIITPPLLFAQPWETWVYRGLALLLIACPCALVISTPAAITSGLAAAAKRGALIKGGAALEQLGKIQTIAFDKTGTLTEG
    KPQVTDIQPLSGWKQDAMLRVVGAIEVGSTHPLAQSLVAKVKELNVEIPESHNKKALIGSGVEGDVDGVKYQVLSPSKVT
    FALGSDVVSQVEALEGEGKTVVVALELKDLEESTEQATTVIGLIAWQDTLRSDAKLTIERLNDLGIQSIMLTGDNPRSAA
    AISSKIGMQYKASLLPSDKVSYVEELSQQSHVAMVGDGINDAPAMKTANVGIAMGGGTDVALETADSALTHNRLTELPAM
    IELSQATMNNIRQNVALALGLKGVFLVTSLLGITGLWVAVLADSGATALVTLNALRLLRFKSKAD

    >gi|218710070|ref|YP_002417691.1| thiol:disulfide interchange protein DsbA [Vibrio splendidus LGP32]
    MKKLFSLFAALIMSASINAAQFEEGTHYKILDVAKADKPVVTEFFSFYCPHCYKFEGVIEFLKQDLPESASFQKVHVAFM
    GNDMAVPMAKAYATMIALDAEDNMVPAMFAKIHEKQQTPRNEAELRQIFIDNGIDAKKFDAAYNGFAVNSMQKRFDKQFD
    ASTLTGVPGVLVNNKYIVKPDQIKSYEEYNQLVNYLLTL

    >gi|218710097|ref|YP_002417718.1| putative outer membrane protein [Vibrio splendidus LGP32]
    MKFITRSIITLLVTLAFSPVTFAMTKQEKIAEITQMLETNEGIIDSVHDSLAAYIDQQSSFDKTLVESHDFIYNNPHHPW
    YGSEHPKLTIVNMTDFS
    CPWCKKLDPVLRKIADEFPNDIKVINIYIPLKERDSPLNSATFGLNVWNNDKEKYKAVEEMLI
    SKPGIHNVRSIMKVAKKNKATDYVSSDSEIAIEVAENYNLFTRLGVRGTPAMLIDGTLLPGYLPYEKLYPIVKAKLEEKS
    K

    >gi|218710098|ref|YP_002417719.1| putative thioredoxin [Vibrio splendidus LGP32]
    MMRKKAKAKPQSKKQKLRSALLYTLFALVVVFGVDYWRTKDVPMQNVPPMVGMSLSGKPIDVIEMSKKEPVLVYFWTTWC
    VACKFVTPVVDWFSSSYPVVGVSLTSGKDERVQRYMNAKGYSYDNINDTQGKIARDWGISLTPTLIVINDGKVTSVTSGI
    TTPIGIAARLWLAKY

    >gi|218710099|ref|YP_002417720.1| putative suppressor for copper-sensitivity B precursor [Vibrio splendidus LGP32]
    MPKSKMSLRFVVLWLFVALCSTFTVNASASESMTPVTTGWMQDKLHPYVETRFVMTGQINKEDKTAAGYLEVNLSDEWKT
    YWRSPGEGGIAPKIKWADSKNVSQLQWFWKFPQRFNLLGIDTLGYKHNIIFPMNLHIDDMNKPVELHAVLTMSSCTTICI
    LTDFDINLVFNPSEMTVNNDAMLVYAKVMSEVPKDSPLVEGTSTIWDAHKSQLQVIAAHKIGWTAPDIIVDGDSDEMQDA
    EFGIPHIEIEGNQAIATYDVSSWMGTPDLNNQHIRVSIKDKDFITEYPATVTNGIVGNSSMISMVLLALLGGLILNIMPC
    VFPVLGMKLSGVISAQGMARKQVRFQFLASASGILASFWLIATFLAVLKISGSVIGWGIQFQNGWFIGGMFIVTALFSAN
    MLGLFEIRLSSNTNTWMATKGDSSYVGHFTQGMFATLLATPCSAPFLGTAVAFALATTIPTMFGIFTALAVGMALPWIIV
    AAFPSIALALPKPGAWMNRVKYLFGGMMLITSVWLFSLLRPHVPQLWLYAILAVSVCLLLVRLVQVHGIKTAGAVALLLL
    SVISASLFVEKATSKILPPEPEWEALSTVAIDDHVANDKVVFVDVTADW
    CVTCKANKIGVLLQDPVYSVLTEGDVVPMEG
    DWTVPSDSVTSYLQDHNRFGVPFNMVYGPNAPEGIELPVILTSDAVMEAIEKAKGGDE

    >gi|218710105|ref|YP_002417726.1| alkyl hydroperoxide reductase subunit C [Vibrio splendidus LGP32]
    MINTEIKPFNATAFKNGEFVEITEQDVKGKWAVFFFYPADFTFVCPTELVDLQDKYAELQSRGVEVFSVSTDTHFSHKAW
    HDTSDKIGTIEYFMVGDQTGNITNNFNVMREGQGLADRATFLIDPEGVIQAMEITAEGIGRDAEDLLRKVKAAQYVAANP
    GEVCPAKWKEGEETLAPSLDLVGKI

    >gi|218710106|ref|YP_002417727.1| alkyl hydroperoxide reductase subunit F [Vibrio splendidus LGP32]
    MLDQAMKQQLKAYLENLKTNVQLVLSLDGSDTANKLQDLANDIASLTDKIEVIRDDNASTRRPIMQVVNQSKGTAIGFAG
    LPMGHEFTSLVLALLHSGGHPIKLEADVIEQIKELDQELNVEIFISLS
    CQNCPEVVQAFNMMSAINPLVKTTMIDGAAFQ
    DEVKSRDIMAVPSVFINGELFGQGRMSLAEILNKVDSGAAEKKAANLNQQAPFDVLVVGGGPAGSSAAIYAARKGIRTGV
    VADRFGGQVMDTMAIENFISVKATTGPKLVASLEEHVKEYGVEVMTEQRAANIIAAENTEDGYIHVELESGATLRARTVI
    TSTGARWREMNVPGEQEYRNKGVAY
    CPHCDGPLFKGKKTAVIGGGNSGIEAAIDLAGIVEHVTVLEFADTLRADQVLIDK
    ANATPNIEIIKMAQTTQVIGDGNRVTGLEYKDRNTDELKQIELAGIFVQIGLMPNSEWLKGSKVELSPRGEIEINAHGAT
    SMKGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDHLIRNSAPVKEAETA

    >gi|218710125|ref|YP_002417746.1| putative ABC transporter [Vibrio splendidus LGP32]
    MKHSLLCSTALIASLTSSFAFSASCPEILNGKQRLLNSNEEIELCEEFQGKTLLIVNTASQCGFTPQFEQLEQLHQTYKD
    EGFTVVGFPSNDFRQDRGSEKQSAKICYLDYGVTFPMMARASLSGPDANPVFAEIQQQAGIKPKWNFYKFLVSKEGKVIA
    TFPSSTSPTSSTLKNAIEQQL

    >gi|218710239|ref|YP_002417860.1| hypothetical protein VS_2272 [Vibrio splendidus LGP32]
    MNTEPSSVSASITKATIAIHYCRQCNWMLRSSWLCQELLHTFSEEIEQVSLHPDTGGRFEIFCNGVQIWERKADQGFPEA
    KVLKQRVRNIIAPDRDLGHVDSK

    >gi|218710267|ref|YP_002417888.1| arsenate reductase [Vibrio splendidus LGP32]
    MTITMFGIPNCDTIKKAKKWLEAEGIEFEFHDYRKQGITEELVTSFCSELGWELVLNKRGTTYRQLSQEQKDTLTEEKAV
    ILLVEQPAMIKRPILKVDGKLHIGFKADQYAAIFA

    >gi|218710274|ref|YP_002417895.1| putative peroxiredoxin bcp [Vibrio splendidus LGP32]
    MNTLTAGVPAPAFSLPDQDGNIVSLGDFKGKKVLFYFYPKAMTPGCIVQAEGLRDIKAQLDDLNVVVLGVSVDPVKRLPN
    FVAKKSLNFTLLSDEDHSVAEQFGVWGEKKFMGKVYDGLHRISFLIDEEGQIEHVFNKFKTKTHHEVVLDYFNPEA

    >gi|218710278|ref|YP_002417899.1| arsenate reductase [Vibrio splendidus LGP32]
    MSVVIYHNPRCSKSRQTLELLEANGVQPEVIKYLDTPLTIEQLKVLFTQLGFESVRDMMRTKEADYKEANLGDASVADED
    LFAAMATNPKLFERPVVVANNKAKIGRPPEQVLEIL

    >gi|218710364|ref|YP_002417985.1| thiamine biosynthesis protein ThiI [Vibrio splendidus LGP32]
    MKFIVKPHPEIFVKSESVRKRFTKILERNIRTILQRRTESVAVFNRRDHIEVTSESDKYFKETLEVLTQTPGIHHSLEVQ
    QSEFKDLHNIYEQVLERSGALIEGKTFSVRAKRRGKHDFTSIELERYVGGGLNQAVESAKVKLKNPDITVKVEVENDKLN
    QVIERHKGLGGFPLGTQEDLLSLISGGFDSGVSSYLHIKRGSKVHYCFFNLGGPAHEIGVKQVSHYLWDKYGSSAKVKFI
    SIDFEPVVAEILENVEDGQMGVVLKRMFMRAGGMVAERFGIEALVTGEALGQVSSQTLTNLRHIDNVTDTLILRPLINWD
    KEDIIDLSRKIGTEDFAKVMPEYCGVISKKPTVKAKKGKLEAEEAKFNFEVLEQVIENARIMDIRDIEKESQEQAPEVEQ
    VQAVAEHAVVLDIRSPDEEDESPLEIDGVEIKHIPFFKLSTQFGDLDQSKEYLLY
    CDRGVMSRLQALYLQEQGFHNVKVY
    RP

    >gi|218710462|ref|YP_002418083.1| iron-sulfur cluster insertion protein ErpA [Vibrio splendidus LGP32]
    MLFLTQVREVVVSEVNIPLSFSDAAATRVQTLIAEEENPDLKLRVYITGGGCSGFQYGFTFDEKVNDGDTTIVNSGVTLV
    VDPMSLQYLMGGMVDYTEGLEGARFFVNNPNATTTCGCGASFSV

    >gi|218710501|ref|YP_002418122.1| dihydrolipoamide dehydrogenase [Vibrio splendidus LGP32]
    MSKEIKAQVVVLGSGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVSKVIEEAKAMAEHGVVFGEPQ
    TDINKIRIWKEKVVDQLTGGLGGMAKMRNVTVVNGFGKFTGPNSILVEGEGEATTVNFDNAIIAAGSRPIKLPFIPHEDP
    RIWDSTDALELNEVPEKLLIMGGGIIGLEMGTVYHSLGSKVEVVEMFDQVIPAADKDIVKVFTKRIKDKFKLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAERYDAVLVAIGRVPNGALIDAEKAGIEVDERGFINVDKQMRTNVPHIHAIGDVVGQPML
    AHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGKTEKEAKAEGLNYEVATFPWAASGRAIASDCADGMTKMI
    FDKETHRVIGGAVVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNKKAVKKKK

    >gi|218710695|ref|YP_002418316.1| methionine sulfoxide reductase A [Vibrio splendidus LGP32]
    MLNKQQLVSAATALPGNADPIRISERHFVNHTDLLNAPTGSQQEVLLGMGCFWGAERLFWQLNGVISTSVGYAGGYTINP
    TYEQVCSGQTGHTEVVRIIFDSEQTSLAQVLETFWERHDPTQGMRQGNDLGTQYRSAIYTFSEEQQTIAEHSKREYQRAM
    TESLGNEITTEVLPAGKYFFAETYHQQYLAKNPNGYCGLGGTGVCFPPQ

    >gi|218710757|ref|YP_002418378.1| sulfur transfer complex subunit TusD [Vibrio splendidus LGP32]
    MLSYTLLVNGPVYGSQSARSAYQFAVALLKQGHKLHSVFFYQEGVSNGSGITVPANDEFDLAAAWQKLADEHNVSLETCV
    AAALRRGVISTEEAAQHQLSASNLATGFTQAGLGSLSEALLTQDRVVQF

    >gi|218710797|ref|YP_002418418.1| peroxiredoxin family protein/glutaredoxin [Vibrio splendidus LGP32]
    MFASKEGQSIPQVTFPTRQGDAWVNVTTEELFKDKTVIVFSLPGAFTPTCSSSHLPRYNELHSVFKDNGVDDILCVSVND
    TFVMNAWKADQEAEKITFIPDGNGDFTDGMGMLVEKNDIGFGKRSWRYSMLVKNGVVEKMFIEEDVPGDPFKVSDADTML
    NYIAPEHKEQESITVFTKPG
    CPFCMKAKQNLIDKGLNYEEVVLGKDATTVSLRAISGRTTVPQVFIGGKHIGGSEELEAF
    LG

    >gi|218710798|ref|YP_002418419.1| dihydrolipoamide dehydrogenase [Vibrio splendidus LGP32]
    MKQVNVDVAVIGGGTAGLGSYRAAKAHTDSVVMIEGGPYGTTCARVGCMPSKLLIAAAESVHQIEKAPAFGVHPQGDIVI
    NGREVMDRVKFERDRFVGFVLEGVDEIPEQDKIPGYAKFLDDNTLQIDDHTVVTAKRIVIATGSRPAYPAVWNELGDRLI
    INDDVFSWDDLPESVAIFGPGVIGLELGQSLHRLGVKTKLFGLGGQVGPVTDPEIMAYADKAFNEEFYLDADVKIESMKR
    ITTDSGEDRVEIQFINKEGELETNVVEYVLAATGRRPNTDKLGLENTSLELDERGVPVADHYTLQTSLPSVFIAGDASNQ
    LPLLHEAADQARIAGDNAGRFPEIRAGLRRSKISAVFSDPQIAMVGETYKEITTRLGTCGCFATGEVSFENQGRSRVMLR
    NKGILHVYGEQGTGRFLGAEMMGPNAEHLAHLLAWAHQNKMTVSEMLDMPFYHPVIEEGVRTALRDLNAKLHLGPEMVKH
    CLDCGPGC

    >gi|218710847|ref|YP_002418468.1| thiol:disulfide interchange protein [Vibrio splendidus LGP32]
    MRRLATLLFVCVSLFTQPAWALFGNDNAEPSFGGNNNGFVPVDQAFPFNYYQQDGKVLLDWQVKEGYYLYQHSLSFTGQN
    LTIGNVEMENGQPHQDEFFGEVSIYTQPLFVQVPLQSYQVGSQLIVKYQGCADAGFCYPPEIRVIDIEPFTATSSGDMKS
    SDEQNSGALQGSSDAAGEADNSVQASSPSTDAASNTTQQANAPVSKEAGLADKLGDSWWTPLLFLALGVGLAFTPCVLPM
    YPILTGIVLGGGKLSQGRALMLSFIYVQGMALTYTLLGLVVASAGMQFQAAMQHPYVLIALSVLFVTLAMSMFGVYNLQL
    PSSIQTWLNNQSNKQQGGNTLGVFAMGAISGLVCSPCTTAPLSGALLYVAQSGDLLTGAIALYALAMGMGIPLILVAVFG
    NKLLPKAGSWMDKVKIVFGFILLAAPIFLLERIIPELWATVLWSGLGFIAFGWLYHSKNALPFGGWKQSAVGIIAMLGLF
    ASAQPALNYWFAEKSVVVEQQIQFARVNTVEELEIQLIEAKKLGKPVMLDFYADW
    CVACKEFEKYTFHQADVENKLSDFV
    LLQADVTRNMPQDIELLKQLQVLGLPTIEFWDGKGNHVPNARVTGFMPADVFLKHMQDHQL

    >gi|218710901|ref|YP_002418522.1| soluble pyridine nucleotide transhydrogenase [Vibrio splendidus LGP32]
    MSHSNHFDVIVIGSGPGGEGAAMGLTKAGLNVAIIEKESSVGGGCTHWGTIPSKALRHAVSRIIEFNSNPLFCQNNKSIH
    STFSNILGHAKSVIDKQTRLRQGFYDRNQCTLVFGTARFIDTHTISVMQSDGTEEHYSADKFVIATGSRPYQPDNVDFMH
    ERVYDSDSILSLKHDPQHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLSFLDNETSDALSYHFWNSGVVIRNDETF
    EKIEGTDDGVIIHLESGKKMRADCLLYANGRTGNTDKLNLGAVGLEADSRGQVSVNSNYQTSVEHVYAVGDVIGYPSLAS
    AAYDQGRFVAQAVVKGEAERHLIEDIPTGIYTIPEISSVGKTEQELTAAKVPYEVGRSSFKHLARAQIAGKDIGSLKILF
    HRETKEILGIHVFGERAAEIIHIGQAIMEQKGEANTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|218710914|ref|YP_002418535.1| thiosulfate sulfurtransferase [Vibrio splendidus LGP32]
    MDQFKHIDVKGAQALIEQNEARLVDIRDPQSFAVAHSETAYHLTNDTMVSFMDEVEFEQPILVMCYHGISSQGAAQYLVN
    QGFEEVYSVDGGFEASYRAELPVIAG

    >gi|218710958|ref|YP_002418579.1| thioredoxin [Vibrio splendidus LGP32]
    MEWKMSDKILQLTDDGFDNDVINAAGPVLVDFWAEWCGPCKMIAPILDEIANEYEGQLTIGKLNIDQNAGTPPKFGIRGI
    PTLLLFKDGGVAATKVGALSKTQLKEFLDANL

    >gi|218710969|ref|YP_002418590.1| peroxiredoxin [Vibrio splendidus LGP32]
    MSHVTFKGAAVPLTGTFPQTGEKSPSFALTAGDLSELTLASLEGKKVVLNIFPSIDTATCATSVRTFNAKAAELENTVVV
    CISADLPFAAGRFCELEGIEGVQHASTFRSPAFASDYGVAIAEGPLSGLTTRAVVVVDEKGVVTHSELVAEITEEPNYEA
    ALAAL

    >gi|218710982|ref|YP_002418603.1| hypothetical protein VS_3096 [Vibrio splendidus LGP32]
    MLSDFEFIRYQRQIALPEVGEQGQRNLLNSHVLVIGCGGLGNAAALYLAASGVGKIVLVDDDCVDSSNLQRQVAFRENQL
    GSPKVEALKQQLSELNGRSQVRTINQRMSESQLELEVMLADLVLDCTDNFESRQQVNQACFSTKTPLISGSAIGWKGQFI
    VFDYQNQKGCYHCLFPFRQHPQTTR
    CSDSGIIGPVVGTIGNLQALAAIQRLTRGEFQVATHQLKLFDGQTMNWQNLMVTQ
    DSECPVCSASVVKHLEEEIQ

    >gi|218711011|ref|YP_002418632.1| thiol:disulfide interchange protein DsbA [Vibrio splendidus LGP32]
    MKKLFAFFSLIMLSLSAHAAKFNEGEHYKVLDLEASKKPMVTEFFSFYCPHCNSFEPIIQQLKQQLPKDAKLQKNHVSFM
    GGNMGLPMSKAYATMIALKVEDKMVPVMFNRIHTMNKPPRDEAELRQIFLDEGVDAKKFDAAYNGFAVDSMVRRFDKAFK
    DSGLSGVPAVVVNNRYLVDAQGISSLDEYFELVNFLLKK