Vibrio parahaemolyticus RIMD 2210633 uid57969

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|28896842|ref|NP_796447.1| glutathione reductase [Vibrio parahaemolyticus RIMD 2210633]
    MEKVMATHFDYICIGGGSGGIASANRAAMYGAKVALIEAQDLGGTCVNVGCVPKKVMWHGAQIAEAMNLYAEDYGFDVDV
    KGFDWSKLVESRQAYIGRIHQSYDRVLGNNKVNVIKGFAKFVDEKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGID
    SNGFFDLAEQPKRVAVVGAGYIAVEIAGVLHALGTETHLFVRKESPLRSFDPMIIDTLVEVMEAEGPTLHTHSVPKEVVK
    EADGSLTLHLENGESQNVDQLIWAIGRHPATDAINLASTGVATNEKGYIKVDEYQETNVKGIYCVGDIMEGGIELTPVAV
    KAGRQLSERLFNNKPNAKMDYDLVPTVVFSHPPIGTIGLTTQEAEEKYGKDNIKVYTSGFTAMYTAVTKHRQPCKMKLVC
    AGEEETVVGLHGIGFTVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVTMR

    >gi|28897080|ref|NP_796685.1| methionine sulfoxide reductase A [Vibrio parahaemolyticus RIMD 2210633]
    MLNKQTLISIEDALPGREQPMQIEDCHFVNQSSLTAPLAHHQQQILLGMGCFWGAERLFWQLDGVVSTSVGYAGGFTPNP
    TYEEVCTGKTGHTEVVRVVFDERVISLAQLLAVFWEKHDPTQGMRQGNDLGTQYRSAIYTYSQDQQEIADKSKLQYQQAL
    EAELRSTITTEIVPAGPYYFAETYHQQYLAKNPDGYCGIGGTGVCFPPSLQG

    >gi|28897284|ref|NP_796889.1| thiol:disulfide interchange protein DsbC [Vibrio parahaemolyticus RIMD 2210633]
    MSVLRRLTLLTLPFFITVCGAEESQAKTETPAQQAAPTAQQHFDEAALKAKFSKLGLSIIDIQPSDVAGLLEIQTNGGIL
    FASNNGDHFIAGTLYAIDDNGGYKDVLAERQAPLNAEKIAEFADSMIEYKADNEKYVVTVFTDIT
    CGYCVRLHNQMQGYN
    DLGITVRYMAYPRQGATGPVAEQMATIWCAEDPKAAMHNAKVSRTFDNPAKDLEQCKETIQAHYNVGRQLGISGTPAIFL
    PNGEMVGGYLPPAELLKRLEQL

    >gi|28897354|ref|NP_796959.1| anti-oxidant AhpCTSA family protein [Vibrio parahaemolyticus RIMD 2210633]
    MVLVGRQAPDFTAAAVLGNGEIVENFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLADFQAKGVEVIGVSIDSQF
    SHNAWRNTAIEDGGIGQVKYPLVADVKHEICKAYDVEHPEAGVAFRGSFLIDEEGVVRHQVVNDLPLGRNIDEMLRMVDA
    LNFHQKHGEVCPAQWEEGKAGMDASPKGVAAFLSEHAADLGKK

    >gi|28897372|ref|NP_796977.1| HesB family protein [Vibrio parahaemolyticus RIMD 2210633]
    MAITMTETAASRVKAFLDNRGKGIGLRLGVKTTGCSGMAYVLEFVDELNEEDEVFDFSGVKIIIDKKSLVYLDGTELDYV
    KEGLNEGFEFNNPNAKSECGCGESFNV

    >gi|28897532|ref|NP_797137.1| cation transporter E1-E2 family ATPase [Vibrio parahaemolyticus RIMD 2210633]
    MNQFVVPLSGLNCMGCARKVEKALHANHDVEIINLSPTSVELKTDASLSDVVASIESLGYQAGTHYELQLSGLSCGGCVK
    KLSSLLESNQDVVSFEASTTHLRIHTLLTQEQVIDLVASLGYSASAEVITEANTETNVSAPQKAETLAQVEQQHHGEPEV
    KIEELPPAGATQLQMLIQGMT
    CASCVASVEKALTQVQGVEKAQVNLAEQSALVFVDNDSDDLHAEILESVKQAGYQGEIL
    QDAATQQEKQAQQQRQQQKRFKLDAIAGLVVGAPLMIWGVAGGNMMIRNTNDQLAWGAIGIVCLLLLATAGKHFFSNAWL
    AATHKRATMDTLVALGTGAAWFYSMLVVIFPDWFPMASRHVYFEASAMIIGLISLGHYIEAKAKANTTRSLQALINLQPQ
    QATVITEQGDQQITVEQITLGMKLRIKPGEKVPVDGVVIQGESYIDESMLTGEPVPVLKAQEAQVSAGTLNTDGALIIEA
    TGIGANTMLARIIRMVRTAQSSKPAIAKLADQISSVFVPVVVGIAILAALVWFAVGPEPKASYMLVVTTTVLIIACPCAL
    GLATPLSVTVGVGKAAELGILIKDADALQLASKVDTVVFDKTGTLTQGKPSVQQVFTHATSQEDLLALAYAAERQSEHPL
    AKAVCDYAKQHNAKDVSLDKFENVRGRGILATYQDKPLLIGSLQFMQAENVETSALKPAIDECAKNAWTPVAVALNGELI
    GLIAIADPIKSDAKQALSALKSQGIKTVMLTGDNQHVANAIGQELGIDEVIAQVMPDEKAQHIEQLQSQGHVVAMVGDGI
    NDAPALALANLGIAMGSGSDVAIESSQMTILNTSPMAVVHAIELSRATLKNMKQNLFGAFVYNSLGIPVAAGVLYPAFGF
    LLSPVVAGAAMALSSITVVSNANRLRLFSVK

    >gi|28897591|ref|NP_797196.1| selenoprotein W-related protein [Vibrio parahaemolyticus RIMD 2210633]
    MDKAIIDIYYCRQCNWMLRSTWLSQELLHTFSEEIDTISLHPDTGGRFEIFCNGQQIWERKKDGGFPEAKVLKQRVRDII
    DPERDLGHSDTK

    >gi|28897683|ref|NP_797288.1| hypothetical protein VP0909 [Vibrio parahaemolyticus RIMD 2210633]
    MSIWQRVSFTHRFSQLPSAFYTLVEPQPLDNTRWVAWNGEFAQQFGLPAAQNDELLAVFSGQSEFEPFRPLAMKYAGHQF
    GVYNPDLGDGRGLLLAEIEHQNGTWFDIHLKGAGLTPYSRMGDGRAVLRSTIREYLCSEAMAGLGIPTTRALGMVVSDTP
    VYREKTEFGAMLIRMAETHVRFGHFEHLFYTNQLAEQKLLADKVIEWHFADCASAEKPYAAMFGEIVQKTADMIAYWQAY
    GFAHGVMNTDNMSILGQTFDYGPFGFLDDYEPGYICNHSDYQGRYAFEQQPRIALWNLSALAHALSPLVEREDLEQALSQ
    FEGRLSQQFSRLMRSKLGLKTKIAEDGRLFESMFELLNQNHTDYTRFFRALSNLDKQPAQEVIDLFIDREAAQAWLDLYL
    ARCELEVDEIGEPISAEQRSEQMRQTNPKYILRNYLAQLAIDKAEEGDFSEVHRLAEILRHPYDSQPEFEAYAKLPPEWG
    KKMEIS
    CSS

    >gi|28897733|ref|NP_797338.1| zinc/cadmium/mercury/lead-transporting ATPase [Vibrio parahaemolyticus RIMD 2210633]
    MCTKHQGCQSGKIKTAVPLSAHDSCCAPTKPTLNIAQAGVDTVESSCCSGGSCSSDTADEEGPAELRESSVRSSWLVSDM
    D
    CPSCAQKLEKAIMSLQGVTNAKVLFATEKLVVDFDDHSLSLIIEQTARQTGFPLSALDKPKQKKENKGWFGFVQDNLQI
    LSIAGAMAFAGLVASINPQLSSWIFTLTCLLGLYPIARKAVKLARGGTPFAIETLMSVAALGALYLGETAEAAMVLLLFL
    IGEKLEAYASSRARSGVQALMDLVPENTTLIIDGVRKEVPASQLQPGDVIEVAPGGRLPADGVLMTTLASFDESALTGES
    VPVEHEEGGKIMAGAVVVDKVVQVQVTSRQGENAIDRILHLIEEAESRKAPLERFLDKFSRWYTPLMMLVSLAVIVTPPL
    LFAQPWETWVYRGLALLLIACPCALVISTPAAITSGLAAAARRGALIKGGAALELLGKVESVAFDKTGTLTQGKPQVTDV
    VSYDVTEETLLSLTASIEMGSSHPLALSLVKRAEEQGVSIPEASDKTAQVGSGVTGLVNGKLVQVIAPSKADFPVSSKVE
    QRVIELEEQGKTVVIVRHDYEVIGVIAWQDTLRQDAQQAIATLKMLGVSSVMLTGDNPRSAEAIAHQIGLDYKASLLPAD
    KVRYVEQLSTEHTVAMVGDGINDAPAMKASSIGIAMGGGTDVALETADAALTHNRLVELPAMIELSRATLNNIRQNVALA
    LGLKGVFLVTSLLGITGLWVAVLADSGATALVTLNALRLLRFESKQVQ

    >gi|28897974|ref|NP_797579.1| putative thiosulfate sulfurtransferase [Vibrio parahaemolyticus RIMD 2210633]
    MKKSTIALGVLAAVAAVGYSAYNTMFSAEAVIVDAAAQEQKFTQYAHPEHFISAQQLKSLMDGDKDVVVIGALNPIKPDS
    PISGSYTMWRNDYSATEDAYDFGGMSNSTEEMETILGSFGATTDSTIVVYAAGSHHDAARLYWQIHNLGHQDVRYLDGGL
    NAWMGAGYPTGSANQSVAAVEYNAPNTQQENNALATLDMVIAAQNNPDWVILDTRGNDEFNGEVAVSGAYGPGTIPSSVH
    INWTKALNEDTTLKSAEELQALYGDIIKGKKVIAY
    CQSGVRSAHTTMILTEVLGAEGVYNYDGSWIEYSHAHYEQKNPEV
    NVINGKS

    >gi|28898007|ref|NP_797612.1| glutaredoxin 1 [Vibrio parahaemolyticus RIMD 2210633]
    MFVVIFGRPACPYCVRAKEHAETLKAKRDDFNYRYVDIQAEGISKADLEKTVGKPVETVPQIFIDQEHIGGCDDFEAYAK
    EHLGLFDE

    >gi|28898025|ref|NP_797630.1| thioredoxin reductase [Vibrio parahaemolyticus RIMD 2210633]
    MSDVKHCKLLILGSGPAGYTAAVYAARANLNPVLVTGMQQGGQLTTTTEVENWPGDAEGLTGPALMERMKEHAERFETEI
    VFDHINEVELSQRPFRLKGDSGEYTCDALIISTGASAKYLGLESEETFKGRGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIASEVHLIHRRDSFRAEKILINRLMDKVENGNIILHTDRTLDEVLGDDMGVTGVRIKDVNTGTTEDLEVMGAF
    IAIGHQPNTQIFEGQLEMKDGYIVVKSGLEGNATQTSIEGVFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDALSDK

    >gi|28898091|ref|NP_797696.1| putative glutaredoxin [Vibrio parahaemolyticus RIMD 2210633]
    MKRVVLYVKDKCPHCKDAQRYLDSKNINYRLCNAKMQRGRKELDALGARSVPVLKIGDRVMIGWNPKNFEKMYSGS

    >gi|28898313|ref|NP_797918.1| cation transporter E1-E2 family ATPase [Vibrio parahaemolyticus RIMD 2210633]
    MCKSCYHCGEDVPANTDFKVEILGEVREMCCPGCETVAQTIVDSGLVSYYQYRTAPAEKADLVPEQLQALIHYDNEDVQS
    EFVRNHDNVSEVTLSLEGVS
    CAACAWLIEKQVSSAKGLVSIRVNTTTNRALLAWDKTQVKLSELLSVIHNLGYKAAPFEA
    DKQEASYHRMMKQYLYRLGIAGLATMQVMMLAVALYLEVFGDLEPEFKNYFRWVSLIFATPVLLYSALPFYLNAWRSIKG
    RTLGMDVPVSIALIFAYVASLVATVTEQGEVFFESISMFTFFLLVGRFLEMRARRKAAAASGNLLKLIPAIATTLDGEQI
    PVKTLKIGDRIRVLPGEHIPADGKVISGRIHIDESMLTGESIHVVKKEGDAVYAGTLNGDESFELEVTNSKADSMISNIV
    RLQDEAQHSKPKIAEVADVVARYFVGVILIISAGTWFYWHQTKPDDAFWIMLSVLVATCPCALSLATPTALTCATSRMGN
    FGILLRKGHVFETLCKVNHLVVDKTGTLTKGDIEISRTSTFKELSEAESLALASALETHANHPIARSFTGFSNDEIIVTD
    VKNVIGSGIEGVWNGKTVKIGSSSFVLDSSTKESNAIYLSINNEHAATFYYHDPIRKESQAFIQRFAEAGIKTTLLTGDS
    IQNAQPVADEIGIEHVIASAKPEDKLAYLKSLDSSDITMMVGDGINDAPTLAGAHLSVAMGGGTDVAKASADMTLLGDNL
    EKLLEARLLALRTRKIIRENLAWSLGYNLLILPLAVAGLVAPYIAVVGMSASSIIVVSNSLRLLKEK

    >gi|28898698|ref|NP_798303.1| thiol:disulfide interchange protein DsbE [Vibrio parahaemolyticus RIMD 2210633]
    MSPKTMPKLFGLFIVVAVFSVVVVAALSDRPHVEQAKESTLMVPNFSAVSVISGKEVTQVLFQDNGYKLLNVWASWCGIC
    KKEHETLLQIADAGVPIIGLNYRDNNSAAQNYLSSKNNPYQDVISDPNGELAVELGVIGTPETYLIDQNGKVLIKYRGAI
    TIDKWNSIFSRYFNGAI

    >gi|28898779|ref|NP_798384.1| putative thioredoxin [Vibrio parahaemolyticus RIMD 2210633]
    MSSTKQHRTFRYWLIQIVQMVLIVTAISIAMDWYRTKDIPKQETPPLSSVLSDGEYFDAIAQSHEQPVVVYFWATWCPAC
    KFVSPSVSWLSDDYAVVGVSGSSGPNERVAQFMQAKEYRFENINDPSSDIMREWKISVTPTIYILRNGEVTSITTGITTP
    IGILARICLAR

    >gi|28898780|ref|NP_798385.1| putative suppressor for copper-sensitivity B precursor [Vibrio parahaemolyticus RIMD 2210633]
    MNHIIKATQLASIFFMALVLGLFSLNLSAQTTDTGWMTNPQHPPVQTRFVLTGQQDPQAKTLTGYLDVKLTGDWKTYWRS
    PGEGGVAPSIDWQNSQNLSKVDWQWPYPQKFELLGIETLGYKGDTLFPMTLHIDNMSKPVTIDAVLTLSSCTTICVLTDY
    QIQLTFLPSELQIDEQVMFSYAQAVSNVPQPSPFIDVTQASWDANQSKLQIKLTNTQGWNQPQVLVDGVDEATRDYSFKL
    EGIHQEGNTVTASYLVDTWLGDVELSDQSLFVTIKDANLLAEETTQAIAEAIVDPLPSTSVVSIFLFALLGGLILNIMPC
    VLPVLGMKLSSIVAAQGIERRQIRAQFVASSLGILTSFWILAGFILVLKLTGNAIGWGVQFQSPWFLGLMVLVTGLFGAN
    MLGLFQIRLSSGSSTWLASKGDNSLAGHYVQGMFATLLATPCSAPFLGTAVAFALGADVVTLFAIFTALALGMALPWIMV
    AIFPSIALKLPKPGQWMNVVKNVFGVMMLATSVWLLSLMANHLPVFWVILAGLVAFIVLMIRVKRVHGDKALVVSGSASL
    ILIAGGLLLGSVTANQWATPLPEDLAWQKLSNSAIEQHVNNGRVVFVDVTADW
    CVTCKANKIGVIWQDPVYSLLQSPNVA
    TLKGDWTHPDGSVTDFLRAHGRYGVPFNIVYGPAAPQGIPLPVILTDDVVLSAVKQASGGTIQ

    >gi|28898786|ref|NP_798391.1| tetrathionate reductase, subunit B [Vibrio parahaemolyticus RIMD 2210633]
    MDSTKRRFLSAITAGAALVPIAGIGTATAGNVIRNNQSADRKGQVGKRYAMVIDLRKCVGCQACTVGCSIENQAPIGQFR
    TTVKQYEVTLDDGSTTTQEAKAFMLPRLCNHCDNPPCVAVCPVQATFQREDGIVMVDNSRCVACAYCVQACPYDARFINE
    DTLTADKCTFCAHRLEQGLLPACVETCVGGARVIGDLNDPSSEVRRLITKHQDNIKVLKPDEKTKPHVFYIGMDERFTSH
    IDGQPAIYAPQGDRA

    >gi|28898847|ref|NP_798452.1| disulfide bond formation protein B [Vibrio parahaemolyticus RIMD 2210633]
    MTIFSSLNQFSKGHVSWLLLLLFIIFFEACALYFQHVMMLAPCVMCIYERVAMMGIGGAAIIGLIAPNNALFRWLGLIGW
    GLSSYKGLMLAMQHVDYQFNPSPFAT
    CDLFVTFPSWAPLNQWVPWMFEAYGDCSKIVWQFFDLSMPQWLVVIFAGNLVAL
    ALIVIAQFFPVKRKNPIR

    >gi|161511053|ref|NP_798481.2| Na(+)-translocating NADH-quinone reductase subunit E [Vibrio parahaemolyticus RIMD 2210633]
    MTEYVLLLVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAYLVESYILRPLGIEYLRTMSFILV
    IAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNINENHNFIESIIYGFGAAVGFSLVLILFASMRERIAA
    ADVPVPFKGASIAMITAGLMSLAFMGFTGLVK

    >gi|28898881|ref|NP_798486.1| SoxR-reducing system protein RsxE [Vibrio parahaemolyticus RIMD 2210633]
    MSENKQLMKNGMWSNNPALVQLLGLCPLLAVSSTITNALGLGIATLLVLVGSNVTVSLIRNYVPKEIRIPVFVMIIASLV
    TCVQLLMNAYAYGLYLSLGIFIPLIVTN
    CIIIGRAEAYASKNDVLPAALDGLWMGLGMTSVLVVLGSMRELIGNGTLFDG
    ADLLLGDWAAALRIQVFQFDSSFLLALLPPGAFIGVGLLIALKNVIDSSIQARQPKEEKPAIERARVTNA

    >gi|28898891|ref|NP_798496.1| putative glutaredoxin protein [Vibrio parahaemolyticus RIMD 2210633]
    METIDKIKQQISENSILLYMKGSPKLPSCGFSSQASQALMACGEKFAYVDILQNPDIRAELPKYAQWPTFPQLWVEGELI
    GGCDIILEMFQKGELQPLIKEAAARAEGQAE

    >gi|28898930|ref|NP_798535.1| methionine sulfoxide reductase B [Vibrio parahaemolyticus RIMD 2210633]
    MPKIVKKEPKFVEQSGKKVTKSDEQWREQLSDEEFRVCREQGTEPPFSGKLLHNKETGVYACTCCNAPLFISDNKYDSGC
    GWPSFDAPLNNEAIRYLEDLSHGMVRTEIRCASCDSHLGHVFEDGPKTTGERY
    CVNSVSLIFNKSDE

    >gi|28898991|ref|NP_798596.1| thiol:disulfide interchange protein DsbE [Vibrio parahaemolyticus RIMD 2210633]
    MNKKILFIPLVAFLVLAGIFATQLVRNQDGDDPTKLESVLVGKPVPKFHLEDLAEPGKQYDQSIFKGEPLLLNVWATWCP
    T
    CYAEHKYLNELAGKGVKIIGMNYKDDRNKAIGWLNDLGNPYLISLFDGSGMLGLDLGVYGAPETFIIDANGVIRYRHVG
    DVNPRNWADTLAPMYNQLVEEAKQ

    >gi|28899042|ref|NP_798647.1| putative arsenate reductase [Vibrio parahaemolyticus RIMD 2210633]
    MTITMFGIPNCDTIKKAKKWLEAENIAFDFHDYRKQGIDAQMVTEFCQSLGWEQVLNKRGTTFRQLTQEQKDTLNEENAI
    ALLVDNPAMIKRPILNVDGQLHIGFKADQYATIFNS

    >gi|28899049|ref|NP_798654.1| thioredoxin-dependent thiol peroxidase [Vibrio parahaemolyticus RIMD 2210633]
    MNTLTAGSPAPAFSLLDQDGNTVTLDDFKGKKVLFYFYPKAMTPGCTTQAKGLRDVKAELDAHNVVVLGVSIDPVKRLGK
    FIERDELNFTLLSDEDHAVAEQFGVWGEKKFMGKVYDGLHRISFLINEEGVIEHVFNKFKTKDHHEVVLNYLNENA

    >gi|28899053|ref|NP_798658.1| arsenate reductase [Vibrio parahaemolyticus RIMD 2210633]
    MSVVIYHNPRCSKSRQTLELLEQNGVTPEVVKYLDTPLNVDELKALYAQLGFSSVREMMRTKEDVYKELGLGEASVSDEQ
    LFEAMAQNPKLFERPVVVANGKAKIGRPPEQVLDIL

    >gi|28899121|ref|NP_798726.1| Na(+)-translocating NADH-quinone reductase subunit E [Vibrio parahaemolyticus RIMD 2210633]
    MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVYNLVLKENALVEGVDLSFLNF
    ITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVN
    CAIFGGVSFMVQRDYNFAESVVYGFGSGVGWMLAIVALAGI
    REKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGVQL

    >gi|28899122|ref|NP_798727.1| Na(+)-translocating NADH-quinone reductase subunit D [Vibrio parahaemolyticus RIMD 2210633]
    MSSAQNIKKSIMAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVTFVTALSNFSVSLIRNHIPNSVRIIVQMAIIA
    SLVIVVDQVLKAYLYDISKQLSVFVGLIITN
    CIVMGRAEAFAMKSAPVPSLIDGIGNGLGYGFVLITVGFFRELFGSGKL
    FGMEVLPLVSNGGWYQPNGLMLLAPSAFFLIGFLIWVIRVFKPEQVEAKE

    >gi|28899248|ref|NP_798853.1| iron-sulfur cluster insertion protein ErpA [Vibrio parahaemolyticus RIMD 2210633]
    MSEVNVPLSFSDAAASRVKALIAEEENPALKLRVYITGGGCSGFQYGFTFDENVNDGDTTIENSGVTLVVDPMSLQYLIG
    GIVDYTEGLEGARFFVNNPNATTTCGCGASFSV

    >gi|28899291|ref|NP_798896.1| dihydrolipoamide dehydrogenase [Vibrio parahaemolyticus RIMD 2210633]
    MSKEIKAQVVVLGSGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVSKVIEEAKAMADHGVVFGEPQ
    TDINKIRIWKEKVVNQLTGGLSGMAKMRNVTVVNGYGKFTGPNSILVEGEGESTVVNFDNAIVAAGSRPIKLPFIPHEDP
    RIWDSTDALELKEVPEKLLIMGGGIIGLEMGTVYHSLGSKVEVVEMFDQVIPAADKDIVKVYTKRIKDKFKLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAERYDAVLVAIGRVPNGKLIDGEKAGLEIDERGFINVDKQMRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGKTEKEAKAEGIKYEVATFPWAASGRAIASDCSDGMTKLI
    FDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNKKAVKKK

    >gi|28899527|ref|NP_799132.1| peroxiredoxin family protein/glutaredoxin [Vibrio parahaemolyticus RIMD 2210633]
    MFVSKEGQNVPQVTFPTRQGDTWVNVTSDDLFKGKTVIVFSLPGAFTPTCSSSHLPRYNELFPVFKEHGVDEILCISVND
    AFVMNAWKHDQEAEHITFIPDGNGEFTDGMGMLVDKNDIGFGKRSWRYSMLVKDGVIEKMFIEPNEPGDPFKVSDADTML
    NYIAPEYRTQESITVFTKPG
    CPFCMKAKQNLIDHGLQYEEVILGKDATSVSLRAITGRTTVPQVFIGGKHIGGSEELETY
    LG

    >gi|28899550|ref|NP_799155.1| hypothetical protein VP2776 [Vibrio parahaemolyticus RIMD 2210633]
    MGGLTYTLVVNGSVYGSQSARSAYQFAQAVIEQGHTLVSVFFYQDGVTNGTALSVPANDEFDLTKAWQGLAKEHDVRLET
    CVAAALRRGIISEDEATQHGLTQNNLAEGFVQAGLGSLAEAMLTQDRVVQF

    >gi|28899604|ref|NP_799209.1| hypothetical protein VP2830 [Vibrio parahaemolyticus RIMD 2210633]
    MQEYIEFFQQNMILSLVWVGLLVAFIMNIVKSATAAYKEINVNQLTHLMNRENGVVVDIRTKDEFKKGHITDSLHILPSD
    IKAGNLGSLENHKSDPIIVV
    CKTGQTAQESANLLVKAGFEKVSLLKNGLIAWNEANLPLVRGKK

    >gi|28899639|ref|NP_799244.1| thiol:disulfide interchange protein precursor [Vibrio parahaemolyticus RIMD 2210633]
    MRALLSVLLLGLITFSTPSLALFGKDQFNNSQNNSFGSSNDSFVPVDQAFPFNFYQQDDKLMLDWQVRDGYYLYQERLSV
    SGENISLGELQMENGTPHKDEFFGDVHIYTTPLFVNVPLDEWQEGARVIVQYQGCAKAGFCYPPETRIIPIDAFTASIAD
    SAVATKPTQSTANNNQTNATSPTASTSVSSNNTPAPVTEQDSLAANLADNWWTPLLFLALGVGLAFTPCVLPMYPILTSI
    VLGSGKLSQRRALGLSLVYVQGMALTYTLLGLVVASAGMQFQAAMQHPYVLIGLSILFVTLALSMFGVYTLQLPSSVQTW
    LNNLSNKQQGGSSAGVFAMGAISGLVCSPCTTAPLSGALLYVAQSGDLLTGGIALYALAMGMGIPLILVAVFGNKLLPKA
    GGWMDRVKTLFGFILLAAPIFLLERILPEMWSTALWSALGIAAFGWLYHIKNSLEFGGWKQSAIGIIAVLGLFASAQPAL
    NYWFGNHETQAQQTTVSFTRIANVAELEEQLALAKAAGKPVMLDFYADW
    CVACKEFEKYTFHDPKVEAKLQDFVLLQADV
    TKNQVQDIELLKHMNVLGLPTIEFWDAKGEHVSNARLTGFMQAEPFLEHINRF

    >gi|28899716|ref|NP_799321.1| soluble pyridine nucleotide transhydrogenase [Vibrio parahaemolyticus RIMD 2210633]
    MAHVNHYDVIVIGSGPGGEGAAMGLTKAGLNVAIVEKESSVGGGCTHWGTIPSKALRHAVSRIIEFNSNPLFCRNNTSLH
    ATFSDILGHAKTVIDKQTRLRQGFYDRNDCTLLFGTARFIDTHSIAVMQNDGTEETYSADKFVIATGSRPYRPSDVDFLH
    ERIYDSDSILSLKHDPRHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLEFLDNEVSDALSYHFWNSGVVIRNDETY
    EKIEGTEDGVIIHLQSGKKMRADCLLYANGRTGNTDKLSLDVVGLESDSRGQLKVNRNYQTAVEHIYAVGDVIGYPSLAS
    AAYDQGRFVAQAITKGQAENYLIEDIPTGIYTIPEISSVGKTEQELTAAKVPYEVGRSSFKHLARAQIAGKDVGSLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGQANTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|28899726|ref|NP_799331.1| thiosulfate sulfurtransferase [Vibrio parahaemolyticus RIMD 2210633]
    MDQFQHIDVQGAQALLEQGEAKLVDIRDPQSFAVAHAESAYHLTNDTIVAFMEDVEFEQPILVMCYHGISSQGAAQYLVN
    QGFEQVYSVDGGFEAWQRAQLPIVRS

    >gi|28899775|ref|NP_799380.1| thioredoxin [Vibrio parahaemolyticus RIMD 2210633]
    MSDKILQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLNIDHNAGTPPKFGIRGIPTLL
    LFKDGNVAATKVGALSKTQLKEFLDANL

    >gi|28899799|ref|NP_799404.1| ThiF protein [Vibrio parahaemolyticus RIMD 2210633]
    MLTDQEFIRYQRQVSLPEIGESGQARLGQSHVLLIGCGGLGSAASLYLAAAGVGKLVVIDDDHVDSSNLQRQVIYREGDI
    ELAKTEAMAQQLRHLNSMIQVRTITKRLDQAQLQLEVMLADVVLDCSDNLPTRQLINQVCYEQNTPLISAAAIGWQGQFA
    VFDYSDKPSNSGCYRCLYPFDELQQTMK
    CSETGIIGPVVGTLGNYQALAAIQKLAIDRFHVECGQLHLFDGLRMNWQTMS
    ITKDKQCQVCGDNNLAPMSS

    >gi|28899828|ref|NP_799433.1| thiol:disulfide interchange protein [Vibrio parahaemolyticus RIMD 2210633]
    MKKLFALFSMLMLSLSAHAAQFKEGEHYKVLDLEVSKKPLVTEFFSFYCPHCNTFEPVIQQLKKQLPEGTKLQKNHVSFM
    GGNMGPSMSKAFATMVAMKVEDQMVPVMFNRIHNMRKPPRDDAELRQIFLDEGIDAKKFDAAYNGFAVDSMVRRMDKQFE
    NSGLTGVPAVIVNNKYLVQAQSIKSMDEYFALVNYLLTLK

    >gi|28899901|ref|NP_799556.1| methylated-DNA-protein-cysteine S-methyltransferase [Vibrio parahaemolyticus RIMD 2210633]
    MNTVYTEMPSPLGAVTIQSNAEGLLGIWFETCTTKPSELGRRDDQHPILRQAVTQLDEYFSGLRNEFDLPLAATGTDFQN
    QVWHALTTIPYGETWSYQDLANAIGNPKAVRAVGLANGKNPISIVVP
    CHRVIGKSGKLTGYAGGVERKQRLLALEQGTPL


    >gi|28900062|ref|NP_799717.1| bifunctional methionine sulfoxide reductase A/B protein [Vibrio parahaemolyticus RIMD 2210633]
    MKKISKLLVGFSFALPVLFLLLSKTGTADTMDKMKALENAEIATLAGGCFWCTESDLEQLPGVLDVVSGYSGGHVKNPTY
    RQVSSGKTGHIESIEVKYDPNVVNYEQVLDYFFRHIDPTDDKGSFVDRGPQYRPAIFYHNAEQKQIAEQFMMEIDNAKVY
    PKPLKTELIKFETFYPAEEYHQDYYKKSSLKYKYYRYASGRDKYLDEVFGDDRKEHPKTLRQLIDEKKLLSKVKAYNKPS
    QSKIKSTLTELQYYVTQEEGTERPFDNEYWDNKEAGIYVDIVTGEPLFSSTDKYKSGTGWPSFTKPINPGYIVEKTDYKL
    IYPRTEVRSKFGDSHLGHVFTDGPKPTGLRY
    CMNSAAMKFVPVSKMAQLGYGDYLFLFEQ

    >gi|28900139|ref|NP_799794.1| phage shock protein E [Vibrio parahaemolyticus RIMD 2210633]
    MKKAISLFLATLSLGLLAPNVAASERAEQGWQLIEQGAMIVDVRTPQEFSEGHLDNAVNFPLSELDKHFKDVKKDQLIVL
    Y
    CRSGNRSGQAYQYLQSQGFTNLHNAGGLEELQNAQ

    >gi|28900156|ref|NP_799811.1| methionine sulfoxide reductase A [Vibrio parahaemolyticus RIMD 2210633]
    MMEKIYFAGGCLWGVQEFMRHLPGVISTEAGRANGKTDNTQSEYDGYAECVRTEFDPSQVSIETLMGYFFEIIDPYSINK
    QGDDVGEKYRTGVYSRDTKHLEIAKSFIATRYDADKIAVEVLPLKNYVPSDEEHQDRLTRFPNDYCHIPLDLLHKYKNK

    >gi|28900241|ref|NP_799896.1| glutaredoxin 2 [Vibrio parahaemolyticus RIMD 2210633]
    MKLYIYEHCPFSARVRFVAGMLNIQLDVINIAYDDESTTTNIIGAKQVPLLIKDDGEAMAESLDIINYFLELASSSENSH
    PSTPVLDWQKQAFLPLQKVGYPRWSNMTLPEFATETAKQAWREKKETEALNFEALINDTPAIAKEVAALIEQTKPLLNLS
    SEKQTSLVDQAIMFSILRGFFSAPEVQWDPAVLHWMATARKATNVPVLI

    >gi|28900340|ref|NP_799995.1| putative formate dehydrogenase, alpha subunit [Vibrio parahaemolyticus RIMD 2210633]
    MIEIVIDGKYRIVEEGLTLLEAAKVCGVEIPSLCGMNKSNEKIPCDLCVVEVESGGTKRACDLKVYRGLNVVTQSEQLSE
    HRRKALNRIMTDHYADCEAPCKTACPAGVDIQSYLYHISQNDHQKAIEVIKRTLPMPLSIGRVCPAFCESECRRSLVDEP
    IAIRQLKRHAADADLAAHEAYVPEKKPAKHRKIAVVGSGPGGLTAGYYLSNEGYDVTIFESMPKAGGWLRYGIPEYRLPK
    DILDKEIELMCRNGMQVETNKKLGVDFTLSQLSEDYDAVCLAVGASQAVEMNYPGSDLDG
    CYLGVDYLKDYVTEQNYVTG
    KKVAVIGGGNTAIDCARTARRAGADTTLIYRRTRDEMPAEDYEIVEAEHEGVTFHFLTNPAENIADENGRVKAIRLERMA
    LGEPDASGRRSPKPTGEFFTEAFDTVIAAVSQKPDLSFLENDDLSIPLTRWNTSESDSQTMHTGTGNIFSIGDFRRGPAT
    AVEAVGDGRVAAKAIDLFLNGDMADMPKPAFNSRKEKKLAQVDPLHFENIQKVARSIMPELTPAQREQSFAEVELGFDNE
    EAMKEAARCLECGCQANTDCALRDYSTEYHAEQHFDVSVDVSSASVIGHQDWLDLRAKDLRHKYEVDRSSEFIEFDANRC
    ISCGQCIQACREQAVHGVLSFVSDKNGRPALRPDDRPRFRSDEKGVGCSGLTLMGDSKCVQCGVCVQACPTGAMVDSRDR
    SQGRTEQLKAVDTICTYCGVGCKLTMFVDERQNKIRYVKGADSPVNQGMLCVKGRFGFDFISSEERLTTPLIRKDGWLQP
    ATWDEAIQLVASKLSTIKQDFGSNALAGFSSAKTTNEDNYAFQKFIRRELGTNNVDHCARL
    CHASSVTGLEASLGSGAMT
    NDIPSIKHSDVIFIIGSDTTSAHPIIASHIKQAIRHHGARLIVADPKRVDMAEHAELYLAHRPGTDVMLLNGVMQQIIKN
    GWYDQEYIEERVDGFDTLLQEVMSPAYNLDKVELVTGVKADDIFAMARMIGTAKRTAVYYSMGITQHTTGHDNVRSIANL
    QLLCGNIGIEGGGINPLRGQSNVQGACDMGALPNCYPGYQKVYNPIVRQKFAIEWDAPNLPSEQGLTLTEIIDAACKREV
    RGMYIMGENPVLSDPNQAHVIEGLEALDFLVVQDIFLTETAQYADVVLPSCSFAEKSGHFTNTERRVQRVNAAVKAPGEA
    KEDWWIIQAIANAMGSDWHYQCVSEITSEIARVTPQYAGLRWDAITPNGVQWPSNKNNPNGTRIMHQTQFTRGKGQMVGV
    PFRYAAELPDEEYPLVLTTGRVLEQFHTGTMTRKTKGLDNLAGPRAMISVEDAEAIGIHNGQRLKVSTRRGNIEIDAFVT
    KRMQKGVVFIPFHFVESPVNRLTTTATDPHAKIPEFKVAAVKIEISETAAQPEPVEEAVHHV

    >gi|28900379|ref|NP_800034.1| glutaredoxin-related protein [Vibrio parahaemolyticus RIMD 2210633]
    MTQPIKITLYRWAGNWGPFKVNIPCGECTLTKDILVDTFANELADVPVELEVKDWLSHWWEPLKVGAWHAPILLVEGKVV
    SQGEALNRGVLVQSVISEWVKRDELKGNIVYGKAT
    CPYCVKTKQLLDDAGIKYEYHDVVKDSAALYRMIPEVKAIIGEKT
    PVTVPQIWLEGKYVGGADNLEKWLAAKGLDKVPNNVVEIPSQSA

    >gi|28900401|ref|NP_800056.1| putative disulfide oxidoreductase [Vibrio parahaemolyticus RIMD 2210633]
    MFKTISKGVALFAAIAALSACDSGNSQPQQGKQYEVLPVSLQEYNLAPLTEAFALTCGHCRSMEEFVPQIESLTEQKVEK
    MHVTFNESAQISAIIFYTAVMQLDATPDKAFMADLFAAVQMGADATAEERQQAVEKAFESRNLISPYHLDEAQQEKLFEY
    ITKAESITTRGQINSVPAFIVNGKYQVITGGHDSVEAMAETINYLLKQPK

    >gi|28900404|ref|NP_800059.1| hypothetical protein VPA0549 [Vibrio parahaemolyticus RIMD 2210633]
    MKFIRWILGKVILLLNAVFSPRGIKRTNEAQSNVDDKAKQYALYQFEACPFCVKVRRAMKRQSVNIELRDAKNDPTHRAE
    LEQGGGRVKVPCLRIEKDGETQWLYESSDIVAYLEKEFA

    >gi|28900801|ref|NP_800456.1| hypothetical protein VPA0946 [Vibrio parahaemolyticus RIMD 2210633]
    MLNVIPWESLFGGILLGISATILLLVNGKIAGISGIMNGIMSPKKGDYSWRLLFAVGMIAGGLISVLMLGVAAPSTANLS
    LGMVIAAGLLVGIGTRLGNG
    CTSGHGICGMGRLSKRSIVATCVFMAVAGLTVFVRLHLV

    >gi|28900804|ref|NP_800459.1| putative NADH oxidase [Vibrio parahaemolyticus RIMD 2210633]
    MTKILIVGGVAGGASAAARARRLSEDAEIIMFERGPFVSFANCGLPYHIGGDIQERSKLLLQTPESFLARFNVDVRVMNE
    VVSINRQDKTVTIKNLLDESEYVESYDFLLLSPGAGPIVPPIPGLDNPLTHSLRNIPDMDRIIETIQMNKPEHATVVGGG
    FIGLEMMEAFHQLGIKTSLIEMADQVMTPVDREMAGFAHAEIRDKGVDLKLGVALESVKFVPNEHVASFDSGESEKHQHL
    EGELELTLNNGEKLTTDILIMAIGVRPETKLAQEAGLQIGALGGIYTNEYMQTSDPSIYAVGDAIEEKDFVTGEQTLVPL
    AGPANRQGRMAADNMLGRKETYQGTQGTAICKIFDLAVASTGKNEKQLKRAGIAYDKVYVHTASHASYYPGAEVVSFKML
    FDPQSGKILGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELTYAPPYGSAKDVINQAAFVANNIIKGDATAIHYDEI
    DNLTEDQILLDVRNPGELESVGYLEGAINIPVDQLRHRMDELPKDKEIVIY
    CQVGLRGNVAYRQLVNNGYKARNLIGGYR
    TYLHSKV

    >gi|28900813|ref|NP_800468.1| putative NADH oxidase [Vibrio parahaemolyticus RIMD 2210633]
    MTVEQLQHLELTYAPPYGSAKDVINQAAFVANNIIKGDATAIHYDEIDNLTEDQILLDVRNPGELESVGYLEGAINIPVD
    QLRHRMSELPKDKEIVIY
    CQVGLRGNVAYRQLVNNGYKARNLIGGYRTYKFAKA

    >gi|28900827|ref|NP_800482.1| thioredoxin 2 [Vibrio parahaemolyticus RIMD 2210633]
    MSSFKTRCPSCGGLNRVPNERVAESATCGKCKSPLLDGVPIEGTLDNFSALLESSTPVVVDFWAPWCNPCVGFAPVFSDV
    AQEQAGTARFVKIDTEAQQQLAAQFGIRSIPTIMVFKNGQRVDMLNGALPKSQFDQWLNQALTK

    >gi|28900849|ref|NP_800504.1| hypothetical protein VPA0994 [Vibrio parahaemolyticus RIMD 2210633]
    MFIQTVRIVIPLVLLQFLTGCQSDDNDKLKSEIESLKQEISQLTKEVGKIENEVKEMKNLAFNPPKKEPPTLPNQPNFTE
    DGTLPLLGSKDAKIAIIEFSDFQ
    CPYCKRFTDSAFKQIKENYIDTGKVQYIARDFPLSFHAKAMGAAIAATCSLHQNSYW
    PMRDMLFSNVKDLGEELYQKAATDLSLNLEEFNKCMKDKSIANKVEQDLTLGKSLGIRGTPSFLIGRVENDQLIEPQIVV
    GAQRYAVFESLLEQLSNSDKAK

    >gi|28901026|ref|NP_800681.1| molybdopterin biosynthesis protein MoeB [Vibrio parahaemolyticus RIMD 2210633]
    MDILSDHEMLRYNRQIILRQFDFEGQEALKQSSVLILGAGGLGCASSQYLATAGVGRITLIDDDIVELSNLQRQVLHHDT
    DIGRKKVDSAADALRELNPHVEVNTVAKRLDDAQLQALIEQHTVVVDASDNVDTRNQLNRLCFATKTPLISGAAIRMEGQ
    VSVFTYDDPTQPCYQCLSALFGSGALS
    CVEAGVMAPVVGIVGAVQAMETIKVIANYGQPKKGKILILDALSMSWREMNLI
    KMPTCPVCG

    >gi|28901030|ref|NP_800685.1| putative thiosulfate sulfurtransferase SseA [Vibrio parahaemolyticus RIMD 2210633]
    MQALISAKELHALLDQQNVKLLDASISFQIPSESKKITDKWIPNTYRFDYDNDFCLPDTSLPHMMPTEAGFNVSAQKLGL
    NNEDLIIVYDNSGTLASPRAWWMLKAMGHENVKVLNGGLPAWIEAGLPVVDSLAKPEQLGNFAGKLNKNAFLDANAVLEY
    SNNCSAHIVDARSRARFFGEVPEPREGLRSGHIPNSLCLPFQELLDNGYIKPNSELKQAFSELSLYNDNSIIFS
    CGSGVT
    ACILLLAAHQLGLRNLSVYDGSWTEWGADCSLPITR

    >gi|28901106|ref|NP_800761.1| putative ABC transporter [Vibrio parahaemolyticus RIMD 2210633]
    MKGLLKLAAYLGFISMSSFVLASECPDILQGKQRMLNSTEEIELCEVFKGKTLLVVNTASQCGFTPQYEQLETLYQTYKD
    KNFAVIGFPSNDFRQDKGSEENTAKICYLDYGVTFPMMARSSVLGNDANPVFSEISTQAGVTPKWNFYKFLISKEGKVIA
    TFPSSTSPTSTTLTNMIEQQL

    >gi|28901126|ref|NP_800781.1| thiol:disulfide interchange protein [Vibrio parahaemolyticus RIMD 2210633]
    MKKLLALCSTLLLAFSAHAAQFEEGKHYKVLDVEKATKPTVTEFFSFYCPHCYKFESVIENLKPALPKEARFEKVHVAFM
    GADMAVPMAKSYAAMVSLGVEDKMVPAMFAQIHQKRQAPKNEDELKKVFTDNGVDGNKFDAAYNSFAVSSMQKRFDKQFK
    ESTLTGVPGVVVNNKYIVIPNEVRSYAEYSELVNYLLTL

    >gi|28901148|ref|NP_800803.1| putative antioxidant [Vibrio parahaemolyticus RIMD 2210633]
    MIQQGQALPSATVSELTADGMVNHDVTELFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADQLKAKGVDLIACVAVNDAF
    VMNAWGEAQNASEILMLGDGDASFTKALGLEMDTGGFGGVRSQRYAMIIENGVVTTLNVEKPSEFEVSNAETILAAL

    >gi|28901470|ref|NP_801125.1| putative outer membrane protein [Vibrio parahaemolyticus RIMD 2210633]
    MTFTRTLLALTMAIVPAVSFASEKTSEQKLEEITQILKENPQILDSLHQNLQEYIAYQQSFGDTLKEVRQYLNDGKHSSF
    GAETPELTIINVTDYS
    CPFCKRLEGELVKVGKEYPQIKVLNLNVSFKEQYEKNGYNSASYALNVWQNQRDKYEQVHELLV
    KKPGAHDARSLKQIAKKTGTEAQLVDDKETKALLDKNYQYFTQLGLRGTPALIINDQVIPGYVPFDELEKVIDQELAN

    >gi|28901536|ref|NP_801191.1| putative organic hydroperoxide resistance protein [Vibrio parahaemolyticus RIMD 2210633]
    MTTLYKTQATALAGRNGQVKTNDGLLDLELAYPKEMGGTGAATNPEQLFAAGYSACFSNAILHVAREAKVALKSAPVTAE
    VGIGPNENGGFALTVGLAAELDLPQEQALELTRIAHQV
    CPYSNAVRGNIDVAVTVNGEAI

    >gi|28901538|ref|NP_801193.1| alkyl hydroperoxide reductase c22 protein [Vibrio parahaemolyticus RIMD 2210633]
    MINTKIKPFAATAYKNGEFVEVTEQDVLGKWAVFFFYPADFTFVCPTELGDLADHYEELQKRGVEVYSVSTDTHFTHKAW
    HDSSETIGKIQYYMLGDQTGNITNNFGVMREGQGLADRATFLIDPEGTIQAMEITAEGIGRDAEDLLRKVKAAQYVAAHP
    GEVCPAKWKEGEETLAPSLDLVGKI

    >gi|28901539|ref|NP_801194.1| alkyl hydroperoxide reductase, subunit F [Vibrio parahaemolyticus RIMD 2210633]
    MLDQAIQQQLKQYLANVKEDVRLVVSLDESKASNDILSLANQIAEMSDFITVERDDNASARKPVMTVTNPVKGTALRFAG
    LPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKELDVEVFISLS
    CQNCPDVVQAFNMMAAINPKVKATMIDGALFQ
    DEVKQRDIMAVPSVFVNGELFGQGRMSLTEILNKVDDGASEKAAKALSEKAPYDVLVVGGGPGGSAAALYAARKGIRTGV
    VAKRFGGQVMDTMAIENFISVKRTEGPKLATDLAEHLKEYDVDVVTEQQAQKLMGAAHTDDGLIHIQLESGATLKSKSVI
    LSPGARWREMNVPGEQEYRNKGVAY
    CPHCDGPLFKGKKTAVIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLIDK
    ANSLPNIDIITMAQTTEVVGDGTRVTSLKYKDRNTDEIKEIELSGIFVQIGLVPNTEWLKDSEVALSERGEIEVGSRGET
    SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG

    >gi|161511061|ref|NP_796916.2| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio parahaemolyticus RIMD 2210633]
    MKILLANPRGFCAGVDRAISIVERALELYQPPIYVRHEVVHNRFVVEGLKQRGAIFVEELHEVPDNNIVIFSAHGVSQAV
    RQEAKQRDLTVFDAT
    CPLVTKVHMEVARASRRNMEVVLIGHAGHPEVEGTMGQYSSETGGMYLVETPADVEKLKAIVKDP
    SDLHYVSQTTLSVDETADVIEELRRVFPDIQGPRKDDICYATQNRQDAVRELAGDVDVMVVVGSKNSSNSTRLKELAEKL
    GTPGYLTDCPEDIKPEWFEGKTKVGVTAGASAPEELVNQILERIKELVGARSVDEVLGREENMFFEVPKELQIKQVD