Vibrio harveyi ATCC BAA 1116 uid58957

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|156972416|ref|YP_001443323.1| glutaredoxin [Vibrio harveyi ATCC BAA-1116]
    MFASKEGQAVPQVTFPTRKGDAWVNVTTDELFKDRTVIVFSLPGAFTPTCSSSHQPRYNELFSVFKEHGVDEILCVSVND
    TFVMNAWKADQEAENITFIPDGNGEFTDGMGMLVDKNDIGFGKRSWRYSMLVKNGVVEKMFIEPNEPGDPFKVSDADTMM
    NYVAPEYKTQESITVFTKPG
    CPFCMKAKQNLIDHGLQYEEVILGKDATTVSLRAISGRTTVPQVFIGGKHIGGSEELEAY
    LG

    >gi|156972417|ref|YP_001443324.1| dihydrolipoamide dehydrogenase [Vibrio harveyi ATCC BAA-1116]
    MKQLNVDVAIIGGGTAGLGAYRAAKAHTDSVVMIEGGPYGTTCARVGCMPSKLLIAAAESVHQIEKAPGFGVHPQGEIYI
    NGREVMDRVKRERDRFVGFVLEGVDEIPAEDKVSGYAKFANDNTLIVDDHTQITAKRIVIATGSRPAYPAVWNELGDRLV
    INDDVFDWDDLPESVAVFGPGVIGLELGQALHRLGVNVKLFGLGGQVGPLTDPEVMAYADKAFKEEFYLDADVKVESMKR
    IASSDNSEEDKVEIKFINHDGELETFIVDYVLAATGRRPNVDKLSIENTNVALDERGVPTADHYTLQTSVESIFIAGDAS
    NQIPLLHEAADQGRIAGDNAGRFPDIRAGLRRSSISAVFSDPQIAMVGETFKQLETRLGTCGCFATGEVSFENQGRSRVM
    LRNKGMLHVYGEQGTGRFLGAEMMGPNAEHLAHLLAWAHQNKMTVSEMLDMPFYHPVIEEGVRTALRDLNAKLHLGPEII
    KHCLDCGPGC

    >gi|156972440|ref|YP_001443347.1| hypothetical protein VIBHAR_00060 [Vibrio harveyi ATCC BAA-1116]
    MSGLTYTLVVNGPVYGSQSARSAYQFAQAVIEQGHTLVSVFFYQDGVTNGTALSVPANDEFDLTKAWQSLAQQHDVRLET
    CVAAALRRGIVSEDEANQHGLEQNNLATGFEQAGLGSLAEALLTQDRVVQF

    >gi|156972490|ref|YP_001443397.1| sulfurtransferase [Vibrio harveyi ATCC BAA-1116]
    MQEYIDFFQQNMILSLVWVGLLVAFIMNLVKSATAAYKEINVNQLTHLMNRENGVVVDIRSKDEFKQGHITDALHILPSD
    IKAGNFGSLENRKSGPIIVV
    CKTGQTAQESANLLAKAGFENVSLLKNGLIAWNEANLPLVRGKK

    >gi|156972524|ref|YP_001443431.1| thiol:disulfide interchange protein precursor [Vibrio harveyi ATCC BAA-1116]
    MALFGNDQFGNNQNNAFGSSNDSFVPVDQAFPFNYYQQDGKLMLDWQVRDGYYLYQERLSVAGEKVSLGELQMEEGTPHK
    DEFFGDVHIYTQPLFVNVPMHDWQDGARVVVQYQGCAKAGFCYPPETRVIPISAFTSSNSDSTAATTAPKAEQAPTVTPP
    AAQSSTSSNTLSAPVTQQDSLAANLADNWWTPLLFLALGVGLAFTPCVLPMYPILTSIVLGSGKLSQRRALGLSFVYVQG
    MALTYTLLGLVVASAGMQFQAAMQHPYVLIGLSVLFVALALSMFGVYNLQLPSGVQTWLNNLSNKQQGGSSAGVFAMGAI
    SGLVCSPCTTAPLSGALLYVAQSGDLLTGGIALYALAMGMGIPLILVAVFGNKLLPKAGGWMDRVKTLFGFILLAAPIFL
    LERIMPEMWATALWSALGIAAFGWLYHIKNSLEFGGWKQSAVGIIAVLGLFASAQPALNYWFGGNTTTQTQQATVSFTRI
    ANVAELEAALAQAKQAGKPVMLDFYADW
    CVACKEFEKYTFHDPSVEAKLQDFVLLQADVTKNQLQDIDLLKHMNVLGLPT
    IEFWDANGEHVSNARLTGFMQAEPFLEHINRF

    >gi|156972613|ref|YP_001443520.1| soluble pyridine nucleotide transhydrogenase [Vibrio harveyi ATCC BAA-1116]
    MLSKYNKEDIMAHANHYDVIVIGSGPGGEGAAMGLTKAGLNVAIVEKESSVGGGCTHWGTIPSKALRHAVSRIIEFNSNP
    LFCRNNTSLHATFSDILGHAKSVIDKQTRLRQGFYDRNSCTLLFGTARFIDNYSIAVMQSDGTEEVYSADKFVIATGSRP
    YQPNDVDFLHERIYDSDSILSLKHDPRHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLSFLDNEVSDALSYHFWNS
    GVVIRNDETFEKIEGTEDGVIVHLQSGKKMKADCLLYANGRTGNTDKLNLPAVGLEGDSRGQLKVDGNYRTEVEHIYAVG
    DVIGYPSLASAAYDQGRFVAQAITKGQADGNLIDDIPTGIYTIPEISSVGKTEQELTAAKVPYEVGRSSFKHLARAQIAG
    KDIGSLKILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGEANTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|156972624|ref|YP_001443531.1| thiosulfate sulfurtransferase [Vibrio harveyi ATCC BAA-1116]
    MDQFQHIDVQGAQALLEQSEAKLVDIRDPQSFAVAHAESAFHLTNDSIVSFMNDVEFEQPILVMCYHGISSQGAAQYLVN
    QGFEQVYSVDGGFEAWQRAELPIVRS

    >gi|156972679|ref|YP_001443586.1| thioredoxin [Vibrio harveyi ATCC BAA-1116]
    MSDKILQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDHNAGTPPKFGIRGIPTLL
    LFKDGNVAATKVGALSKTQLKEFLDANL

    >gi|156972705|ref|YP_001443612.1| adenylyltransferase [Vibrio harveyi ATCC BAA-1116]
    MLTDKQFLRYQRQVALPEIAEVGQERLSKSHVLIIGCGGLGSAASLYLASAGVGKLVVVDDDDVDSSNLQRQIIYREQDL
    QVAKTKATVKQLTELNSMVQVRALNKRLDKAQLQLEVMLADVVLDCTDNMPTRQLINQVCFEQNTPLISAAAIGWQGQFA
    VFDYQTPSEQEAQSKACYRCLYPFDELPQTQK
    CSESGVIGPVVGTLGNYQAIAAIQKLATRKFHVETAKLHLFDGLKMQW
    QTMAISKDKQCQVCAQI

    >gi|156972739|ref|YP_001443646.1| disulfide bond formation protein [Vibrio harveyi ATCC BAA-1116]
    MKKLFALFSMLMLSLSAHAAQFKEGEHYKVLDLEASKKPVVTEFFSFYCPHCNTFEPIIQQLKKQLPEGAKLQKNHVSFM
    GGNMGPSMSKAYATMVALKVEDKMVPVMFNRIHNMRKAPRDDAELRQIFLDEGVDAKKFDAAFKGFAVDSMVRRMDKQFE
    NSGLTGVPAVIVNNKYLVQAQGIKSTEEYFALVDYLLTLK

    >gi|156972846|ref|YP_001443753.1| glutathione reductase [Vibrio harveyi ATCC BAA-1116]
    MLDKINKLLEKVMATHFDYICIGGGSGGIASANRAAMYGAKVALIEAQDLGGTCVNVGCVPKKVMWHGAQVAEAMNLYAE
    DYGFDVDVKGFNWSKLVESRQAYIGRIHQSYDRVLGNNKVNVIKGFAKFVDEKTVEVNGEHYTADHILIAVGGRPTIPNI
    PGAEYGIDSNGFFELAEQPKRVAVIGAGYIAVEIAGVLHALGTETHLFVRKESPLRSFDPMIIETLVEVMDAEGPTLHTH
    SVPKEVVKEADGSLTLHLENGESQNVDTLIWAIGRHPATDAINLASTGVATNDRGYIKVDEYQETNVKGIYCVGDIMEGG
    IELTPVAVKAGRQLSERLFNNKPNAKMDYDLVPTVVFSHPPIGTIGLTTQEAEEKYGKDNIKVYTSGFTAMYTAVTKHRQ
    PCKMKLVCAGEEETVVGLHGIGFTVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVTMTG

    >gi|156972847|ref|YP_001443754.1| glutathione S-transferase [Vibrio harveyi ATCC BAA-1116]
    MTMLKVISFKICPFVQRVTAALEAIQIPYEIEYISLKDKPQWFLDISPNGQVPVMVTESGTALFESDAIIEYIEDEYGPL
    EQGVTNEQRALDRTWSYLGSKHYLPQCGTMGSKDQATFEERTEKLIKAFQKAENQLSGETKFFKSDELSNVDMAWLPLLH
    RAAIVKAHSGYDFFCGLPKMQAWQKHILESGLAEKTVSEDFIKLFSDFYLTNTYLADGKDMQAQSGCGTSSCCG

    >gi|156973099|ref|YP_001444006.1| methionine sulfoxide reductase A [Vibrio harveyi ATCC BAA-1116]
    MLNKQTMISIEDALPGREASMQIDDTHFVNQSSLTAQPQAHQQQILLGMGCFWGAERLFWQIEGVVSTSVGYAGGYTPNP
    TYEEVCTGKTGHTEVVRVVFDDRVISLEHLLAAFWEKHDPTQGMRQGNDLGTQYRSAIYTYSQEQQDAAERSKVQYQQAM
    QEDQRSAITTEIEPAGPYYFAETYHQQYLAKNPNGYCGLGGTGVCFPPSLQG

    >gi|156973276|ref|YP_001444183.1| protein-disulfide isomeras [Vibrio harveyi ATCC BAA-1116]
    MKGFNFKVNLMSVLRRLTLLTLPFFVTACGAEESQAKTETPAQQVAPAAKQNFDEAALKAKFSKLGVSILDIQPSDVAGL
    LEIQTNGGVLFASNDGNHFIAGTLYAIDDNGGYKDVVAERQAPLNAAKIAKFSDSVIEYKADNEKYVVTVFTDIT
    CGYCV
    RLHSQMQGYNDLGITVRYMAYPRQGATGPVAEQMATIWCAEDPQSAMHNAKVERTFDNPAKDLKQCKETIQAHYNLGREL
    GISGTPAIFLPNGELVGGYLPPADLLKRLEQQ

    >gi|156973352|ref|YP_001444259.1| hypothetical protein VIBHAR_01039 [Vibrio harveyi ATCC BAA-1116]
    MVLVGRQAPDFTAAAVLGNGEIVENFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLADFQAKGVEVIGVSIDSQF
    SHNAWRNTAIEDGGIGQVKYPLVADVKHEICKAYDVEHPEAGVAFRGSFLIDEDGLVRHQVVNDLPLGRNIDEMLRMVDA
    LNFHQKHGEVCPAQWEEGKAGMDASPKGVAAFLSEHADDLSK

    >gi|156973370|ref|YP_001444277.1| hypothetical protein VIBHAR_01057 [Vibrio harveyi ATCC BAA-1116]
    MAITMTESAASRVKAFLDNRGKGIGLRLGVKTTGCSGMAYVLEFVDDLNEEDEVFELSDVKIIIDKKSLVYLDGTELDYV
    KEGLNEGFEFNNPNAKSECGCGESFNV

    >gi|156973566|ref|YP_001444473.1| cation transport ATPase [Vibrio harveyi ATCC BAA-1116]
    MYQFVVPMSGLNCMGCARKIEKALHTNHSVEIINLSPTMVEVKTESPLSSIVESIESLGYQAGHQYQFHLAGLSCGGCVK
    KLSSLLEANQDVIAFQASTTQLDITTLLSEQQVIDLVATLGYTASFDSIEVEEESSPEIEQVEKQSNTRDAQVPPASIQL
    QMLIQGMT
    CASCVSSVEKALTNVEGIEKAQVNLAEQSALVFATQDTEALHQAIVQFVKQAGYQAEILQDAATQQEKQAAQ
    QLAQQKRFKLDAIAGLVVGAPLMLWGVFGGNMMIRNTNDQLAWGAIGILCLLLLATAGKHFFTNAWLAATHKRATMDTLV
    ALGTGAAWFYSMLVVIFPDWFPLASRHVYFEASAMIIGLISLGHYIEAKAKANTTRSLQALINLQPQQATAITEQGDQQI
    AVEQITLGMKLRIKPGEKVPVDGVVIQGESYIDESMLTGEPVPVLKAQDAQVSAGTLNTDGGLIIEATGIGANTMLARII
    RMVRTAQSSKPAIAKLADQISSVFVPVVVGIAILAALVWFAVGPEPKASYMLVVTTTVLIIACPCALGLATPLSVTVGVG
    KAAELGILIKDADALQLASKIDTVVFDKTGTLTQGKPSVQQVFTHTPSQEHMLALAYAAERQSEHPLAKAVCDYARKNKT
    ESVELSAFENIRGRGISATYQAQPLFIGSLQFMQNEQIDTSPMEQAIEDCASNAWTPVAVALNNELIGLIAIADPIKSDA
    KQAVSALKSQGIKTVMLTGDNQHVANAIGQELGIDEVIAQVMPDEKAQHIKLLQSQGSKVAMIGDGINDAPALALADLGV
    AMGSGSDVAIESSQMTILNTSPMAVVHAIELSRATLKNMKQNLFGAFIYNSLGIPIAAGVLYPAFGFLLSPVVAGAAMAL
    SSITVVSNANRLRLFTIK

    >gi|156973620|ref|YP_001444527.1| hypothetical protein VIBHAR_01323 [Vibrio harveyi ATCC BAA-1116]
    MDKAIIDIYYCRQCNWMLRSTWLSQELLHTLSEEIETVSLHPDTGGRFEIFCNGTRIWERKKDGGFPEAKVLKQRVRDII
    DPERDLGHSDTK

    >gi|156973707|ref|YP_001444614.1| hypothetical protein VIBHAR_01411 [Vibrio harveyi ATCC BAA-1116]
    MSVWEGVNFTHRFSELPSAFFTYVTPQLLDNTRWVVWNGEFAQQFGLPAAENEELLNVFAGQKEFAPFAPLAMKYAGHQF
    GVYNPDLGDGRGLLLAEMQHQDGTWFDIHLKGAGLTPYSRMGDGRAVLRSTIREYLCSEAMAGLGIPTTRALGMMDSDTP
    VYREKTEYGALLIRVAETHIRFGHFEHFFYTNQLAEQKLLADKVIEWHFPECSEAEKPYAAMFESIVEKTAEMIAYWQAY
    GFAHGVMNTDNMSILGQTFDYGPFGFLDDYDPNYICNHSDYQGRYAFEQQPRIALWNLSALAHSLSPLVQREDLEAALGK
    FEVRLSQKFSELMRAKLGLHTKVDEDGRLFEAMFELLNQNKADYTRFFRELSNLDVKSPQAVIDLFIDREAASAWVDLYL
    ARCELEVDECGERVSAQTRCEKMRRTNPKYILRNYLAQIAIDKAEEGDFSEVNRLAELLKRPYDEQPEFDDYTKLPPEWG
    KKMEIS
    CSS

    >gi|156973773|ref|YP_001444680.1| hypothetical protein VIBHAR_01483 [Vibrio harveyi ATCC BAA-1116]
    MDSISGDNSDLYNRVFIPKTQRFDIKHEFSKIDSELPCTVPTYDEFCQKVRKLGIKKDSTVVIYDAKGIYSSPRAWWLLT
    LMGHKKVFVLDGGMPKWEMENRPLAVSASESNSNVQWEGDFFSELAVDKDQISSAIALSEANILDARSFLRFSGAAPEPR
    KGLRSGHVPSAKNLPFEQLVSRGCYLPKEALKAKFDELGIDMSLPSYFY
    CGSGVTACILLLAALEIGMKQLAIYDGSWSE
    WGADPALLIEAGNVG

    >gi|156973805|ref|YP_001444712.1| zinc/cadmium/mercury/lead-transporting ATPase [Vibrio harveyi ATCC BAA-1116]
    MDCPACAQKLEKAISSVEGVTNAKVLFATEKLVVDFDNRALASVIEQVSHQTGFPLTSTDAPKPKAEKKGWLGVIKDNVQ
    ILSIAGAMAFAGIISDFNPTLSTWLFTLTCLLGLYPVAMKAVKLARSGTPFAIETLMSVAALGALYLGETAEAAMVLLLF
    LIGEKLEAYASSRARSGVQALMDLVPENTTLIVDGERQDVPASKLQPGDVIEVAPGGRMPADGVLMTQAASFDESALTGE
    SVPVEHNEGGKIMAGAVVVDKVVQVKVTSRQGENAIDRILHLIEEAESRKAPLERFLDKFSRWYTPLMMLVSLLVIITPP
    LLFAQPWETWVYRGLALLLIACPCALVISTPAAITSGLAAAAKRGALIKGGAALELLGRVESVAFDKTGTLTQGKPQVTD
    VVPFDVTEEQLLSLTASIEIGSSHPLAISLVNKAQEQGINIPEAADKTAQVGSGVTGLVEGKLVQVIAPSKADFPISQQV
    EQQVLALEGQGKTMVIARHDNEVIGLIAWQDTLRQDAQQAVAALKKLGISSVMLTGDNPRSAEAIANQIGLDYKASLLPA
    DKVHYVEEISAQHTVAMVGDGINDAPAMKASSIGIAMGGGTDVALETADAALTHNRLIELAGMIELSRATLNNIRQNVAL
    ALGLKGVFLVTSLLGITGLWVAVLADSGATALVTLNALRLLRFESKQLK

    >gi|156974428|ref|YP_001445335.1| glutaredoxin [Vibrio harveyi ATCC BAA-1116]
    MKRVVLYVKDKCPHCKDAQRYLDSKNITYRLCNAKMQRGRKELDALGARSLPVLKIGDRVMIGWNSKNFEKMYSN

    >gi|156974580|ref|YP_001445487.1| cation transport ATPase [Vibrio harveyi ATCC BAA-1116]
    MCKSCYHCGEDVPANTDFKVEILGEIRDMCCPGCETVAQTIVDSGLVSYYQYRTAPAEKADLVPEQLQALIHYDNEDVQS
    EFVRNHENTSEVTLSLECVS
    CAACAWLIEKQVSGVKGLVSIRVNTTTNRALLAWDKTQVRLSELLSVIHKLGYKAAPFEA
    DKQEATYHNTMKQYLYRLGIAGLATMQVMMLAVALYLEVFGNLEPEFKNYFRWVSLIFATPVLLYSALPFYLNAWRSIKG
    RTLGMDVPVSIALIFAYVASLVATVTEQGEVFFESISMFTFFLLVGRFLEMRARRKAAAASGNLLKLIPAIATTLDGEQI
    PVRTLKVGDRIRVLPGEHIPADGKVISGRIHIDESMLTGESVHVVKKAGDAVYAGTLNGEESFELEVTNSKADSMISNIV
    RLQDEAQHSKPKIAEIADVVARYFVGAILIISAGTWLYWHQTKPDDAFWIMLSVLVATCPCALSLATPTALTCATSRMGN
    FGILLRKGHVFETLCKINHLVVDKTGTLTKGDIEISETQTFSDLSESDTLAIAAALEAHANHPIARAFSGFGREGFTVSD
    VQNIIGSGIQGIWNTKTVKIGSASFVVGENRDEGNAVYLSVDNEHVATFYYRDPIRKESKAFIQRFADAGIKTTLLTGDS
    LRNAQPVADEMGIDHVIASAKPEDKLAYLKGLDQDDITMMVGDGINDAPTLAGAHLSVAMGGGTDVAKASADMTLLGDNL
    EKLLEARLLAIRTRKIIRENLAWSLGYNLLILPLAVAGLVAPYVAVVGMSASSIIVVSNSLRLLKEK

    >gi|156974887|ref|YP_001445794.1| thioredoxin reductase [Vibrio harveyi ATCC BAA-1116]
    MSDVKHCKLLILGSGPAGYTAAVYAARANLNPVLVTGMQQGGQLTTTTEVENWPGDAEGLTGPGLMERMKEHAERFETEI
    VFDHINEVELSQRPFRLKGDSGEYTCDALIISTGASAKYLGLESEEAFKGRGVSA
    CATCDGFFYRNQNVAVVGGGNTAVE
    EALYLSNIASEVHLIHRRDSFRAEKILVKRLMDKVESGNIVLHTDRTLDEVLGDDMGVTGVRIKDVNSGATEDLAVMGAF
    IAIGHQPNTQIFEGQVDMKDGYILVQSGLEGNATQTSIEGVFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDALTDK

    >gi|156974916|ref|YP_001445823.1| glutaredoxin 1 [Vibrio harveyi ATCC BAA-1116]
    MFVVIFGRPACPFCVRAKEHAETLKAKRDDFNYRYVDIHAEGISKADLEKTVGKPVETVPQIFIDQTHIGGCDDFEAYAK
    EHLGLFDE

    >gi|156974954|ref|YP_001445861.1| thiosulfate sulfurtransferase [Vibrio harveyi ATCC BAA-1116]
    MKKSTIALGVLVAVTAVGYSAYKTMFSAEAVTVDAAAQEQKFTQYAHPEHFISAQQLKSLMYGDKDLIVIGALNPIKPDS
    PISGSYTMWRNDYSAAEDAYDFGGMSNSTEEMETILGSFGATADSTIVVYAAGSHHDAARLYWQIHNLGHQDVRYLDGGL
    NAWMGAGYPTGSANQSVAAVEYNAPNTQQDNNALATLDMVIAAQNNPDWVILDTRGNDEFNGEVAVSGAYGPGTIPSSVH
    INWTKALNEDTTLKSAEELQALYGDIIKGKKVIAY
    CQSGVRSAHTTMILTEVLGAKGVYNYDGSWIEYSHAHYEQKNPEV
    NVINGKS

    >gi|156974999|ref|YP_001445906.1| protein disulfide-isomerase [Vibrio harveyi ATCC BAA-1116]
    MRSRNSLKLAGLVAAVAVFSAVTAIGLSERPNVELSQQRYLEIPNFSSESLMSGEMISQQILKSDGYKLLNVWASWCGVC
    KREYEELLQLSELGVPIVGLNYRDQKQAAREYLSSKRNPYIEVFSDPNGKLAVELGVIGTPETYLIDQNGRVLIKYRGEL
    TADKWNDIFSGYLNVSI

    >gi|156975056|ref|YP_001445963.1| coenzyme A disulfide reductase [Vibrio harveyi ATCC BAA-1116]
    MKVVVVGGSAAGMSFAAKYKRNQPSDEVIVLDKRDYISFGACGLPYFTGGMFDDTERMISRTPEQAIKSGLDVRIETEMV
    GLDRTEKQIKVRHQGEESTINYDMLVIATGARPIVPSFGEFNPEHVYTLTSMEDGLAVKEALKDSNKQRICVIGGGFIGL
    EVFDAAHLLGKDVTIIEREQHVMSRQFSPEMIEVVEGAIRESGAELKTGCSVSAIRDAEQGGYIVETDNGNVEADVVIMS
    LGFKPNTEAFELPKAANGALLVDEFGATEDAHIYAVGDCAVVHHMALGKSVYVPLATTANKQARMMADKLAGKDTYMSGF
    LGSSCLKVLDYELACTGVSELLAKEHGLEVKVSTISDKNQTDYYPGQEDIKVKLVYHPETNVLLGGEIVGKKGAVGRINA
    LAVAITAKMTTQQLGYMDFCYAPPFARTWDALNVAGNVAK

    >gi|156975119|ref|YP_001446026.1| hypothetical protein VIBHAR_02846 [Vibrio harveyi ATCC BAA-1116]
    MNTVKKRKSLKYWLSQALQMVLMVTVISVAMDWYRTKDIPKEQAPPLSAIMADGEFVDVIAKSHEEPFVVYFWATWCPAC
    KFVSPSVSWLSDYYEVVAVSGASGPEERVQKFMQAKDYQFDNINDPKSSIMQEWSISVTPTIYVLKDGKVSSITTGVTTP
    IGILARIWMA

    >gi|156975120|ref|YP_001446027.1| hypothetical protein VIBHAR_02847 [Vibrio harveyi ATCC BAA-1116]
    MNHMKKTTQAALMFIMTLVVSLFSLFAHAQTTDTGWLTNPQHPPVQTRFVLTGQQDPNTNTLTGYLDVKLTGDWKTYWRS
    PGEGGVAPSIDWEKSQNLTKVDWQWPYPQKYELIGIETLGYKGDTVFPMTLHVEDMNKPVTIDAKLTLSSCTTICVLTDY
    HIQLSFLPSELQVDEDVMFTYAQAVSSVPQASPFVEVTEANWDANQSKLQIKLTNSQGWQKPEVLVDGVDEATSDYSFKL
    EGQHQEGNTLTVNYSVNTWLGDVELDNQSVYVSIKDNNLLAQETAQAKAGVITQTLPSTSLVNIFLFALLGGLILNIMPC
    VLPVLGMKLSSIVAVQGVARRQIRTQFVASSLGILTSFWLLAGFILVLKLTGNAIGWGVQFQSPWFLGLMLLVTGLFGAN
    MLGLFEIRLSSGTNTWLASKGDNSLLGHYVQGMFATLLATPCSAPFLGTAVAFALGADVVTLFAIFTALALGMALPWILV
    AIFPGIALKLPKPGQWMNVVKMVFGIMMLATSAWLLSLMANHLPVFWVILIGLVAFIVIMARVKRIYGNKALAISGTVSL
    ILIAGGLVLGSVTANHWATPLPEDLAWEKLSNEAIADHVKNGRVVFVDVTADW
    CVTCKANKIGVIWQDPVYSLLQSPNVA
    TLKGDWTHPNGSVTDFLRAHGRFGVPFNIVYGPAAPEGIPLPVILTDNVVVKAIEQASGGTIK

    >gi|156975204|ref|YP_001446111.1| disulfide bond formation protein B [Vibrio harveyi ATCC BAA-1116]
    MSIFASLNQFSKGRLSWLLLLLAIIFFEACALFFQHVMMLAPCVMCIYERVAMMGIIFAAMIGLIAPNNPLVRWIALAAW
    GASAYKGLMLAMQHVDYQFNPSPFAT
    CDLFVTFPSWAPLNQWFPWMFEAYGDCAKIVWEFLGLSMPQWLIVIFAGNLVAL
    AFIVIAQFVRGKRKNPIQ

    >gi|156975235|ref|YP_001446142.1| Na(+)-translocating NADH-quinone reductase subunit E [Vibrio harveyi ATCC BAA-1116]
    MTEYILLLVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAYLVESYVLRPLGIEYLRTMSFILV
    IAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNINENHNFIESIIYGFGAAVGFSLVLILFASMRERIAA
    ADVPVPFRGASIAMITAGLMSLAFMGFTGLVK

    >gi|156975240|ref|YP_001446147.1| SoxR-reducing system protein RsxE [Vibrio harveyi ATCC BAA-1116]
    MSENKLLMKNGMWSNNPALVQLLGLCPLLAVSSTITNALGLGIATLLVLVGSNLTVSLIRNYVPKEIRIPVFVMIIAALV
    TCVQLLMNAYAYGLYLSLGIFIPLIVTN
    CIIIGRAEAYASKNDPLPAALDGFWMGLGMTTVLVVLGAMRELIGNGTLFDG
    ADLLLGDWAATLRIQVFHFDSSFLLALLPPGAFIGVGLLIALKNVIDSSIQARQPKEEKPAIERARVTNA

    >gi|156975284|ref|YP_001446191.1| hypothetical protein VIBHAR_03013 [Vibrio harveyi ATCC BAA-1116]
    MNEEAMETIDKIKQQISENTILLYMKGSPKLPSCGFSSQAAQALMACGEKFAYVDILQNPDIRAELPKYAQWPTFPQLWV
    EGELIGGCDIILEMFQKGELQPLIKEAAARVEGDAE

    >gi|156975318|ref|YP_001446225.1| methionine sulfoxide reductase B [Vibrio harveyi ATCC BAA-1116]
    MRKYVLQLLREASFLLKKSLPKIRNKEQKLVEQSGRKVTKSDEHWREQLSDEEFRVCREQGTEPPFSGKLLHNKETGVYA
    CTCCNAPLFVSDNKYDSGCGWPSFDAPINDTAVRYLKDLSHGMVRTEIRCAACDSHLGHVFEDGPQTTGERY
    CVNSVSLI
    FNKSDQ

    >gi|156975398|ref|YP_001446305.1| protein disulfide-isomerase [Vibrio harveyi ATCC BAA-1116]
    MNKKVLFIPLVAFMVLAGIFATQLVRNQEGDDPTKLESVLVGKPVPEFHLEDLAEPGKQYDQSIFKGEPLLLNVWATWCP
    T
    CYAEHKYLNELAGKGVKIIGMNYKDDRNKAVGWLNGLGNPYLISLFDGSGMLGLDLGVYGAPETFIIDANGLIRYRHVG
    DVNPRNWAEKLEPLYTKLVEEAKQ

    >gi|156975451|ref|YP_001446358.1| hypothetical protein VIBHAR_03182 [Vibrio harveyi ATCC BAA-1116]
    MTITMFGIPNCDTIKKAKKWLEAENVAFDFHDYRKQGIDAAMVTEFCNALGWEQVLNKRGTTFRQLTQEQKDALNEENAI
    ALLVENPAMIKRPILKVEDQLHIGFKADQYATIFNS

    >gi|156975458|ref|YP_001446365.1| thioredoxin-dependent thiol peroxidase [Vibrio harveyi ATCC BAA-1116]
    MNTLTAGSPAPAFSLLDQDGNTVSLGDFKGKKVLFYFYPKAMTPGCTTQAKGLRDVKAELDAYNVVVLGVSIDPVKRLGK
    FIERDELNFTLLSDEDHAVADQFGVWGEKKFMGKVYDGLHRISFLINEEGVIEHVFNKFKTKDHHEVVVTYLKENA

    >gi|156975463|ref|YP_001446370.1| hypothetical protein VIBHAR_03194 [Vibrio harveyi ATCC BAA-1116]
    MEKTMSVVIYHNPRCSKSRQTLELLEQNGVTPEVVKYLDTPLNVEQLKALYAQLGFSSVREMMRTKEDIYKELALGDTSV
    TDGQLFDAMARNPKLFERPVVVANGKAKIGRPPEQVLEIL

    >gi|156975539|ref|YP_001446446.1| Na(+)-translocating NADH-quinone reductase subunit E [Vibrio harveyi ATCC BAA-1116]
    MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVYNLVLKENALVEGVDLSFLNF
    ITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVN
    CAIFGGVSFMVQRDYNFAESIVYGFGSGVGWMLAIVALAGI
    REKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGVQL

    >gi|156975540|ref|YP_001446447.1| Na(+)-translocating NADH-quinone reductase subunit D [Vibrio harveyi ATCC BAA-1116]
    MSSAQNIKKSIMAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVTFVTALSNFSVSLIRNHIPNSVRIIVQMAIIA
    SLVIVVDQVLKAYLYDISKQLSVFVGLIITN
    CIVMGRAEAFAMKSAPVPSLIDGIGNGLGYGFVLITVGFFRELFGSGKL
    FGMEVLPLVSNGGWYQPNGLMLLAPSAFFLIGFLIWVIRILKPEQVEAKE

    >gi|156975681|ref|YP_001446588.1| iron-sulfur cluster insertion protein ErpA [Vibrio harveyi ATCC BAA-1116]
    MREVFVSEVNVPLSFSDAAASRVKALIAEEENPALKLRVYITGGGCSGFQYGFTFDERVNEGDTTIVNSGVTLVVDPMSL
    QYLIGGVVDYTEGLEGARFFVNNPNATTTCGCGASFSV

    >gi|156975727|ref|YP_001446634.1| dihydrolipoamide dehydrogenase [Vibrio harveyi ATCC BAA-1116]
    MSKEIKAQVVVLGSGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVSKVIEEAKAMAEHGVVFGEPQ
    TDISKIRIWKEKVVNQLTGGLGGMAKMRNVTVVNGYGKFTSPNSILVEGEGESTTVNFDNAIIAAGSRPIKLPFIPHEDP
    RIWDSTDALELKEVPEKLLIMGGGIIGLEMGTVYHSLGSKVDVVEMFDQVIPAADKDIVKVFTKRIKDKFKLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAERYDAVLVAIGRVPNGALIDAEKAGIEVDERGFINVDKQMRTNVPHIHAIGDVVGQPML
    AHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGKTEKEAKAEGINYEVATFPWAASGRAIASDCADGMTKLI
    FDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNKKAVKKKK

    >gi|156975991|ref|YP_001446897.1| alkyl hydroperoxide reductase, subunit F [Vibrio harveyi ATCC BAA-1116]
    MLDQAIQQQLKQYLANVKEEVRLVVSLDESKASNDILSLANQIAEMSDLITVERDENASARKPVMAVTNPAKGTALRFAG
    LPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKDLVVEIFISLS
    CQNCPDVVQAFNMMAAINPKVKATMIDGGLFQ
    DEVKQRDIMAVPSVFVNGELFGQGRMSLTEILNKVDDGASEKAAKALSEKDPYDVLVVGGGPGGSAAALYAARKGIRTGV
    VAKRFGGQVMDTMAIENFISVKRTEGPKLATDLAEHLKEYDVDVVTEQQAEKLMGAAHTEDGLIHIQLESGATLKSKSVI
    LSPGARWREMNVPGEQEYRNKGVAY
    CPHCDGPLFKGKKTAVIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLIDK
    ANSLPNVDIITMAQTTEVVGDGTRVTSLKYKDRNTDEIKEIELSGIFVQIGLVPNTEWLKDSEVALSERGEIEVGSRGDT
    SLEGVFAAGDATTIPYKQIIIAMGEGAKASLGAFDYLIRKQG

    >gi|156975992|ref|YP_001446898.1| alkyl hydroperoxide reductase c22 protein [Vibrio harveyi ATCC BAA-1116]
    MINTQIKPFAATAYKNGEFVEVTEQDVLGKWAVFFFYPADFTFVCPTELGDLADHYEELQKRGVEVYSVSTDTHFTHKAW
    HDSSDTIGKIQYYMLGDQTGNITNNFGVMREGQGLADRATFLIDPEGTIQAMEITAEGIGRDAEDLLRKVKAAQYVAAHP
    GEVCPAKWKEGEETLAPSLDLVGKI

    >gi|156975994|ref|YP_001446900.1| redox protein, regulator of disulfide bond formation [Vibrio harveyi ATCC BAA-1116]
    MTTLYKTQATALAGRNGQVKTDDGLLDLELSYPKEMGGTGAATNPEQLFAAGYSACFSNAILHVAREGKVNLKSAPVTAE
    VGIGPNDNGGFALTVSLAVELDMPQEQALELTRIAHQV
    CPYSNAVRGNIDVAVTVNGEAI

    >gi|156976090|ref|YP_001446996.1| hypothetical protein VIBHAR_04861 [Vibrio harveyi ATCC BAA-1116]
    MKFTRTLLTVAIALVPLFSHAAEKTSEEKLQEITQLLKENPQILDSLHQNLQDYVAYQKTFNATLDEARAYLNDGKHSYF
    GAENPELTIINVTDYS
    CPFCKRLEGELVKVEKEYPQVKVLNMTVSFKEQYEKNGYNSASYALNVWQNQHDKYKQVHDLLV
    KKPGPHDASSLQKIAKKTGTEAQLVDDKETKALLDKNYEYFTRLGLRGTPAIIINDQVIPGYVPFEELEKVIDQELKK

    >gi|156976408|ref|YP_001447314.1| hypothetical protein VIBHAR_05181 [Vibrio harveyi ATCC BAA-1116]
    MTHRNARSLHAIIGALVGDAASLGFHWLYDQELIRQFGSPHPEFHQPNRTEYHDKGYFAHGSKQVGDLTHYGAQLVAMLD
    ALVQTGHYDEARYIRSFREWFDFGGKWQGYTDKPTKQTLLIHELEAEELRVTLCGADDTQNPALSKIPPLVAFHSDDDKL
    AKLVDSAVRATNNNDTAVMYAQAIAVMIQLALQGVAPKACVMAAQTISSTIANDIKRAETMSGRSATSVAESVGMH
    CGLD
    ASFVVICHLLMNSESYETTMRENIYCGGDSSGRAIPLGAILGASYYDTPMSIPNHWMDRTALPRRLLQCL

    >gi|156976533|ref|YP_001447439.1| thiol:disulfide interchange protein DsbA [Vibrio harveyi ATCC BAA-1116]
    MNTAHMCLKESNMKKLFALCSTLLLAFTAHAAQFEVGKHYKVLDVEKAKKPTVTEFFSFYCPHCYKFESVIDNLKPALPK
    EASFEKVHVAFMGSDMAVPMAKSYATMVSLGVEKTMVPAMFAQIHQKRQVPQNEAELKQIFVDNGVDGKKFDAAYNSFAV
    DSMQKGFDKQFKQSTLTGVPGVVVNNKYIVLPNEIRSYDEYNDLVNYLLTL

    >gi|156976536|ref|YP_001447442.1| glutathione peroxidase [Vibrio harveyi ATCC BAA-1116]
    MKGITRNALIATLLSTSSMIFASSCPDILQGKQRLLNSTEEIALCDAFKGKTLLVVNTASQCGFTPQFEQLEQLHQTYKD
    QNFAVVGFPSNDFRQDRGSEEKTAKICYLDYGVTFPMMARTSVLGENANPVFAEITNQAGVTPKWNFYKFLINKDGKVVA
    TFPSSTSPTSTTLTNMIEQQL

    >gi|156976617|ref|YP_001447523.1| hypothetical protein VIBHAR_05391 [Vibrio harveyi ATCC BAA-1116]
    MFKTISKGAALFAAVFALTACDNGNSQPQQGKQYEVLPVSLAEYNLAPVTEVFSLNCGHCRTMEQFVPKIESLTEQKVEK
    MHVTFNESAQISAIIFYTAAMQVNGTPDKAFMEELFAAVQMGAEATADERQAAVEKAFESRNLVSPYQLDDAQQAKLFEY
    ITKAEQITTRGQINSVPAFIVNGKYQVITGGHETVEAMADTINYLLKQPK

    >gi|156976619|ref|YP_001447525.1| hypothetical protein VIBHAR_05393 [Vibrio harveyi ATCC BAA-1116]
    MKFIRWILGKIILLLNAVFSPRGVKRSAEAQKSVDDKAQNYALYQFEACPFCVKVRRAMKRQSVNIELRDAKNDPVHREA
    LEQGGGRVKVPCLRIEKDGETQWLYESSDIVAYIEKEFA

    >gi|156976914|ref|YP_001447820.1| thioredoxin 2 [Vibrio harveyi ATCC BAA-1116]
    MRLTGKSCFHEVVIKEEVMSSFKTRCPSCGGLNRVPNERVAEAASCGKCKNALFDGSPVEGTIDNFSVLLESNTPVVVDF
    WAPW
    CNPCVGFAPVFEDVAQEQTGNARFVKIDTEAQQQLAAQFGIRSIPTIMVFKNGQRVDMINGALPKTQFDQWLNQAL
    SK

    >gi|156976922|ref|YP_001447828.1| hypothetical protein VIBHAR_05707 [Vibrio harveyi ATCC BAA-1116]
    MSKIVIIGGVAGGASAAARARRLSEDAEIIMFERGPFVSFANCGLPYHIGGDIQERSKLLLQTPESFLARFSVDVRVMNE
    VVSINRQDKTVTVKNLLDGSEYQESYDFLLLSPGAGPVVPPIPGIDNPLTHSLRNIPDMDRIIKTIETNKVEHATVVGGG
    FIGLEMMEAFHQLGVKTTLVEMADQVMTPVDREMAGFAHAEIREKGIDLRLGVALSSVEYVANQSIANIEAGEDDTHQHL
    QGKLTLSLNNGDQLDTDILIMAIGVRPETKLAQEAGLQIGSLGGIYTNEYMQTSDPSIYAVGDAVEEKDFVTGEQTLVPL
    AGPANRQGRMAADNMLGRQETYQGTQGTAICKIFDLAVASTGKNEKQLKRDNITYEKVYVHTASHASYYPGAETVSFKML
    FDPATGKVLGAQAVGKDGVDKRIDVMAVAQRAGMTVEQLQHLELTYAPPYGSAKDVINQAAFVANNIMNGDATAIHFDEI
    DNLSENQVLLDVRNPGELESVGFIEGAINIPVDQLRQRMNELPKDKEIVIY
    CQVGLRGNVAYRQLVNSGFKARNLLGGYR
    TYKFARA

    >gi|156976924|ref|YP_001447830.1| hypothetical protein VIBHAR_05709 [Vibrio harveyi ATCC BAA-1116]
    MFEVPWVSLLGGVMVGASAVVLMLFNGKTAGISGILNGAVENADRVWRIVFLITMALGGVFAVYVLGGHVPTEYSGNLGL
    VVVAGLFVGVGTRIGNG
    CTSGHGICGMGRFSVRSVVATCTFMATAMLTVLLVS

    >gi|156977450|ref|YP_001448356.1| molybdopterin biosynthesis protein MoeB [Vibrio harveyi ATCC BAA-1116]
    MDILSDQEMLRYNRQIILRQFDFEGQEALKQASVLMLGAGGLGCASSQYLAIVELSNLQRQVLHHDADIGRKKVESAADA
    LRELNPHIIVDTIAKRLDDTELKSLIEQHTIVVDASDNVDTRNQLNRLCFATKTALISGAAIRMEGQVSVFTYDDPAQPC
    YQCLSALFGSGALS
    CVEAGVMAPVVGIVGAVQAMEAIKVISDYGQPKKGKILILDALSMSWREMNLMKMPTCPVCN

    >gi|156977465|ref|YP_001448371.1| thiosulfate sulfurtransferase SseA [Vibrio harveyi ATCC BAA-1116]
    MQALISTEELNSLLGQPNVKLLDASIAFQIPSEGEKVKDKWLPNSLRFDYDNDFCLPDSSLPHMMPTEEGFNQSAQQLGL
    NNEDLIVVYDNSGTLAAPRAWWMFRAMSHENVRVLNGGLPTWIKTGLPVTSALSQPSGKGNFSGKLNQEAFLSAQAVLAH
    SNNQSANIIDARAKARFLGEVPEPREGLRSGHIPNSVCLPFQEFLTNGHIKPNSELQQIFSSLTIDSDNSIIFS
    CGSGVT
    ACILLLAAYQIGLDNLSVYDGSWTEWGADHSLPIER

    >gi|156977505|ref|YP_001448411.1| hypothetical protein VIBHAR_06292 [Vibrio harveyi ATCC BAA-1116]
    MTQPIKITLYRWAGSWGPFKVNIPCGECTLTKDILADTFENELADVPVELEVKDWLSHWWEPLKLGAWHAPILVVEGKVV
    SQGEALNRGVLVQSVIAEWTKRDQLKGNIVYGKAT
    CPYCVKAKKLLDDAGIKYKYHDVVKDSAALYRMIPEVKAIIGEKT
    PVTVPQIWLDGQYIGGADNLEKWLAEKGLDNVPDNVVEIPSQTA

    >gi|156977540|ref|YP_001448446.1| hypothetical protein VIBHAR_06328 [Vibrio harveyi ATCC BAA-1116]
    MATSVKLKAGDSFPSLQATLLDGSSVTLGQPQGDATWQAVFVYRGKHCPLCTKYLNELEGYKQAFAEAGVDILAVSGDSK
    EQLEGHLEKLEISFPIAYGLTEEQMKTLGLYISLPRSEQETDHNFAEPGLFVVNEHGNLHVVDISNNPFVRPELGALSRG
    LAWIRNPDNNYPIRGTSDY

    >gi|156977635|ref|YP_001448541.1| peroxiredoxin [Vibrio harveyi ATCC BAA-1116]
    MIQQGQALPAATLSKLTADGMVNHQVTELFADKKVVLFAVPGAFTPTCSEAHLPGYVVLADQLKAKGVDLIACVSVNDAF
    VMQAWGEAQNASELLMLGDGDASFTKALGLEMDTGGFGGVRSQRYAMIIDNGVVTTLNVEEPTTFEASKAETILAAL

    >gi|156977709|ref|YP_001448615.1| glutaredoxin 2 [Vibrio harveyi ATCC BAA-1116]
    MKLYIYEHCPFSARVRYVAGMLNIQLDVINIAYDDDKTTTDLIGTKQVPLLIKDNGEAMAESLDIIAYFLELATSSETSQ
    PSQQALDWQKIAFLPLQKVGYPRWSNIDLPEFATQSAQQAWRAKKETDALNFDALLQDTPNIAKEVEALIERVKSVLNLD
    SYQHVALVDEAILFSILRGFFSAAEIQWDNTVKDWMESVSSKTQVPLLK

    >gi|156977798|ref|YP_001448704.1| methionine sulfoxide reductase A [Vibrio harveyi ATCC BAA-1116]
    MMEEIYFAGGCLWGVQEFMRHLPGVISTEAGRANGTTDNTQSEYDGYAERVKTQFDPEQVSVETLMGYLFEIIDPHSVNK
    QGEDVGEKYRTGVYSQNEQHLAIAKAFIAARPDAEKIAVEVLPLTNYVPSDDEHQDRITRFPNDYCHIPLGLLHKYKNQS


    >gi|156977818|ref|YP_001448724.1| hypothetical protein VIBHAR_06606 [Vibrio harveyi ATCC BAA-1116]
    MKKLLPIVFTCLSLAFTAPSVFASERAAQGWQWIEQGAMIVDVRTPQEFADGHLDNAVNFPLSELDKHFANVDKDTQIVL
    Y
    CRSGNRSGQAYQYLQSQGFTNLHNAGGLVEMQKSK

    >gi|156977865|ref|YP_001448771.1| hypothetical protein VIBHAR_06657 [Vibrio harveyi ATCC BAA-1116]
    MSQYVVCALYKFVELENYQELREPLLALMEAHGVHGTLLLASEGINGTVAAKREGIDTLLAWLNDEPRLNGIVYKESYSD
    TQPFNRTKVKLKKEIVTLGVEGIDPRHVVGTYVKPQDWNDLIADPEVFVVDTRNDYEIEIGTFKGAVNPNTDTFREFPDY
    VKQNMDPEKHKKVAMF
    CTGGIRCEKSTAYMKEQGFDEVYHLEGGILKYLEEVPEEESMWEGDCYVFDGRVAVNHQLEKAD
    YDLCNACRLPITEEDKRSEQFEQGVSCPKCFGKHSEEQVARFREREKQVSLAAVRGEQHVGGESAKQRQQRRAEKLAKKD
    VQRKQA

    >gi|156977898|ref|YP_001448804.1| peptide methionine sulfoxide reductase [Vibrio harveyi ATCC BAA-1116]
    MKKVSKLLVGFSFTLTVLFILLSKTGAADTMDKMNASGKTDIATLAGGCFWCTESDLEQLPGVLDVVSGYSGGDLENPTY
    RQVSSGKSGHIEVIEVKYDPAVVNYEQVLDYFFRHIDPTDAKGSFVDRGPQYRPAIFYHNAEQKQIAEQFMMEIDKAMIY
    PKPLKTELIEFEKFYPAESYHQDYYKKSSLKYKYYRYASGRDKYLDEVFGDDRKDNPKTLRELINEKELVSKVKVYEKPS
    DKEIKAKLTELQYYVTQEEGTERPFNNKYWDNKEAGIYVDIVTGEPLFSSTDKYKSGTGWPSFTRPINPRYIVEKTDFKL
    VYPRTEIRSKFGDSHIGHVFKDGPKPTGLRY
    CMNSAAMEFVPVNKMASLGYGDYLFLFDK

    >gi|156978210|ref|YP_001449116.1| hypothetical protein VIBHAR_07015 [Vibrio harveyi ATCC BAA-1116]
    MDNSPLNGIKLDDLAAYTQVITEDATQAISEYGIVAEWKGGVHSEIRTLNQKVGGKEILKDFSFEVGEPEELLGNNAYPT
    PQDYLLGGMAG
    CMMVGFVAGASARGIKLDAVKLTIKGALDLRGFLNVSEEAPVGFDEIQFQFEVKGEGTQADYDEVIASV
    QQFSPNYRTISDAVKVSAIVA

    >gi|156975237|ref|YP_001446144.1| electron transport complex protein RnfC [Vibrio harveyi ATCC BAA-1116]
    MLSLIEQIRTGSLWDFPGGVHPAENKKQSNKTELVHAAIPSEIVLPLKQHIGKAGNLLIAVGDTVLKGQQLTASDSGFTV
    PVHAPTSGQITAIEPRTVAHPSGLSELCAVMTPDGNDTWCEKTPVADYTQESADALIDVIRLAGISGMGGAGFPTAKKIQ
    SGIARTEILIVNAAECEPYITADDKLMQEHADELIQGIEIVEHILKPKLTIIGIEDNKPAAIKALEQAAMNKDIVIRVIP
    TKYPSGGEKQLIKILTNKEVPSGAIPADIGILVQNVGSLYSIKRAVIDGEPVVNRIVTLTGKTFKQPRNVWTLLGTPVQA
    LLDEFGYKADKKLQRLIMGGPMMGFTLPHAQVPITKTAN
    CILAPKRREIASDQYEMECIRCSQCAEACPASLLPQQLQWY
    AKSQEYEKLEELNLKDCIECGACAFVCPSEIPLVQYYRQAKAEIRTRAQEAAAAERAKLRFEEKKARMEREKAERENRFK
    KAADDRRKDMKASGGDDAIAAAIARVKAQKDNAEAKAEPAVKPAVAAAIAKAKAKQAAAAQSGAAEPDNSEMAKLREERK
    RIARERKAAKEQDDTSADNADDKKSAVAAAIARAKAKKAQQEDASTPTEAGDKKAAIAAAIARAKAKKAQQEDSTESVET
    EAPVKQAEDPKKAAVAAAISRAKARKAQQEGSTESEETEAPAKQAEDPKKAAVAAAIARAKARKAQQEGSTESLETDAPA
    EPAEDPKKAAVAAAIARAKARKAQQESQTEPVEAEAPSEEPEVDPKKAAVAAAIARAKARKAQQEAQTESVEAEAPSEEP
    EVDPKKAAVAAAIARAKARKAQQEAQTESVEAEAPSEEPEVDPKKAAVAAAIARAKARKAQQEAQTESVEAEAPSEEPEV
    DPKKAAVAAAIARAKARKAQQEANKNNTEENE

    >gi|156973302|ref|YP_001444209.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vibrio harveyi ATCC BAA-1116]
    MSNEMKILLANPRGFCAGVDRAISIVERALEMYQPPIYVRHEVVHNRFVVEGLKQRGAIFVEELHEVPDDNIVIFSAHGV
    SQAVRQEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRNMEVVLIGHAGHPEVEGTMGQYSSETGGMYLVETPADVEKLKSI
    VKDPSDLHYVSQTTLSVDETADVIEELRRVFPEIQGPRKDDICYATQNRQDAVRELSADVDVMVVVGSKNSSNSTRLKEL
    AEKLGTPGYLTDCPEDIKPEWFEGKVKVGVTAGASAPEELVNQILDRIKELVGAEAVDEVLGREENMFFEVPKELQIKQV
    D