Vibrio fischeri MJ11 uid58907

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|197334226|ref|YP_002154806.1| adenylyltransferase ThiF [Vibrio fischeri MJ11]
    MSNQLMEGLSDQDFLRYSRQIMLPDIGDKGQIALRNSTVLIIGCGGLGSSVGMYLSASGIGTLIIADGDNVELSNLQRQV
    VYRDNNLNQNKAMAMALQLKGLNGTTHIEVISHKLTEPELSRFINQVDVVLDCSDNLPTRHETNAACVKHNVPLISGAAI
    GWQGQLMLFSNQVTENNTSCYHCLFPFTESQQKQN
    CQSFGIVGPVVGMIGNLQALETIKYLTQPSYMKWDTIHQFDGRSL
    TWSSFKIPKDDQCSICASTVSNDVSRETYSKGETCHE

    >gi|197334006|ref|YP_002154826.1| thioredoxin [Vibrio fischeri MJ11]
    MSDKILQLTDGGFEESVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNAGTPPKFGIRGIPTLL
    LFKDGGVAATKVGALSKTQLKEFLDANL

    >gi|197333977|ref|YP_002155089.1| peptide-methionine (S)-S-oxide reductase [Vibrio fischeri MJ11]
    MTTKQPTSPPLHFISQRNLEFIPPNFEQIFFGMGCFWGAERLFWQLEGVYSTAVGYCGGATSHPTYKEVCTGTTNHTEVV
    KIIFDPTIISLDTLLHSFWQKHDPTEGMRQGNDIGSQYRSAIYTTSKEQLETAKQTQQQYQAALQKQGIMRAITTEVVPA
    QTFYFAEEYHQQYLAKNPDGYCGLKGTGVCFI

    >gi|197334791|ref|YP_002155205.1| thiol:disulfide interchange protein DsbC [Vibrio fischeri MJ11]
    MSFIRRTSAMIIALMSVVSFTACSDEQAQKQDALPSAVETAQPDSEQAITQRLTTLGLPVEAIHDSEVDGFKQVETPFGI
    FYVSSDGKHFIQGRIFEFDENGNMKDLLAARFAKLVDSQSDNMIVFPAKNEKHVITVFTDIT
    CGYCTKLHKEMKDYNDAG
    ITVRYLAYPRQGYQGSVADKMAQIWCADDKQQAMEDAKSNRPINGSKPATAECKNIIKEQYLLGRKMGVNGTPAIVLPSG
    DLVPGYKPARELLSDLER

    >gi|197335386|ref|YP_002155376.1| iron-sulfur cluster assembly protein IscA [Vibrio fischeri MJ11]
    MAISVTEAAASRVQKFLENRGKGVGLRLGVRTSGCSGMAYILEFVDELNEEDQVFEQFGVKIIIDPKSLAYMDGTELDFA
    KEGLNEGFKFNNPNVKSECGCGESFNV

    >gi|197336191|ref|YP_002155404.1| thiol:disulfide interchange protein DsbA [Vibrio fischeri MJ11]
    MKKLFVFLSAVMFAFSVQATQFEEGKYYQVLDVAKSTQPKVTEFFSFYCPHCYKFEAVIKNLKPALAKNVKFEKVHVAFM
    GNDMAVPMAKSYATMVVLGVEDKMVPAMFKQIHELGQRPKNEDELRQLFINNGIDPDKYDEAYNGAAVNAMQRKFDIQFE
    ASTLTGVPGVLVNNKYIVKPNAIRSYDEYNQLVNYLLTL

    >gi|197334938|ref|YP_002155491.1| NADH:ubiquinone oxidoreductase, D subunit [Vibrio fischeri MJ11]
    MASAKDIKKSILAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVMFVTALSNLFVSLIRNHMPNSVRIIVQMAIIA
    SLVIVVDQVLKAYLYDISKQLSVFVSLIITN
    CIVMGRAEAFAMKSAPFPSFIDGIGNGLGYGFVLMTVAFFRELLGSGKL
    FGVEVLPLVSNGGWYQPNGLMLLAPSAFFLIGFMIWAIRILKPEQVEAKE

    >gi|197334468|ref|YP_002155492.1| NADH:ubiquinone oxidoreductase, E subunit [Vibrio fischeri MJ11]
    MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVYTYLLKENALVAGVDLTFLSF
    ITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVN
    CAIFGGVSFMVQRDYNFAESVVYGFGSGIGWMLAIVALAGI
    REKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGVQL

    >gi|197336113|ref|YP_002155542.1| copper-transporting P-type ATPase [Vibrio fischeri MJ11]
    MSQEFNLPLAGLNCGRCIAKIEKAFADNPHIQQYSVTKTDTKLTTSLSYQEVVKLITELGYSVPKAQDVTLYLSGLNCGK
    CVNKTKEALSGLSHSSITSISTTLLKLETTHSQQHIIDLIESIGFHASSVSPASDNQEEQTSLSDSSKTDNISHSSEKTT
    QLILSGMT
    CASCVSSVEKIIAQNKNVHSVTVNLAERTALVHGDIDVPTLIKSIEDGGYGAELSVSEEQRRVRQKEQFLKI
    TSEHKRNTILSLSIGAPLMLWGVFGGNMQISNTHDQLAWGVIGFICLGLLLTAGRHFFVNAWKAFTHHRATMDTLVALGT
    GSAWLYSMALVLFPEFFPEQARHVYFEATAMILGLITLGNLIETKARNRTSNAIEKLINLQPQTATVIIDSQEVTLPVAQ
    VVEGMVIKIKPGEKIPVDGTILSGESYLDEAMLTGEPIPSLKSLGNAVHAGTINQQGSFTFKATKVGEHTMLARIITMVR
    NAQSSKPKLAKLADKISSIFVPSVMIIAILSALIWYNFGPEPTSSYMLVVATTVLIIACPCALGLATPMSVTVGIGKAAE
    FGALIKDADVLQTASTIDTVVVDKTGTLTEGKPRVNHVTLFNQYDEKEVISLAAAVETHSEHPLALAVVNYLNDNHWIPL
    TSTNFTAELGLGASAIVNGNLIFIGNHRYLTKNNIPTPDVSISPSATPLYVANEQECIGVIQVSDAIRLDSKAAIKQFNQ
    LGIDVVMLTGDRKETAEHVAEELEINQIIAGVLPDGKAQAIQELQKQGKKVAMIGDGINDAPALAQAEVGIAMGNGSDVA
    IESAHLTLMNHSLLTAVNAITLSKATMKNMKQNLFGAFIYNTIGIPIAAGILFPFTGMLLSPVVAGAAMALSSITVVTNA
    NRLRLFTPQPQQK

    >gi|197335915|ref|YP_002155652.1| glutaredoxin, GrxA family [Vibrio fischeri MJ11]
    MFVVIFGRPGCPFCVRAKEHAETLTEKRDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFIDEKHIGGCTEFEAYAK
    ENLGLFD

    >gi|197334553|ref|YP_002155664.1| thioredoxin-disulfide reductase [Vibrio fischeri MJ11]
    MSNVKHSKLLILGSGPAGYTAAVYAARANLNPVMITGMQQGGQLTTTTEVENWPGGAADMTGPGLMEEMKAHAERFNTEI
    IFDHINETDFSQRPFRLKGDSCEYTCDALIISTGASAKYLGLESEEAFKGRGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIAAEVHLIHRRDSFRSEKILIDRLMDKVENGNIILHTDRTLEEVLGDDMGVTGVRLKDTKSDATENLEVMGAF
    IAIGHQPNTAIFNGQLDMENGYIKVKSGLEGNATQTSVEGIFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDALEAKE
    S

    >gi|197335773|ref|YP_002155671.1| thioredoxin-2 [Vibrio fischeri MJ11]
    MSQFQTRCPSCHGLNRLPTERINDGATCGRCKEPLLDGKPVEGTMDNLAALLNSDKAVVIDFWAPWCNPCVGFSPVFEDV
    AAERNGQIRCIKVNTEAEQQIAAQYQIRSIPTIMVFKNGQRVDMINGALPKGQFDQWLNQALLK

    >gi|197335937|ref|YP_002155676.1| methionine-R-sulfoxide reductase [Vibrio fischeri MJ11]
    METPKTFLEYTDEEWRKKLTKEEFDICRKQGTEAPFSGTLLHNKEKGYYACTCCQTILFVSDNKYDSGCGWPSFDAPVND
    QVIRYIEDNSHGMRRIEIRCRHCDSHLGHVFDDGPKTTNERY
    CVNSVSLNFSQDK

    >gi|197335571|ref|YP_002155685.1| putative glutaredoxin family protein [Vibrio fischeri MJ11]
    METIDKIKQQISENHILLYMKGSPKLPSCGFSSQAAQALMNCGEKFAYVDILQNPDIRAELPAYAQWPTFPQLWVEGELV
    GGCDIIIEMFQKGELQPLIKEAAERNAPAAE

    >gi|197334384|ref|YP_002155693.1| electron transport complex protein RnfE [Vibrio fischeri MJ11]
    MASHKELIKNGLWDNNPALVQLLGLCPLLAVSATVTNALGLGIATILVLVGSNLIVSLVRQWIPQEVRIPVFVMIIASLV
    TCVQLLMNAYAYGLYLSLGIFIPLIVTN
    CIIIGRAESFASKNDPLPAVLDGLWMGMGMTAVLVLLGAMREILGNGTLFDG
    ADLLLGDWATILRIELFHVDSHFLLAMLPPGAFLGVGFLIALKNVIDKKMADRQPKEKAEIERVRIS

    >gi|197335244|ref|YP_002155698.1| na+-translocating NADH-quinone reductase subunit e [Vibrio fischeri MJ11]
    MGVSKKLESAIGMGLATTFVLTLASVCSYLVETYILSPLGIEYLRTMSFILVIAVVVQFTEMVVHKTSPTLYRVLGIFLP
    LITTN
    CAVLGVALLNVTENHNFVESIIYGFGAAVGFSLVLILFSAMRERIAAADVPLPFKGASIAMITAGLMSLAFMGFT
    GLVKL

    >gi|197335133|ref|YP_002155893.1| SAM-dependent methyltransferase [Vibrio fischeri MJ11]
    MSSMYTTFAEQYDTAVQDNIYNAHLERPSLQAIIGDVSECDVIDLGCGSGVYADYLIKGGASKLTCIDYSPEMVEIVKRK
    FGDRISAYAQDASIGLIKEESESADLIISPLMIHYLEDLSVLFNDVARVLKNGGSFAFSTHHPFADFE
    CSLSGNYFEREL
    ITEMWDTVGEPLEVRFYRRSLTELIEAITKSGLVVTQVSEGKVSEVVKDMSPEHYDYLSKNPNFIFIKCQKLA

    >gi|197334577|ref|YP_002156060.1| glutaredoxin [Vibrio fischeri MJ11]
    MKPIKITLYRWAGSWGPFKVNIPCGECTLTKDILEDTFNTELDGIPIELEVKDWLSYWWEPLKLKAWHAPIIIVEDKVIS
    QGEALNRGVLVQAVIAQVAKHDDIKGNVVFGKAT
    CPYCIKAKAALDEAGVEYTYHDVVKDSAALYRMIPEVKAIIGEKTP
    VTVPQIWLDGKYVGGFDDLSKQMNTDVKAGH

    >gi|197334294|ref|YP_002156101.1| copper-translocating P-type ATPase [Vibrio fischeri MJ11]
    MSKECYHCNEPVPSGSNFHVDILGETRDMCCPGCESVAQTIVENGLSSYYQYRTAPADKADLIPEQLKALTHYDHEEIQK
    EFVRTNDNYREVTLSLDGVS
    CAACAWLIEKQLSAAKGIHQIKVNTSTHRALLSWNPEETELSSLLTLIHQLGYKAAPFEA
    DKQEEEYHRSMKQYLYRLGIAGLATMQVMMLAVALYLEVFGDLDEEFRNYLRYVSLVFATPVMLYSALPFYMNAWRSLKA
    RTLGMDVPVSIAMLFAYFASVVATVTETGEVFFESVAMFTFFLLLGRFLEMRARRKAAAITGNLLKLIPVMATLSSGKRV
    PARTLDIDDIVVVPPGEHLPADGIVISGTSAIDESMFTGESMPIAKSESDAVYAGTINGDGNLTIKVTKTKADSLISNIV
    KLQDEAQMSKPKVAEIADLVARYFVAGILIISAFTWFYWHETKPDDAFWIMLSVLVATCPCALSLATPTAITCSTSRLAQ
    FGLMLRRGHVLETLCKVNRLVIDKTGTLTEGNIRLVKVNTFTNTTEEECKALAAELESFANHPIAQAFSSFRKSKTTYFE
    RVENVIGSGLIGYHNNSEWKIGHKTFAAPSAQIADEDNYQVWLSKDNQAVAAFSLDDPIRKESKEFIDALHKLGIKITML
    TGDSSSSVSKVANELDIDTVVSGASPQGKLEYLTSLPEHEISLMVGDGINDAPTLAGAHLSIAMGSGTDVAKASADMILL
    GDQLTRLIDARELAMKTRKIIRENLAWALGYNAIILPLAVMGLVAPYIAVIGMSGSSIIVVTNSLRLLKENG

    >gi|197334751|ref|YP_002156184.1| stringent starvation protein A [Vibrio fischeri MJ11]
    MIIPTLYSLRQCPYAMRARLAILYAGQTVVLRDVDMMNKPKEMLSISPKGTVPVLHFEDTVIEESVDVMLWALTQSDPRN
    LLYHHDLLQLPLMLDLIQKSDSEFVQILQKYRAASRYHDDNEIEYRAKCVEWLSDIEERLSKHAFIMGESASIVDYALLP
    FIRQFSRVDKKWYNIAPLPHLRAWLVRHYNDPIFSKAMTIYPKWNRDAEPVIFG

    >gi|197336317|ref|YP_002156188.1| 3-mercaptopyruvate sulfurtransferase [Vibrio fischeri MJ11]
    MNQLLADNPLVTTEWLAEHINDTNLVIVDAYMANIVGKEPIVYDEFCCLPKSRKLDVELDFCDHASSQIHALPTESQFTK
    AVQELGINSDSIVVIYDNQGIYSSPRAWWTFKVMGVEHVYVLDGGLPKWQEEKREVVTSYQQIPSLGNAVAKPNRHLACD
    SDEILHVIDTDAVILDARGEMRFLGKAAEPREGVRSGHIPSSKNLPFAMLLDNTTFKNKEILNSIFQERVPSNITKVFFS
    CGSGITACILILAAVSIGYKNVVLYDGSWADWGSNHNLPIE

    >gi|197334438|ref|YP_002156308.1| glutaredoxin [Vibrio fischeri MJ11]
    MLNTHQTIIFSKTVCPFCVKAKAILDDKGIEYKVLTLDEDLTKEEMVALIQEKENIAVNTVPQIYLDRKYIGGHDDLVAF
    FERQDTDMDLGDFEL

    >gi|197335393|ref|YP_002156335.1| cadmium-translocating P-type ATPase [Vibrio fischeri MJ11]
    MCTTHKSTHSHDHKHNPSSSCCATPKISTIKAESATTDCCSGVDKPTSSDSCCGSDPGESDPLVVIPQVSEKGTLSRSWL
    ISEMD
    CPSCAAKLKKAILAIPDVVDANVVFATEKLTVRTKDESVFDVVESVARTTGFPLTDMNAKNASENVAQPFWKKNA
    LLLLLVAFLVIATGINIVNKELGTIAFTVAGLFGLIPIGRKAIRLAKNGSPFSIETLMTVAAIGAVYLGETVEAAMVILL
    FMLGEQLEGYASAKARSGVKALMDLVPDTALRINSDGTKEEVPASELNVGDRVQVSPGDRLAADAILLSEFASFDESALT
    GESVPVDKKANDPLMAGSIVNDRVIEIQITSAQGENAIDRILHLIEEAESRKAPLERFLDKFSRWYTPAMMVLSLLVIII
    PPLMFGQSWDTWIYRGLAMLLIACPCALVISTPAAITSGLATAAKRGALIKGGAALEELGHIQNIAFDKTGTLTQGKPIL
    TDIRVLTETETEESILLQSAAVEMGSSHPLARAVVVRAQEQGLTVIEADNRETVVGKGIKGTVNDQHIELYAPQQFDGEV
    IPEIESQIAFLEQQGKTVVLVLINEQISGLLAWRDELRADAKMAVEKLVKLGIKPIMLTGDNERAAKAIAAELNIDYKAG
    LLPSDKVKYVEQLTANAKTAMVGDGINDAPAMKTASIGIAMGGGTDVALETADAALTHNRLEELAPMVALSKATLSNIRQ
    NITLALGLKAVFLVTSLFGITGLWVAVLADSGATALVTLNALRLLRFKEKE

    >gi|197335159|ref|YP_002156363.1| thiol:disulfide interchange protein TlpA [Vibrio fischeri MJ11]
    MKQIVKVLTAIILCIAVFFVLLSGLETKESSGSTAMVGEMVPAFKLSDLTEASTHVTEAHFYNEPLTLLNVWAAWCGICK
    TEHQFLHQLKDQGIPIIGLDYRDDRSAAKHVLEQTGNPYQSVIYDPQGILAMDLGVYGTPTTFLINQQGEILHRFTGALN
    EEKWQREFAGFFEEK

    >gi|197334638|ref|YP_002156400.1| glutaredoxin, GrxB family [Vibrio fischeri MJ11]
    MKLFIFDHCPFCMKAKMVAGIKKLPVEFVYLQNDDVNARIEKVGANMVPILEKNDGSYMAESLDIARYLDEHDHHPIIEK
    STHEEEISEWLNTARPLFAKLTFSRWTQLDLPEFARSEAITWFTEKKEEFIEMSFEQALANSNEYINALNPLLVNASFIT
    LPSEKGNQITWDDINFFPFIRNLTVVKGLDFPPHLKNYLEEISELTGVHLFFDVAV

    >gi|197335184|ref|YP_002156426.1| molybdopterin synthase sulfurylase MoeB [Vibrio fischeri MJ11]
    MSELTDNEMLRYNRQIILRNFDFDGQEALKASSILIIGAGGLGCASSQYLAAAGVGTLTLVDDDCVELSNLQRQVLHCDE
    TIGVKKVVSAKMALNRINPNCHINTVDKRLSDDELRSLIASHDLVLDGTDNVDTRNQLNRLCHESKTPLVSGAAIRMEGQ
    VSVYTYQDDEPCYQCLSSLFGQQALT
    CVEAGVMSPVVGIIGSVQALEAIKVLANYGQPLISKLLILDALSMNWREMKLAK
    MPNCSVCGH

    >gi|197334728|ref|YP_002156456.1| oxido-reductase [Vibrio fischeri MJ11]
    MQALNHFSRIRLSWFLLLLCIIFFEASALTFQHIMKLPPCVMCIYERVAMMGIGGAAIIGLLNPNNLIIRWCGFIAWGIS
    AGWGLKLALEHVDFQLNPSPFST
    CDLFVTFPSWAPLNKWAPWMFEAYGDCSKIVWQFLTLTMPQWLVIIFAGNLIALAIF
    VIAQFFNKK

    >gi|197334649|ref|YP_002156591.1| protein VV1_0039 [Vibrio fischeri MJ11]
    MSFWNSLSITTRYSRLPRCFFTYVQPTPLDNSRWLIWNSELAKQFDLPENVHNHSELLDAFSGEVVPSVFAPLAMKYAGH
    QFGSYNPDLGDGRGLLLAEIKDKKGNSFDLHLKGAGLTPYSRSGDGRAVLRSTIREYLCSEAMAGLGIPTTRALGMMTSD
    TPVFREGYETGALLIRMAETHIRFGHFEHLFYSNLLEELKLLSDKVIEWHFPCCLGEDKPYLAMFNNIVDRTAYMIAQWQ
    AVGFAHGVMNTDNMSIIGQTFDYGPFGFLDDYEPGYICNHSDYQGRYAFNQQPRIGLWNLSALAHSLSPLIDKSDLEKAL
    EQYEIKLHDYFSQLMRKKLGLLSKQEGDTRLFESMFELLSQNTVDYTRFMRVLSDLDSQDKQTVIDLFVDREAATLWVDL
    YLTRCKLEADSFDMRCSKMRKVNPKYVLRNYLAQQAIVKANEGDFSDVKILSTLLASPFDEHPDFERYAELPPEWGKRME
    IS
    CSS

    >gi|197336296|ref|YP_002156645.1| thiol:disulfide interchange protein TlpA [Vibrio fischeri MJ11]
    MNKNFLFAPLALFLILVAVFATQLTRNSNGDDPTKLESVLVGKSVPEFRLEDLAQEGKLYDQSIFKGEPLLLNVWATWCP
    T
    CYAEHQYLNTLATEGVKIIGMNYKDDRAGAVQWLKELGNPYLITLFDGDGMLGMDLGVYGAPETFLIDSNGIVRYRHVG
    DVNERNWNETLKPMYDKLVAEAK

    >gi|197335426|ref|YP_002156741.1| arsenate reductase [Vibrio fischeri MJ11]
    MTTIYGIKNCDTIKKCKKWLEANNINFTYHDYRTDGIDKEMVTTFVKQLGWENVLNKRGTTYRQLTDEQKASLNEETAIE
    LLLEMPAMIKRPVLIHNNEYHLGFKPAQYETLFDI

    >gi|197335629|ref|YP_002156748.1| bacterioferritin comigratory protein [Vibrio fischeri MJ11]
    MITPLAAGSTAPNVSLLDQNGESVSISDFKGKKVLFYFYPKAMTPGCTVQAQGLRDIKSELEAHNVVTLGVSIDAVKRLG
    KFIERDNLNFTLLSDEDHAAADAFGVWGEKKFMGKVYDGLHRISFLINEEGVIEHVFTKFKTKDHHEVVLDYLNNK

    >gi|197335838|ref|YP_002156752.1| arsenate reductase [Vibrio fischeri MJ11]
    MSVVIYHNPRCSKSRETLSLLEEKGVTPEIVKYLDETPSIDTLKTIFSQLGFSSVRDMMRTKEAEYKDQGLAEASITDEQ
    LFEAMVATPKLIERPIVTNNSQARIGRPPEQVLEIL

    >gi|197335544|ref|YP_002156803.1| peroxiredoxin-2 [Vibrio fischeri MJ11]
    MVLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLEDFQAKGVEVIGVSIDSQF
    SHNAWRNTAIEDGGIGQVKYPLVADVKHEICKAYDVDHPEAGVAFRGSFLIDADGLVRHQVVNDLPLGRNIDEMLRMVDA
    LNFHEKNGEVCPAQWEEGKAGMDASPKGVASFLSEHADDLSK

    >gi|197334760|ref|YP_002156861.1| YeeE/YedE [Vibrio fischeri MJ11]
    MTIPWFSLFGGMLLGVSATLLLLLNGKIAGISGVLTGLMTPKKKDYAWRWLFVLGMISGGFAGVYFLGAYVPIEYTTSTP
    MLIIAGLLVGIGTRLGNG
    CTSGHGICGIGRLSVRSIVATCVFMLVAGITVFVRLHIL

    >gi|197334283|ref|YP_002156862.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Vibrio fischeri MJ11]
    MTKIVIIGGVAGGASAAARARRLSEDAQIIMLERGPFVSFANCGLPYHIGGNIKDRDNLLLQTPDSFLARFNVDVRVMNE
    VISINRSEKTITIKNLVDNTEYQESYDFLLLSPGAGPIVPPIPGINNSLTFSLRNVPDMDRIIASIKDNKPQHATVVGGG
    FIGLEMMEAFHQLGIKTTLLELADQVMTPVDREMAGFVHKEIKDKGIDLRLGSALQEVVETETGLTLSLSTGEALDTNLL
    IMAIGVKPETKLANEAGLQLGELGGIYTNDQLQTSDPFIYAVGDAIEEKDFVTGNQTLVPLAGPANRQGRMAADNMLGRN
    ESYQGTQGTAICKVFDLAIASTGKNEKTLKREGISYEKVFVHTASHASYYPGAEIVSFKLLFSPETRKILGAQAVGKDGI
    DKRIDVMAVAQRAGMTVDQLEHLELTYAPPFGSAKDVINQAAFVANNLIKGDTKAIHFDEVEHLNENQILLDVRNPAELI
    NVGYIKGAMNIPVDQLRQRLHELPKDKEIIIY
    CQVGLRGNVAYRQLVNNGFKARNLIGGYRTYSFANA

    >gi|197334736|ref|YP_002156933.1| iron-binding protein ErpA [Vibrio fischeri MJ11]
    MSDVSVPLTFSDVAAAKVKTLIAEEENPNLKLRVYITGGGCSGFQYGFTFDEDVNEGDMTIENDGVTLVVDPMSLQYLIG
    GKVDYTEGLEGSRFFIDNPNATTTCGCGASFSV

    >gi|197335370|ref|YP_002156976.1| dihydrolipoyl dehydrogenase [Vibrio fischeri MJ11]
    MSKQVKAQVVVLGSGPAGYSAAFRCADLGLETVLIERYSTLGGVCLNVGCIPSKALLHVSKVIEEAKAMAEHGVVFGEPQ
    TDINKIRIWKDKVVTQLTGGLGGMAKMRNVTVVNGYGKFTGPNTIEVEGEENTTVTFDNAIIAAGSRPIKLPFIPHEDPR
    IWDSTDALELKEVPEKLLIMGGGIIGLEMGTVYHSLGSKVEVVEMFDQVIPAADKDIVKVYTKRIKDKFKLMLETKVTAV
    EAKEDGIYVSMEGKKAPAEAERYDAVLVAIGRVPNGKLIDAEKAGIEVDERGFINVDKQMRTNVAHIHAIGDVVGQPMLA
    HKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGKTEKEAKEEGLNFEVATFPWAASGRAIASDCADGMTKLIF
    DKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNKKAVKKKK

    >gi|197334763|ref|YP_002157095.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase) [Vibrio fischeri MJ11]
    MFTSKEGQSVPQVTFPTRQGDAWVNVTTEELFKDKTVIVFSLPGAFTPTCSSSHLPRYNELHSVFKENGVDDILCVSVND
    TFVMNAWKADQEAENITFIPDGNGEFTDGMGMLVEKNDLGFGKRSWRYSMLVKNGVVEKMFIEEDVPGDPFKVSDADTML
    NYLAPEHKEQESITVFTKPG
    CPFCMKAKQNLIDKGLNYEEVVLGKDATTVSLRAITGRTTVPQVFIGGKHIGGSEELEAF
    LA

    >gi|197334320|ref|YP_002157096.1| dihydrolipoamide dehydrogenase [Vibrio fischeri MJ11]
    MKQVNVDVAVIGGGTAGLGSYRAAKAHTDSVVMIEGGPYGTTCARVGCMPSKLLIAAAESVHQIEKAPKFGIHPQGEIVI
    NGREVMERVKFERDRFVGFVLEGVDEIPAEDKISGYAKFLDDNTLQVDDHTIINAKRIVIATGSRPAYPAVWNELGDRLI
    INDDVFNWDDLPKSVAVFGPGVIGLELGQSLHRLGVETKLFGLGGQVGPVTDPEVMAYANKAFNEEFYLDADVKVESMKR
    ITTESGEDRVEIQFINKQGELETNIVEYVLAATGRRPNTDKLGLENTSIELDERGVPTADFYTLQTSLPTVFIAGDASNQ
    LPLLHEAADQARIAGDNAGRFPEIRAGLRRSKISAVFSDPQIAMVGETYKEITTRLGTCGCFATGEVSFENQGRSRVMLR
    NKGILHVYGEQGTGRFLGAEMMGPNAEHLAHLLAWAHQNKMTVSEMLDMPFYHPVIEEGVRTALRDLNAKLHLGPEMIKH
    CMDCGPGC

    >gi|197334698|ref|YP_002157145.1| sulfurtransferase [Vibrio fischeri MJ11]
    MVTEPICGIELSKTSEIKNMETSIIDFVSNNMILAVVWIGIVVALIQNVVKQKTAGYQEVDPAQATTLMNREDAIVLDIR
    SKDEFKSGHITDARHILPSDIKAGNLSGLENSKTTPIIVV
    CKTGQTAQAAANDLHKAGFEQVKLLKNGLISWNEANLPLV
    KGKK

    >gi|197335107|ref|YP_002157151.1| thiol:disulfide interchange protein DsbD [Vibrio fischeri MJ11]
    MTHLYRFRTALLSLFLLFTTLVPHANAAFDLTKLQGSQDSSFVTVNEAFPFNFMQQGDRVYLDWQVKPDYYLYQQRISVK
    ANGAEIADLVMEDGTPHNDEFFGDVNIYTEPLTITVPLVSVGDNAELIVRYQGCAKAGFCYPPEIRKIPLSELSAPSSYQ
    NEVAKTDVVAKSENAPVGIKTSVQPTPETPKTQTQQQELATNLGDAWWTPFLFLALGIGLAFTPCVLPMYPILTGIVLGG
    GKLSHGKAFKLSFVYVQGMALTYTLLGLVVASAGLQFQAALQHPYVLIGLSILFVLLALSMFGAYTIQLPSSIQTKLNDI
    SNQQQGGNLGGVFAMGAISGLVCSPCTTAPLSGALLYVAKSGDLLTGAIALYALAIGMGIPLILAAVFGNKLLPKAGVWM
    THVKTLFGFILLAVPVFLLERILPHDVTPFVWSALGISAFGWLYHVKATMPQSWKTSIVGIVAILGIVGSAIPLIDAISG
    KSNTEIATNTQTVTFKKITNINELNQELEIAKAQGKPVMLDFYADW
    CVACKEFEKYTFHNEKVEPVLSEFVLLQADVTKN
    SPTDIELLQQLKVLGLPTIDFWNANGEYLSDSRLTGFMKADPFMDHLSTNVINVK

    >gi|197336409|ref|YP_002157225.1| soluble pyridine nucleotide transhydrogenase (STH)(NAD(P)(+) transhydrogenase [B-specific]) [Vibrio fischeri MJ11]
    MTNSTPIRSTHFDAIVIGSGPGGEGAAMGLTKANLNVAIIEREPSVGGGCTHWGTIPSKALRHAVSRIIEFNSNPLYCKN
    NTSLHSTFSDILGHAKSVIDKQTRMRQGFYDRNQCSLIFGEASFVEKNTVAVTAKDGSIETYTADKFIIATGSRPYRPEG
    INFNHSRVYDSDSILSLKHDPRHIIIYGAGVIGSEYASIFRGLGVKVDLVNTRDRLLSFLDNEMSDALSYHFWNSGIVTR
    NDENFEHIEANNDGVIMHLESGKKMKADCILFANGRTGNTDKLNLSAVGLEADSRGQLKVNDNYQTDVEHIYAVGDVIGY
    PSLASAAYDQGRFTAQAITKGKAEARLIDHIPTGIYTIPEISSVGKTEQELTATKVPYEVGRSSFKHLARAQIAGKDIGS
    LKILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGEANTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|197336419|ref|YP_002157234.1| thiosulfate sulfurtransferase GlpE [Vibrio fischeri MJ11]
    MDQFQHISVVDAQEKLKQQDLNAVLVDIRDPQSFIRGHVENAFHLTNDTIVELMNEVDFEQPVLVMCYHGHSSQGAAQYL
    VNQGYEEVYSVDGGFEGWHKAGLPVEK

    >gi|197336410|ref|YP_002157276.1| glutathione-disulfide reductase [Vibrio fischeri MJ11]
    MTTHFDYICIGGGSGGIASANRASMYGAKVALIEAQDLGGTCVNVGCVPKKVMWHGAQVAEAINLYAEDYGFDVELKEFK
    WNKMIESRQAYIGRIHESYDRVLGNNKVTVIKGFARFVETESGDAKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGI
    DSNGFFELTEQPKRVAVIGAGYIAVEIAGVLHSLGTETHLFCRKESPLRSFDPMIIDTLVEVMNTEGPTLHTHSVPKEVV
    KEADGSLTLHLENGNTQNVDTLIWAIGRHPATDAINLDKTGVATNDRGYIKVDEYQETNVKGIYCVGDIMEGGIELTPVA
    VKAGRQLSERLFNGKTNAKMDYDLVPTVVFSHPPIGTIGLTEQEADEQYGKENVKVYTSGFTAMYTAVTKHRQPCKMKLV
    CAGEDEKVVGLHGIGFTVDEMIQGFAVAMKMGATKADFDAVVAIHPTGSEEFVTMR

    >gi|197336467|ref|YP_002157279.1| copper sensitivity protein ScsC [Vibrio fischeri MJ11]
    MKFKTKLITTLVMACLFSPLASAMTQSEKVEDINKMLKDNPTIIDSLHESLAMYIAQQGKYEKTLADYHDYMYNNPNLPW
    FGAKDPKLTIVVLTDLS
    CPWCKKLDPVLMKLVEEHPDDLKVINIYVPLKEGSNPANSATFALRVWKESPEKFNKISETLL
    SKPGIHNMRSIMKVAKANDAEKYVSTNDEVQDMVAKNYQLFTDLGVRGTPAMLIDGQLLPGYLPYEKLAPMVEAKIAEKS
    GK

    >gi|197336468|ref|YP_002157280.1| thiol:disulfide interchange protein TlpA [Vibrio fischeri MJ11]
    MGKRQKMKRWGKDTLIYLLVIIIFSFAVDAWRTKDMPANTAPALAGISTTGEAIDVIAMSQEKPVVVYFWATWCAACRFV
    TPTINWFSDTYQVVGVSTSSGEDRRVSGYMSSHDYTFKNMNDTRGDISREWGIRVTPTIVIIDKGEIKNITTGITTPVGL
    LARLWLI

    >gi|197336450|ref|YP_002157281.1| thiol:disulfide interchange protein DsbD [Vibrio fischeri MJ11]
    MQKSVMTTRMVLFGLFAMLCSAFISVAQAETPNTGWLKNQNHTPIETRFVLTGQINKVDQTVAGFLEVRLAGDWKTYWRS
    PGEGGIAPSMTWEDSKNIRSIDWYWPYPKRFDLLGIETLGYKGSVIFPMTLHIDDLNKPVTFKADLTLSSCTTICVLTDY
    PFELTFTPADLTLSKEAMHVYAQGLSQVPKESALISDVKAVWDATKMQLQVTASKKIGWITPDVLVDGLSDEMQDANFSR
    PKIDVDGNNITAIFDVSSWMGTPDLTGENISVTLKDSEFIAEQPASISDGIITSSNGLQSILKMILFALFGGLILNVMPC
    VFPVLGMKLSSVISAQGLEKKQIKLQFLASASGIVFSFWLLASFLVVLKLSGNAIGWGIQFQSAWFIGVMTLITALFGAN
    MLSLFEIRLSSNTNTWIASKGSNSYFGHFIQGMFATLLSTPCSAPFLGTAVAFALATNIPTMYGIFTALALGMALPWILV
    ALFPSIALSLPKPGPWMSKVKYLFGAMMLITSIWLLNLLSNHLSEFWIYVIAAISGGVILLRTVQVHSKKAAGWLSILFA
    IAFGFGTVIDSMTSTDLLPEEPKWVPLSSESIQQYVDEGKVVFVDVTADW
    CVTCKANKIGVLLQEPVYSELNSANVVPMQ
    GDWTVPSEKITSYLQEHGRFGVPFNVVYGPRAPNGIELPVILNEKVVMDAIKKAGNKP

    >gi|197333887|ref|YP_002157337.1| thiol:disulfide interchange protein DsbA [Vibrio fischeri MJ11]
    MMKKMMALFGALVLSFSVNAANFTEGDYYKVLDLPESKTPTVNEFFSFYCPHCNSFEPLIQGLKKTLPDNATFKKTHVSF
    MGGKMGLSMSKAYATMVSLGIEDKMVPVFFNRIHTMNKPPRNEKEIRQIFLDEGVNADEFDGTYNSFAINSMVNRFDKSF
    QDSGLTGVPALIVNNKYLVETGKIKSADEYYELVNWLLKK

    >gi|197336496|ref|YP_002157460.1| hypothetical protein VFMJ11_B0098 [Vibrio fischeri MJ11]
    MSDKKNCEKPTNSLNKVFIFCGVAMIGALIYNFQSTFYEPKDELNSKNLPVMVANQERFIASDAFDLLDEKGDKSITLSI
    EDLEAKLTTQFKRHVFLKNIKGTALYLAVIGDEMFFVDDTGSYLLDGRLLDLNNSLILSDLLQEEINSAQRHFTTLRSAR
    LKDVSSFVSSNQVKEVANIQLTQSSQELNKNKNNSTSLEDVTRKNDSPTETKAASISTQKSLDSKSQKVSFAELPMGLNQ
    EINIAPVLLNMASSLSSSDPLFSDKCLTVSLGANSYAEMYHLYQKMKSQDVRRKCGEVYASKLIPQLEDKDLIVYEAPNA
    TRSITILSDYT
    CQYCRKLHNETQQYLDAGVTVRVFPYGRASYMKGGELTAVGKNNSLALCQTPEKRGDVFDELLSNPTMY
    NTRVIGSEGVSVPSERCNQRSFIYKVLGDILTHKQTPIVISDEGHVARGYFPAQSLLSRWGML

    >gi|197337091|ref|YP_002157576.1| peptide methionine sulfoxide reductase MsrA/msrB [Vibrio fischeri MJ11]
    MKSRLKITTVALLFASFFAVITSFFSTAEDMTQPMKGDNEVATLAGGCFWCTESDLEKLDGVVDVVSGYSGGTLENPTYK
    QVSSGTSGHIEVIQVTFDPKVVSYEQILDHLFRHIDPTDNKGSFVDRGPQYRPAIFYHNEDQKVIAQNFMKDIDAAGVFP
    KPLATELIEYKTFWPAEAYHQDYYKRNPIRYKYYRHGSGRDKYLDSVFGEDREENPKTLRQYITEYEMAVNVKPYSKPSE
    SQIKKSLTELQYYVTQEEGTERPFDNAYWDNKAEGIYVDIVSGEPLFSSTDKYKSGTGWPSFTKPINKAYIVEEDDFQLF
    TKRTEIRSKFADSHLGHVFNDGPKPTGLRY
    CMNSAAMRFVAKADLEKEGYGEYLYLFN

    >gi|197337761|ref|YP_002157681.1| thiosulfate sulfurtransferase [Vibrio fischeri MJ11]
    MKKSTIAIGVLAAAVAIGYPTYKSMFSAPAFEISEQHLTEKFSHYAHPEHFIAAQDLKEMMDNGNNIVVIGALNPMKPDA
    PIEGSFTMWRDGYSAKDGTYEFDGMSNTTEEMEQILSSYGATPESTIVVYAATSHHDAARLFWQIEALGHNDIRYLDGGL
    NAWVGADLPTGNANPSVAQSDYQASQPAHQHTALATLDMVIEAQNNDEWVIIDTRGNDEFNGTTTVGGAFGPGTIPKSVH
    INWTKAVNEDTTLKSAEELQALYGNVIKGKKVIAY
    CQSGVRSAHTTMILQNVLGAEEVYNYDGSWIEYSHAHYEEKQPNV
    TVINGQI

    >gi|197336714|ref|YP_002157709.1| phage shock protein E [Vibrio fischeri MJ11]
    MKIKAGLCALLAMFSFNSWSSDRSEQAWEQVEQGALLIDVRTPGEFDQGHLDGATNYPLNTVDKAFAKIDKDTPIVVYCR
    SGARSGKAMSYLKQMGFKEVYNGGGLVEMQSTKPTP

    >gi|197337599|ref|YP_002157768.1| methylated-dna--protein-cysteine methyltransferase [Vibrio fischeri MJ11]
    MNVYTQFESPIGQITVNANDEGLLGVWYESHKMELSEFGTRADDHPILKLTVTQLKEYFRGDRRDFSIPLAAKGTEFQNK
    VWKALTTIPYGKTWCYKDLAIAVGNPKASQAVGGANGKNPISIIVP
    CHRVIGKNGSLTGYAGGVDIKEKLLALESNK

    >gi|197336953|ref|YP_002157842.1| putative formate dehydrogenase [Vibrio fischeri MJ11]
    MMKITIDKQTFTIDEEITLLAAAKECNVEIPSLCGNNINGEKVPCDLCVVEIEGQGIQRACETQAVDGMQVITSSEALVK
    RRQSALNKILSDHYADCEAPCQTACPAGVDIQSYLYHISQNDHQKAIEVIKRTLPMPLSIGRVCPAFCEAECRRGLVDEP
    LAIRQLKRHAADVDLHAQESYVPPKKADKGKSIAVIGSGPGGLTCGYYLTNEGYSVTAFESMPKAGGWLRYGIPEYRLPK
    SILDKEIELMCRNGMEIQTSVKLGEDFSLTQLSDEYDAVCLAVGASKAVEMHYQGSELGG
    CYLGVDYLKDYVTESKLTTG
    KKVAVIGGGNTAIDCARTAVRDGADTTLIYRRTREEMPAEDYEVVEAEHEGVKFHFLTNPVENIADENGRVTQVRLEKMA
    LGEPDASGRRSPQATGEFFIEEFDTVISAVSQKPDLSFLENDTIDLPLTRWNTADANSLTMHSGVKNIFSIGDFRRGPAT
    AIEAVADGRIAAEAIDRFFNGNMEKIPTKPFNSQKEKKTKQVDPRHFEHIQKAMRVIMPELTAEQREQSFDEVETGFDNL
    DAIREAERCLECACQANTNCGLRDYATEYKADETDLSNEGKQKFAIDTSSEFIVFDANRCISCGQCVEACNEKGVHGVLS
    FMKNEDGTNASRPECRAGFEHGYQMGNSNCVQCGACVQACPVGALVDSRDKSQGRIEVLKPVDTICTYCGVGCKLTMMVD
    ESTNKIKYVQGAKSSPVNEGMLCVKGRFGFDFVSSDERLKTPLIRKNGKLVPASWEEAITLVADKFSAIKSQHGGNALAG
    FSSAKTTNEDNYAFQKLVRREFETNNLDHCARL
    CHSTTVTGLEASIGSGAMTNDIPSIKHSDLIFIIGSDTTSAHPIIAS
    HIKQAIRHHGARLIVADPKQVDISDHAELYVAQRPGTDVMLLNGIMQQIIKNNWHDQTYIAERVEGFDELKAEVMSEAYS
    PEKIELITGVKAQDVIEMARYIGTAKRTAIYYSMGITQHTTGHDNVRSIANLQMLCGNIGIEGGGINPLRGQSNVQGACD
    MGALPTDFPGYQKVENPAVYEKFVKAWNKPTLPSKKGLTLTEIIDAACHEQVKGLFVMGENPVLSDPDQAHVIHGLEKLD
    FLVVQDIFMTETAAYADVILPSCSFAEKAGHFTNTERRVQRILPAVNPPGEAKEDWWIIQEIANAMGGEWNYQSVEDITE
    EITQVTPQYQGMHWDAIGKNGLQWPCNDANPQGTRIMHNQQFLRGKGQMAAVPFRYAAELPDEEYPLVLTTGRLLEQYHT
    GTMTRKTKGLNNLAGPRAMMSVADAERLGISNSEMVRVSTRRGTIEAPAFVTKRMQEGVIFVPFHFVEAAANKLTTTALD
    PHAKIPEFKVAAVKVEKVLQPEPEVCV

    >gi|197337039|ref|YP_002157917.1| thiol:disulfide interchange protein DsbD [Vibrio fischeri MJ11]
    MTLFFLSFFSVSAIAQPTDEIQSNNIFNIIGIALLGGLILNIMPCVLPVLGMKLSNMLALSSMNSQSIRLQFLASASGIL
    VSFWLLAFSVLILRITGGMIGWGIQYQNPLFIGFMAITMGLFTANLLGLFEIQLSHRFSTFIAQKGDNSTLGNFIQGMFA
    TLLATPCSAPFLGTAIAFALGASTLEMLLIFTFLGLGMALPWLFFAVFPHLISYMPKPGPWMDKVKIVFGLMMLSSTLWL
    LSLLSPFIGVLLTVIIALLFSIYLLYKIAHIHGKNTVITIIAVIIFLSSSILIVGSMTTKYWVTPTEDNLHWESLDERTI
    DDYVKQGKTVFVNVSADW
    CITCKTNKIGVILQNPIYPALQQENVITMQGDWTHPSHKITEYLKKYQRYGVPLTVVYGPNA
    PQGLTLPVLLDGDEVIHALNYAKGSSNQ

    >gi|197337004|ref|YP_002157928.1| osmotically inducible protein C [Vibrio fischeri MJ11]
    MTTLYTTKATALAGRNGQVKTDDNMLELALSYPKEMGGTGEATNPEQLFAAGYSACFSNAILHVAREMKIKLTQAPVTAE
    VGIGPNSAGGFALTVALAVVLDLEDQQAQQLVKTAHQV
    CPYSNAVKGNIDVKLSVNGVEL

    >gi|197337880|ref|YP_002158056.1| thiol-disulfide isomerase [Vibrio fischeri MJ11]
    MKSFIKPLLLILSSALFLTACSDNNDPKEGVQYEVLSTSLENDGMAPVTEVFALSCGHCRNMENFLPVISQEAGTDIGKM
    HITFNQSAHIASMFYYAAEMQVDGAPDHAFMEDLFAATQMGEGTTLTEQQEAYSKAFTSRGLVSPYDFNEEQRDILIKKV
    DNAKMLSEKSGISSVPTFVVNGKYNVLIGGHDDPKKIADTIRYLLEK

    >gi|197337077|ref|YP_002158496.1| glutathione S-transferase [Vibrio fischeri MJ11]
    MIKLISFKNCPFVQRVMGALVTKNVPFEIEYIELNNKPQWFLDIAPNGQVPVLITEDKTVLFESDAIVEYLDDKYAPIED
    ITPEQRAIDRAWSYQASKHYMPQCGTMGSKDKETFETRLANLSKAFAKAEGKLSDSLFFKGDYISNVDIAWLPLLHRAAV
    IKDQSGIDMLDGFPKVQKWQASLIESGLAEKTVPQDFVATFSGFYLKNTYLAHVMNGTEAECAEGRCSTDSSSCCN

    >gi|197337582|ref|YP_002158503.1| glutaredoxin 2 [Vibrio fischeri MJ11]
    MKVIRFVLGKVILGLDCVFSPSGVKRDPAKQTEIDAETAKYSLYQFEACPFCVKVRRTIKRQSLNIELRDAKNNEEHRAA
    LLAGGGRIKVPCLRIDNENGETQWMYESADIMSFLESKYP

    >gi|197337842|ref|YP_002158706.1| glutaredoxin [Vibrio fischeri MJ11]
    MKRVVLYVADKCPHCKEAQRYLDSKGIKYRLTNAKMQRGRKELEAIGARSVPVLKIGDQMMAGWNQKNFDKMYNS