Vibrio fischeri ES114 uid58163

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|59710641|ref|YP_203417.1| thiamin (thiazole moiety) biosynthesis protein [Vibrio fischeri ES114]
    MSNQLMEGLSDQDFLRYSRQIMLPDIGDKGQITLRNSTVLIIGCGGLGSSVGMYLSASGIGTLIIADGDKVELSNLQRQV
    VYRDNNLNQNKAMAMAHQLKGLNGTTHIEVISHKLTEPELSRFINQVDVVLDCSDNLPTRHETNAACVKHNVPLISGAAI
    GWQGQLMLFSNQVTENNTSCYHCLFPFTESQQTQN
    CQSFGIVGPVVGMIGNLQALETIKYLTQPSYMKWDTIHQFDGRSL
    AWSSIKIPKDSQCSICASTVTNDVSRETHSKGETCHE

    >gi|59710664|ref|YP_203440.1| thioredoxin [Vibrio fischeri ES114]
    MSDKILQLTDGGFEESVINAAGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNAGTPPKFGIRGIPTLL
    LFKDGGVAATKVGALSKTQLKEFLDANL

    >gi|59710938|ref|YP_203714.1| peptide-methionine (S)-S-oxide reductase [Vibrio fischeri ES114]
    MTTKQPTSPPLHFISQRNLEFIPPNFEQIFFGMGCFWGAERLFWQLEGVYSTAVGYSGGVTSHPTYKEVCTGTTNHTEVV
    KVIFDPTIISLNTLLHSFWQKHDPTEGMRQGNDIGSQYRSAIYTTSKAQQETAKQTQQQYQAALEKQGIMRIITTEIVPL
    QTFYFAEEYHQQYLAKNPDGYCGLKGTGVCFI

    >gi|59711056|ref|YP_203832.1| protein disulfide isomerase II [Vibrio fischeri ES114]
    MSFIRRTSAMIIALMSVVSFTACSDEQAKNQDASPSAVEAAQPDAEQAITQRLTTLGLPVEAIHDSEVDGFKQVETPFGI
    FYVSSDGKHFIQGRIFEFDENGDMKDLLAARFAKLVDSQSENMIVFPAKNEKHVITVFTDIT
    CGYCTKLHKEMKDYNDAG
    ITVRYLAYPRQGYQGSVADKMAQIWCADDKQQAMEDAKSNRPINGSKPATAECKNIIKEQYLLGRKMGVNGTPAIVLPSG
    DLVPGYKPARELLSDLEK

    >gi|59711226|ref|YP_204002.1| Fe-S cluster assembly protein IscA [Vibrio fischeri ES114]
    MAISVTEAAASRVQKFLENRGKGVGLRLGVRTSGCSGMAYILEFVDELNEEDQVFEQFGVKIIIDPKSLAYMDGTELDFA
    KEGLNEGFKFNNPNVKSECGCGESFNV

    >gi|59711253|ref|YP_204029.1| periplasmic protein disulfide isomerase, DsbA-like protein [Vibrio fischeri ES114]
    MKKLFVFLSAVMFAFSVQATQFEEGKYYQVLDVAKSTQPKVTEFFSFYCPHCYKFEAVIKNLKPALAKSAKFEKVHVAFM
    GNDMAVPMAKSYATMVVLGVEDKMVPAMFKQIHELGQRPKNEDELRQVFINNGIDPDKYDEAYNSAAVNAMQRKFDIQFE
    ASTLTGVPGVLVNNKYIVKPNAIRSYDEYNQLVNYLLTL

    >gi|59711335|ref|YP_204111.1| Na(+)-translocating NADH-quinone reductase subunit D [Vibrio fischeri ES114]
    MASAKDIKKSILAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVMFVTALSNLFVSLIRNHMPNSVRIIVQMAIIA
    SLVIVVDQVLKAYLYDISKQLSVFVSLIITN
    CIVMGRAEAFAMKSAPFPSFIDGIGNGLGYGFVLMTVAFFRELLGSGKL
    FGVEVLPLVSNGGWYQPNGLMLLAPSAFFLIGFMIWAIRILKPEQVEAKE

    >gi|172087677|ref|YP_204112.2| sodium-translocating NADH:quinone oxidoreductase, subunit E [Vibrio fischeri ES114]
    MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVYTYLLKENALVAGVDLTFLSF
    ITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVN
    CAIFGGVSFMVQRDYNFAESVVYGFGSGIGWMLAIVALAGI
    REKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGVQL

    >gi|59711388|ref|YP_204164.1| copper transporter [Vibrio fischeri ES114]
    MSQEFNLPLAGLNCGRCIAKIEKAFADNPHVQQYSVTKTDTKLTTTLSYQEVVKLITELGYSVPKAQHVTLYLSGLNCGK
    CVNKTKEALSGLSHSSITSISTTQLKLETTHSQQHIIELIESIGFHASNQSPVSDNKENLSPQSDNPKTDNTNYSSEKTT
    QLILSGMT
    CASCVSSVEKIIAQNKNVHSVTVNLAERTALVHGDIDVPTLIKSIEDGGYGAELSVSEEQRRVRQKEQFLKT
    TAKHKRNTILSLSIGAPLMLWGVFGGNMQISNTHDQIAWGVIGVICLGLLLTAGRHFFVNAWKAFTHHRATMDTLVALGT
    GSAWLYSMALVLFPEFFPEQARHVYFEATAMILGLITLGNLIETKARNRTSNAIEKLINLQPQTATVIIDSQEVTLPVAQ
    VVEGMVIKIKPGEKIPVDGTILSGESYLDEAMLTGEPIPSLKSLGNAVHAGTINQQGSFTFKATKVGEHTMLARIITMVR
    NAQSSKPKLAKLADKISSIFVPSVMIIAILSALIWYNFGPEPTSSYMLVVATTVLIIACPCALGLATPMSVTVGIGKAAE
    FGALIKDADVLQTASTIDTVVVDKTGTLTEGKPRVNHVTLFNQYDEKEVISLAAAVETHSEHPLALAVVNYLNDNHWIPL
    TSTNFTAELGLGASAIVNGNLIFIGNHRYLTKNNIPTPDVSISPSATPLYVANEQECIGVIQVSDAIRLDSKAAIKQFNQ
    LGIDVVMLTGDRKETAEHVAKELGINQIIAGVLPDGKAQAIQELQKQGKKVAMIGDGINDAPALAQAEVGIAMGNGSDVA
    IESAHLTLMNHSLLTAVNAITLSKATMKNMKQNLFGAFIYNTIGIPVAAGILFPFTGMLLSPVVAGAAMALSSITVVTNA
    NRLRLFTPQPQQK

    >gi|59711497|ref|YP_204273.1| glutaredoxin 1 [Vibrio fischeri ES114]
    MFVVIFGRPGCPFCVRAKEHAETLTEKRDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFIDEKHIGGCTEFEAYAK
    ENLGLFD

    >gi|59711509|ref|YP_204285.1| thioredoxin reductase, FAD/NAD(P)-binding [Vibrio fischeri ES114]
    MSNVKHSKLLILGSGPAGYTAAVYAARANLNPVMITGMQQGGQLTTTTEVENWPGGAADMTGPGLMEEMKAHAERFNTEI
    IFDHINETDFSQRPFRLKGDSGEYTCDALIISTGASAKYLGLESEEAFKGRGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIAAEVHLIHRRDSFRSEKILIDRLMDKVENGNIILHTDRTLEEVLGDDMGVTGVRLKDTKSDATEDLEVMGAF
    IAIGHQPNTAIFNGQLDMENGYIKVKSGLEGNATQTSVEGIFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDALEAKE
    S

    >gi|59711516|ref|YP_204292.1| thioredoxin 2 [Vibrio fischeri ES114]
    MSQFQTRCPSCHGLNRLPTERVNDGATCGRCKEPLLDGKPVEGTMDNLAALLNSDKAVVIDFWAPWCNPCVGFSPVFEDV
    AAERNGQIRCIKVNTEAEQQIAAQYQIRSIPTIMVFKNGQRVDMINGALPKGQFDQWLNQALLK

    >gi|59711521|ref|YP_204297.1| methionine sulfoxide reductase B [Vibrio fischeri ES114]
    METQKTFLEYTDEEWRKKLTKEEFDICRKQGTEAPFSGTLLHNKEKGYYACTCCQTILFVSDNKYDSGCGWPSFDAPVND
    QVIRYIEDNSHGMKRIEIRCRHCDSHLGHVFDDGPKTTNERY
    CVNSVSLNFSQDK

    >gi|59711529|ref|YP_204305.1| glutaredoxin 4 [Vibrio fischeri ES114]
    METIDKIKQQISENHILLYMKGSPKLPSCGFSSQAAQALMNCGEKFAYVDILQNPDIRAELPAYAQWPTFPQLWVEGELV
    GGCDIIIEMFQKGELQPLIKEAAERNAPAAE

    >gi|59711537|ref|YP_204313.1| SoxR-reducing system protein RsxE [Vibrio fischeri ES114]
    MASHKELVKNGLWDNNPALVQLLGLCPLLAVSATVTNALGLGIATILVLVGSNLIVSLVRQWIPQEVRIPVFVMIIASLV
    TCVQLLMNAYAYGLYLSLGIFIPLIVTN
    CIIIGRAESFASKNDPLPAVLDGLWMGMGMTAVLVLLGAMREILGNGTLFDG
    ADLLLGDWATMLRIELFHVDSHFLLAMLPPGAFLGVGFLIALKNVIDKKMADRQPKEKAEIERARIS

    >gi|59711542|ref|YP_204318.1| Na(+)-translocating NADH-quinone reductase subunit E [Vibrio fischeri ES114]
    MTEYLLLLIGTVLVNNFVLVKFLGLCPFMGVSKKLESAIGMGLATTFVLTLASVCSYLVETYILSPLGIEYLRTMSFILV
    IAVVVQFTEMVVHKTSPTLYRVLGIFLPLITTN
    CAVLGVALLNVTENHNFVESIIYGFGAAVGFSLVLILFSAMRERIAA
    ADVPLPFKGASIAMITAGLMSLAFMGFTGLVKL

    >gi|59711701|ref|YP_204477.1| SAM-dependent methyltransferase [Vibrio fischeri ES114]
    MSSMYTTFAEQYDNVVQDNIYNAYLERPSLQAMLGDVNGCDVIDLGCGSGVYADYFIHRGVAKLTCIDYSPNMIEIVKRK
    FGDRVTAYAQDASIGLIKEASESADLIISPLMIHYLEDLSVLFNDVARVLKNGGNFAFSTHHPFADFE
    CTLSGNYFEREF
    ITEMWNTVGEPVEVTFYRRSLTEIMNAITDSGLVVTQLSEGKVAEEVKQISLEKYEYLSKNPNFIFIKCQKLV

    >gi|59711869|ref|YP_204645.1| glutaredoxin [Vibrio fischeri ES114]
    MKPVKITLYRWAGSWGPFKVNIPCGECTLTKDILEDTFNTELDGIPIELEVKDWLSYWWEPLKLKAWHAPIIIVEDKVIS
    QGEALNRGVLVQAVIAQVAKRDDIKGNVVFGKAT
    CPYCIKAKAALDEAGVEYTYHDVVKDSAALYRMIPEVKAIIGEKTP
    VTVPQIWLDGKYVGGFDDLSKQMNTDVKAGN

    >gi|172087697|ref|YP_204687.2| copper-exporting ATPase [Vibrio fischeri ES114]
    MSKECYHCNEPVPSGSNFHVDILGETRDMCCPGCESVAQTIVENGLSSYYQYRTAPADKADLIPEQLKALTHYDHEEIQK
    EFVRTNDNYREVTLSLDGVS
    CAACAWLIEKQLSAAKGIHQIKVNTSTHRALLSWNPEETELSSLLTLIHQLGYKAAPFEA
    DKQEEEYHRSMKQYLYRLGIAGLATMQVMMLAVALYLEVFGDLDEEFRNYLRYVSLVFATPVMLYSALPFYMNAWRSLKA
    RTLGMDVPVSIAMLFAYFASVVATVTETGEVFFESVAMFTFFLLLGRFLEMRARRKAAAITGNLLKLIPVMATLSSGKRV
    PARTLDIDDIVVVPPGEHLPADGIVISGTSAIDESMFTGESMPIAKSESDTVYAGTINGDGNLTIKVTKTKADSLISNIV
    KLQDEAQMSKPKVAEIADLVARYFVAGILIISAFTWFYWHETKPDDAFWIMLSVLVATCPCALSLATPTAITCSTSRLAQ
    FGLMLRRGHVLETLCKVNRLVIDKTGTLTEGNIRLVKVNTFINTTEEECKALAAELESFANHPIAQAFSSFRKPETTYFE
    RVENVIGSGLIGYHNNSEWKIGHKAFAAPSTQIADEDNYQVWLSKDNQVVAAFSLDDPIRKESKEFIDALHKLGIKITML
    TGDSSSAVSKVANELDIDTVVSGASPQGKLEYLTSLPEHEISLMVGDGINDAPTLAGAHLSIAMGSGTDVAKASADMILL
    GDQLTRLIDARELAMKTRKIIRENLAWALGYNAIILPLAVMGLVAPYIAVIGMSGSSIIVVTNSLRLLKENG

    >gi|59711991|ref|YP_204767.1| putative glutathione S-transferase [Vibrio fischeri ES114]
    MTIPILYSLRQCPYAMRARLAILYAGQTVVLRDVDMMNKPKEMLSISPKGTVPVLHFEDTVIEESVDVMLWTLTQSDPRN
    LLYHHDLLQLPLMLDLIQKSDSEFVQILQKYRAASRYHDDNEMEYRDKCVEWLSDIEERLSKHTFIMGESASIVDYALLP
    FIRQFSRVDKKWYNIAPLPHLRAWLVRHYNDPIFSKAMTIYPKWNRDAEPVIFG

    >gi|59711994|ref|YP_204770.1| 3-mercaptopyruvate sulfurtransferase [Vibrio fischeri ES114]
    MNQLLADNPLVTTEWLAEHINDTNLVIVDAYMANIVGKEPIVYDEFCCLPKSRKLDVELDFCDHASSQIHALPTESQFTK
    AVQELGINSDSIVVIYDNQGIYSSPRAWWTFKVMGFEHVYVLDGGLPKWQEEKREVVTSYQQIPSLGNAVAKPNRHLACD
    SDEILHVIDTDAVILDARGEMRFLGKAAEPREGVRSGHIPSSKNLPFAMLLDNTTFKNKEILNSIFQERVPSNITKVFFS
    CGSGITACILILAAVSIGYKNVVLYDGSWADWGSNHNLPIE

    >gi|59712103|ref|YP_204879.1| glutaredoxin [Vibrio fischeri ES114]
    MLNTHQTIIFSKTVCPFCVKAKAILDDKGIEYKVLTLDEDLTKEEMVALIQEKENITVNTVPQIYLDRKYIGGHDDLVAF
    FERQDTDMDLGDFEL

    >gi|59712129|ref|YP_204905.1| zinc/cadmium/mercury/lead-transporting ATPase [Vibrio fischeri ES114]
    MCTTHKSTHCHDHKHNPSSSCCAKPKISTIKAESAVADCCSSVDKPTSSDSCCGSDPGESDPLVVIPQASEKGTLSRSWL
    ISDMD
    CPSCAAKLKKAILAIPDVVDANVVFATEKLTVRTNDELVFDVVESVARTTGFPLTDINTKKTSENAAQPFWKKNA
    LLLLLVAFLVIATGINIVNKELGTIAFTVAGLFGLIPIGRKAIRLAKNGSPFSIETLMTVAAIGAVYLGETVEAAMVILL
    FMLGEQLEGYASAKARSGVKALMDLVPDTALRINSDGTKEEVAASELNVGDRVQVSPGDRLAADAILLSEFASFDESALT
    GESVPVDKKANDPLMAGSIVNDRVIEIQITSAQGENAIDRILHLIEEAESRKAPLERFLDKFSRWYTPAMMVLSLLVIII
    PPLMFGQSWDTWIYRGLAMLLIACPCALVISTPAAITSGLATAAKRGALIKGGAALEELGHIQNIAFDKTGTLTQGKPVL
    TDIRVLTETETEESILLQSAAVEMGSSHPLARAVVVKAQEQGLTVIEADNRETVVGKGIKGTVNEQHIELYAPQQFDGEV
    IPEIESQIAFLEQQGKTVVLVLINEQISGLLAWRDELRPDAKMAVEKLVKLGIKPIMLTGDNERAAKAIAAELNIDYKAG
    LLPSDKVKYVEQLTANAKTAMVGDGINDAPAMKTASIGIAMGGGTDVALETADAALTHNRLEELAPMVALSKATLSNIHQ
    NITLALGLKAVFLVTSLFGITGLWVAVLADSGATALVTLNALRLLRFKEKE

    >gi|59712156|ref|YP_204932.1| thiol:disulfide interchange protein TlpA [Vibrio fischeri ES114]
    MKQIAKVLTAIILCIAVFFVLLSGLETKESSGSTAMVGETVPAFKLSDVTDASTYLTESIFHNDSLTLLNVWAAWCGICK
    TEHQFLHQLKEQGIPIIGLDYRDNRSAAKQVLEQTGNPYQAVLYDPQGILAMDLGVYGTPTTFVIDQHGKILHRFTGALN
    EEKWQREFADFFEGK

    >gi|59712191|ref|YP_204967.1| glutaredoxin 2 [Vibrio fischeri ES114]
    MKLFIFDHCPFCMKAKMVAGIKKLPVEFVYLQNDDVNARIEKVGANMVPILEKNDGSYMAESLDIARYLDEHDHHPIIEK
    STHEEEISEWLNAARPLFAKLTFSRWTQLDLPEFARPEAITWFTEKKEEFIEMSFEQALTNSNEYINALNPLLVNANFIT
    LPSEKGNQITWDDINFFPFIRNLTVVKGLDFPPHLKNYLEEISDLTGVHLFFDVAV

    >gi|59712216|ref|YP_204992.1| molybdopterin biosynthesis protein MoeB [Vibrio fischeri ES114]
    MSELTDNEMLRYNRQIILRNFDFDGQEALKASSILIIGAGGLGCASSQYLAAAGVGTLTLVDDDTVELSNLQRQVLHCDE
    TIGVKKVMSAKMALNRINPNCHINTVDKRLSDDELRSFIASHDLVLDGTDNVDTRNQLNRLCHESKTPLVSGAAIRMEGQ
    VSVYTYQDDEPCYQCLSSLFGQQALT
    CVEAGVMSPVVGIIGSVQALEAIKVLTNYGQPLISKLLILDALSMNWREMKLAK
    MPNCSVCSH

    >gi|59712242|ref|YP_205018.1| disulfide bond formation protein B [Vibrio fischeri ES114]
    MQALNHFSRIRLSWFLLLLCIIFFEASALTFQHIMKLPPCVMCIYERVAMMGIGGAAIIGLLNPNNLIIRWCGFIAWGIS
    AGWGLKLALEHVDFQLNPSPFST
    CDLFVTFPSWAPLNKWAPWMFEAYGDCSKIVWQFLTLTMPQWLVIIFAGNLIALAIF
    VIAQFFNKK

    >gi|59712338|ref|YP_205114.1| stringent starvation protein A [Vibrio fischeri ES114]
    MTTLYSFRRCPYAMRARLGIVQSNKTVHLREIILKSKPEAMLQASPKGTVPVLITNKGKVIDESLDIMKWALEGSELLLS
    ATNEMFQLIRENDDIFKSWLDKYKYADRYPEYSEIYYREQGELFLNKLEQRLTTSPMLFSKQYSFADLAILPFIRQFAFV
    DIHWFYQSKYKNLQRWLFEFIESELFNSIMNKYPTWLDSHQEFIFPEQK

    >gi|59712376|ref|YP_205152.1| hypothetical protein VF_1769 [Vibrio fischeri ES114]
    MSFWNSLSITTRYSRLPRCFFTYVQPTPLDNSRWLIWNSELAKQFDLPENVHNHSELLDAFSGETVPSVFSPLAMKYAGH
    QFGCYNPDLGDGRGLLLAEIKDKKGNSFDLHLKGAGLTPYSRSGDGRAVLRSTIREYLCSEAMAGLGIPTTRALGMMTSD
    TPVFREGYETGALLIRMAETHIRFGHFEHLFYSNLLEELKLLSDKVIEWHFPCCLGEDKPYLAMFNNIVDRTAYMIAQWQ
    AVGFAHGVMNTDNMSIIGQTFDYGPFGFLDDYEPGYICNHSDYQGRYAFNQQPRIGLWNLSALAHSLSPLIDKSDLEKAL
    EQYEIKLHDYFSQLMRKKLGLLSKQEGDTRLFESMFELLSQNAVDYTRFMRALSYLDSQDKQTVVDLFVDREAATLWIDL
    YLTRCKLEVDSFDMRCSKMRKVNPKYVLRNYLAQQAIVKANEGDFSDVKILSTLLASPFDEHPDFERYAELPPEWGKRME
    IS
    CSS

    >gi|59712425|ref|YP_205201.1| periplasmic thioredoxin of cytochrome c-type biogenesis [Vibrio fischeri ES114]
    MNKNFLFAPLALFLILVAVFATQLTRNSNGDDPTKLESVLVGKPVPEFRLEDLAQEGKLYDQSIFKGEPLLLNVWATWCP
    T
    CYAEHQYLNTLATEGVKIIGMNYKDDRAGAVQWLKELGNPYLITLFDGDGMLGMDLGVYGAPETFLIDSNGIVRYRHVG
    DVNERNWNETLKPMYDQLVAEAK

    >gi|59712520|ref|YP_205296.1| arsenate reductase YffB [Vibrio fischeri ES114]
    MKKVMTTIYGIKNCDTIKKCKKWLEANNLTFTYHDYRTDGIDKEMVTTFVKQLGWENVLNKRGTTYRQLTDEQKASLNEE
    TAIELLLEMPAMIKRPVLIHNNEYHLGFKPAQYETLFDI

    >gi|59712527|ref|YP_205303.1| thioredoxin-dependent thiol peroxidase [Vibrio fischeri ES114]
    MITPLAAGSTAPNVSLLDQNGESVSISDFKGKKVLFYFYPKAMTPGCTVQAQGLRDIKSELEAHNVVTLGVSIDAVKRLG
    KFIERDNLNFTLLSDEDHAAADAFGVWGEKKFMGKVYDGLHRISFLINEEGVIEHVFTKFKTKDHHEVVLDYLNNK

    >gi|59712530|ref|YP_205306.1| oxidoreductase [Vibrio fischeri ES114]
    MSVVIYHNPRCSKSRETLSLLEEKGITPKIVKYLDETPSIDTLKTIFAQLGFSSVRDMMRTKEAEYKEQGLAEASITDEQ
    LFEAMVATPKLIERPIVTNNSQARIGRPPEQVLEIL

    >gi|59712582|ref|YP_205358.1| alkyl hydroperoxide reductase, C22 subunit [Vibrio fischeri ES114]
    MVLVGRQAPDFTAAAVLGNGEIVDNFNFAEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLEDFQAKGVEVIGVSIDSQF
    SHNAWRNTAIEDGGIGQVKYPLVADVKHEICKAYDVEHPEAGVAFRGSFLIDADGLVRHQVVNDLPLGRNIDEMLRMVDA
    LNFHEKNGEVCPAQWEEGKAGMDASPKGVASFLSEHADDLSK

    >gi|59712669|ref|YP_205445.1| hypothetical protein VF_2062 [Vibrio fischeri ES114]
    MISGGVAGVYFFGAHVPTEYTTNTPLLIIAGLLVGIGTRLGNGCTSGHGICGIGRLSVRSIVATCVFMLVAGITVFIRLH
    VL

    >gi|59712741|ref|YP_205517.1| iron-sulfur cluster insertion protein ErpA [Vibrio fischeri ES114]
    MSDVSVPLTFSDVAAAKVKTLIAEEENPNLKLRVYITGGGCSGFQYGFTFDEDVNEGDMTIENDGVTLVVDPMSLQYLIG
    GKVDYTEGLEGSRFFIDNPNATTTCGCGASFSV

    >gi|59712785|ref|YP_205561.1| dihydrolipoamide dehydrogenase [Vibrio fischeri ES114]
    MSKQVKAQVVVLGSGPAGYSAAFRCADLGLETVLIERYSTLGGVCLNVGCIPSKALLHVSKVIEEAKAMAEHGVVFGEPQ
    TDINKIRIWKDKVVTQLTGGLGGMAKMRNVTVVNGYGKFTGPNTIEVEGEENTTVTFDNAIIAAGSRPIKLPFIPHEDPR
    IWDSTDALELKEVPEKLLIMGGGIIGLEMGTVYHSLGSKVEVVEMFDQVIPAADKDIVKVYTKRIKDKFKLMLETKVTAV
    EAKEDGIYVSMEGKKAPAEAERYDAVLVAIGRVPNGKLIDAEKAGIEVDERGFINVDKQMRTNVAHIHAIGDVVGQPMLA
    HKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGKTEKEAKEEGLNFEVATFPWAASGRAIASDCADGMTKLIF
    DKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNKKAVKKKK

    >gi|59712907|ref|YP_205683.1| glutaredoxin [Vibrio fischeri ES114]
    MFTSKEGQSVPQVTFPTRQGDAWVNVTTEELFKDKTVIVFSLPGAFTPTCSSSHLPRYNELHSVFKENGVDDILCVSVND
    TFVMNAWKADQEAENITFIPDGNGEFTDGMGMLVEKNDLGFGKRSWRYSMLVKNGVVEKMFIEEDVPGDPFKVSDADTML
    NYLAPEHKEQESITVFTKPG
    CPFCMKAKQNLIDKGLNYEEVVLGKDATTVSLRAITGRTTVPQVFIGGKHIGGSEELEAF
    LA

    >gi|59712908|ref|YP_205684.1| dihydrolipoamide dehydrogenase [Vibrio fischeri ES114]
    MKQVNVDVAVIGGGTAGLGSYRAAKAHTDSVVMIEGGPYGTTCARVGCMPSKLLIAAAESVHQIEKAPKFGIHPQGEIVI
    NGREVMERVKFERDRFVGFVLEGVDEIPAEDKISGYAKFLDDNTLQVDDHTIINAKRIVIATGSRPAYPAVWNELGDRLI
    INDDVFNWDDLPKSVAVFGPGVIGLELGQALHRLGVETKLFGLGGQVGPVTDPEVMAYANKAFNEEFYLDADVKVESMKR
    ITTESGEERVEIQFINKQGELETNIVEYVLAATGRRPNTDKLGLENTSIELDERGVPTADFYTLQTSLPTVFIAGDASNQ
    LPLLHEAADQARIAGDNAGRFPEIRAGLRRSKISAVFSDPQIAMVGETYKEITTRLGTCGCFATGEVSFENQGRSRVMLR
    NKGILHVYGEQGTGRFLGAEMMGPNAEHLAHLLAWAHQNKMTVSEMLDMPFYHPVIEEGVRTALRDLNAKLHLGPEMIKH
    CMDCGPGC

    >gi|59712957|ref|YP_205733.1| rhodanese-related sulfurtransferase [Vibrio fischeri ES114]
    MVTDPISGIELSNTSEIKNMETSIIDFVSNNMILAVVWIGIVVALIQNVVKQKTAGYQEVDPAQATTLMNREDAIVLDIR
    SKDEFKSGHITDARHILPSDIKAGNLPGLENSKTTPIIVV
    CKTGQTAQAAANDLHKAGFEQVKLLKNGLISWNEANLPLV
    KGKK

    >gi|59712963|ref|YP_205739.1| thiol:disulfide interchange protein precursor [Vibrio fischeri ES114]
    MTHLYRFRTALLSLFLLFTTLVPNANAAFDLTKLQGSQDSSFVTVNEAFPFNFMQQGDRVYLDWQVKPDYYLYQQRISVK
    ANSAEIADLVMEDGTPHNDEFFGDVNIYTEPLTITVPLVSVGDNAELIVRYQGCAKAGFCYPPEIRKIPLSELSAPSSYQ
    NEVAKTDVVAKSENAPVGIKTSVQPTPETPKTQTQQQELATNLGDAWWTPFLFLALGIGLAFTPCVLPMYPILTGIVLGG
    GKLPHGKAFKLSFVYVQGMALTYTLLGLVVASAGLQFQAALQHPYVLIGLSILFVLLALSMFGAYTIQLPSSIQTKLNDI
    SNQQQGGNLGGVFAMGAISGLVCSPCTTAPLSGALLYVAKSGDLLTGAIALYALAIGMGIPLILAAVFGNKLLPKAGVWM
    THVKTLFGFILLAVPVFLLERILPHDITPFVWSALGIAAFGWLYHVKATMPQSWKTSIVGIVAILGIVGSAIPVIDAISG
    KSNTEITTKTQTVTFKKITNINELNQELEIAKAQGKPVMLDFYADW
    CVACKEFEKYTFHNEKVEPVLSEFVLLQADVTKN
    SPTDIELLQQLKVLGLPTIDFWNANGEYLSDSRLTGFMKADPFMDHLSTNVINVK

    >gi|59713046|ref|YP_205822.1| soluble pyridine nucleotide transhydrogenase [Vibrio fischeri ES114]
    MKRLKYFVSNVAILIIIKALIMTNSTPIRSTHFDAIVIGSGPGGEGAAMGLTKANLNVAIIEREPSVGGGCTHWGTIPSK
    ALRHAVSRIIEFNSNPLYCKNNTSLHSTFSDILGHAKSVIDKQTRMRQGFYDRNQCSLIFGEASFVEKNTVAVTAKDGSI
    ETYTADKFIIATGSRPYRPEGINFNHSRVYDSDSILSLKHDPRHIIIYGAGVIGSEYASIFRGLGVKVDLVNTRDRLLSF
    LDNEMSDALSYHFWNSGIVTRNDENFEHIEANDDGVIMHLESGKKMKADCILFANGRTGNTDKLNLSAVGLEADSRGQLK
    VNDNYQTDVEHIYAVGDVIGYPSLASAAYDQGRFTAQAITKGKAEARLIDHIPTGIYTIPEISSVGKTEQELTAAKVPYE
    VGRSSFKHLARAQIAGKDIGSLKILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGEANTIEYFVNTTFNYPTMAEAY
    RVAALNGLNRLF

    >gi|59713055|ref|YP_205831.1| thiosulfate sulfurtransferase [Vibrio fischeri ES114]
    MDQFQHISVVDAQEKLQQQDLNAVLVDIRDPQSFIRGHVENAFHLTNDTIVELMNEVDFEQPVLVMCYHGHSSQGAAQYL
    VNQGYEEVYSVDGGFEGWHKAGLPVEK

    >gi|59713096|ref|YP_205872.1| glutathione reductase [Vibrio fischeri ES114]
    MTTHFDYICIGGGSGGIASANRASMYGAKVALIEAQDLGGTCVNVGCVPKKVMWHGAQVAEAINLYAEDYGFDVELKEFK
    WNKMIESRQAYIGRIHESYDRVLGNNKVNVIKGFAKFVDAKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGIDSNGF
    FELTEQPKRVAVIGAGYIAVEIAGVLHSLGTETHLFCRKESPLRSFDPMIIDTLVEVMNTEGPTLHTHSVPKEVVKEADG
    SLTLHLENGNTQNVDTLIWAIGRHPATDAINLDKTGVATNDRGYIKVDEYQETNVKGIYCVGDIMEGGIELTPVAVKAGR
    QLSERLFNGKTNAKMDYDLVPTVVFSHPPIGTIGLTEQEADEQYGKENVKVYTSGFTAMYTAVTKHRQPCKMKLVCAGED
    EKVVGLHGIGFTVDEMIQGFAVAMKMGATKADFDAVVAIHPTGSEEFVTMR

    >gi|59713099|ref|YP_205875.1| copper sensitivity protein ScsC [Vibrio fischeri ES114]
    MKFKTKLITTLVMACLFSPLASAMTQSEKVEDINKMLKDNPTIIDSLHESLAMYIAQQGKYEKTLADYHDYMYNNPNLPW
    FGAKDPKLTIVVLTDLS
    CPWCKKLDPVLMKLVEEHPDDLKVINIYVPLKEGSNPANSATFALRVWKESPDKFNKISETLL
    SKPGIHNTRSIMKVAKANDAEKYVSTNDEVQDMVAKNYQLFTDLGVRGTPAMLIDGQLLPGYLPYEKLAPMVEAKIAEKS
    GK

    >gi|59713100|ref|YP_205876.1| thiol:disulfide interchange protein TlpA [Vibrio fischeri ES114]
    MKRWGKETLIYLLVIIIFSFTVDAWRTKDMPANTAPALVGISTTGEAIDVIAMSQEKPVVVYFWATWCAACRFVTPTINW
    FSDTYQVVGVSTSSGEDRRVSGYMRSHDYTFKNMNDTRGDISRKWGIQVTPTIVIIDKGEIKNITTGITTPMGLLARLWL
    I

    >gi|59713101|ref|YP_205877.1| thiol:disulfide interchange protein DsbD [Vibrio fischeri ES114]
    MQKSVITTRMVLFGLFAMLCSVFISVAQAETPHTGWLKNSNHTPIETRFVLTGQINKVDQTVAGFLEVRLAGDWKTYWRS
    PGEGGIAPSMTWEDSQNIRSIDWYWPYPKRFDLLGIETLGYKGSVIFPMTLHIDDLNKPVTFKADLTLSSCTTICVLTDY
    PFELTFTPADLTLSKEAMHVYAQGLSQVPKESALLSDVKAVWDATKMQLQVTASKKMGWITPDVLVDGPSDEMQDANFSR
    PKIDVDGNNITATFDVSSWMGTPDLTGENISVTLKDSEFIAEQPASISDGVITSSNGLQSILKMILFALFGGLILNVMPC
    VFPVLGMKLSSVISAQGLEKKQIKLQFLASASGIVFSFWLLASFLVVLKLSGNAIGWGIQFQSAWFIGVMTLITALFGAN
    MLSLFEIRLSSNTNTWIASKGNNSYFGHFIQGMFATLLSTPCSAPFLGTAVAFALATNIPTMYGIFTALALGMALPWILV
    ALFPSIALSLPKPGPWMSKVKYLFGAMMLITSIWLLNLLSNHLSEFWIYVIAAIAGGVILLRTVQVHSKKAAGWLSILFA
    IAFGFGTVIDSMTSTDLLPEEPKWVPLSSESIQQYVDEGKVVFVDVTADW
    CVTCKANKIGVLLQEPVYSELNSANVVPMQ
    GDWTVPSEKITSYLQEHGRFGVPFNVVYGPSAPNGIELPVILNEKVVMDAIKKAGNKP

    >gi|59713160|ref|YP_205936.1| periplasmic protein disulfide isomerase I [Vibrio fischeri ES114]
    MMKKMMALFGALVLSFSVNAANFTEGDYYKVLDLPESKTPTVNEFFSFYCPHCNSFEPLIQGLKKTLPDDATFKKTHVSF
    MGGPMGLSMSKAYATMVSLGIEDKMIPVFFNRIHTMNKPPRNEKEIRQIFLDEGVNADEFDGTYNSFAINSMVNRFDKSF
    QDSGLTGVPALIVNNKYLVETGKIKSADEYYELVNWLLKK

    >gi|59713188|ref|YP_205963.1| peptide-methionine (S)-S-oxide reductase [Vibrio fischeri ES114]
    MKSRLKITTVALLFASFFAVITSFFSTAEDMTQPMKGDNEVATLAGGCFWCTESDLEKLDGVVDVVSGYSGGTLENPTYK
    QVSSGKSGHIEVIQVTFDPKVVSYEQILDHLFRHIDPTDNKGSFVDRGPQYRPAIFYHNEDQKLIAQNFMKDIDAAGIFP
    KPLATELIEYKTFWPAEAYHQDYYKRNPIRYKYYRHGSGRDKYLDSVFGEDREENPKTLRQYITEYEMAVNVKPYSKPSE
    SQIKKSLTELQYYVTQEEGTERPFDNAYWDNKAEGIYVDIVSGEPLFSSTDKYKSGTGWPSFTKPINKAYIVEEDDFQLF
    TKRTEIRSKFADSHLGHVFNDGPKPTGLRY
    CMNSAAMRFVAKADLEKEGYGEYLYLFN

    >gi|59713284|ref|YP_206059.1| thiosulfate sulfurtransferase [Vibrio fischeri ES114]
    MKKSTIAIGVLAAAVAIGYPTYKSMFSAPAFEISKQHLTEKFSHYAHPEHFIAAQDLKEMMDNGDNVVVIGALNPMKPDA
    PIEGSFTMWRDGYSAKEGTYEFDGMSNTTEEMEKILSSYGATPESTIVVYAATSHHDAARLFWQIEALGHSDIRYLDGGL
    NAWVGADLPTGNANPSVAQSDYQASQPAHKHTALATLDMVIEAQNNDEWVIIDTRGNDEFNGTTTVGGAFGPGTIPKSVH
    INWTKAVNEDTTLKSAEELQALYGDIIKGKKVIAY
    CQSGVRSAHTTMILQNVLGAEEVYNYDGSWIEYSHAHYEEKQPNV
    TVINGQI

    >gi|59713308|ref|YP_206083.1| rhodanese-related sulfurtransferase [Vibrio fischeri ES114]
    MKIKVGLCALLAMFSFNSWSSERSEQAWEQVEQGALLIDVRTPGEFDQGHLDGATNYPLNTVDKTFAKIDKDTPIVVYCR
    SGARSGKAMSYLKQVGFKEVYNGGGLVEMQSTKPTP

    >gi|59713360|ref|YP_206135.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Vibrio fischeri ES114]
    MNVYTQFESPIGQITVNANDEGLLGVWYESHKMELSEFGTRADDHPILKLTVTQLKEYFRGDRRDFSIPLAAKGTEFQNK
    VWKALTTIPYGKTWCYKDLAIAVGNPKASQAVGGANGKNPISIIVP
    CHRVIGKNGSLTGYAGGVDIKEKLLALESNK

    >gi|172087798|ref|YP_206209.2| formate dehydrogenase-H [Vibrio fischeri ES114]
    MMKITIDKQTFTIDEEITLLAAAKECNVEIPSLCGNNINGEKVPCDLCVVEIEGQGIQRACETQAVDGMQVITSSEALVK
    RRQSALNKILSDHYADCEAPCQTACPAGVDIQSYLYHISQDNHQKAIEVIKRTLPMPLSIGRVCPAFCEAECRRGLVDEP
    LAIRQLKRHAADVDLHAQESYVPPKKADKGKSIAVIGSGPGGLTCGYYLTNEGYSVTVFESMPKAGGWLRYGIPEYRLPK
    SILDKEIELMCRNGMEIQTSVKLGEDFSLTQLSDEYDAVCLAVGASKAVEMHYQGSELGG
    CYLGVDYLKDYVTESKLTTG
    KKVAVIGGGNTAIDCARTAVRDGADTTLIYRRTREEMPAEDYEVVEAEHEGVKFHFLTNPVENIADENGRVAQVRLEKMA
    LGEPDASGRRSPQATGEFFIEEFDTVISAVSQKPDLSFLENDTIDLPLTRWNTADANSLTMHSGVKNIFSIGDFRRGPAT
    AIEAVADGRIAAEAIDRFFNGDMEKIPTKPFNSQKEKKTKQVDPKHFEHIQKAMRVIMPELTAEQREQSFDEVETGFDNL
    DAIREAERCLECACQANTNCGLRDYATEYKADETDLSNESKQKFAIDTSSEFIVFDANRCISCGQCVEACNEKGVHGVLS
    FMKNEDGTNASRPECRAGFEHGYQMGNSNCVQCGACVQACPVGALVDSRDKSQGRIEVLKPVDTICTYCGVGCKLTMMVD
    ESTNKIKYVQGAKSSPVNEGMLCVKGRFGFDFVSSDERLKTPLIRKNGELVPASWEEAITLVADKFSTIKSQHGGNALAG
    FSSAKTTNEDNYAFQKLVRREFETNNLDHCARL
    CHSTTVTGLEASIGSGAMTNDIPSIKHSDLIFIIGSDTTSAHPIIAS
    HIKQATRHHGARLIVADPKQVDISDHAELYVAQRPGTDVMLLNGIMQQIIKNNWHDQAYIAERVEGFDELKAEVMSEAYS
    PEKIELITGVKAQDVIEMARYIGTAKRTAIYYSMGITQHTTGHDNVRSIANLQMLCGNIGIEGGGINPLRGQSNVQGACD
    MGALPTDFPGYQKVENPAVYEKFVKAWNKPTLPSKKGLTLTEIIDAACHEQVKGLFVMGENPVLSDPDQAHVIHGLEKLD
    FLVVQDIFMTETAAYADVILPSCSFAEKAGHFTNTERRVQRISPAVNPPGEAKEDWWIIQEIANAMGGEWNYQSVEDITE
    EITQVTPQYQGMHWDAIGKNGLQWPCNDANPQGTRIMHNQQFLRGKGQMAAVPFRYAAELPDEEYPLVLTTGRLLEQYHT
    GTMTRKTKGLNNLAGPRAMMSVADAERLGISNSEMVRVSTRRGTIEAPAFVTKRMQEGVIFVPFHFVEAAANKLTTTALD
    PHAKIPEFKVAAVKVEKVLQPEPEVCV

    >gi|59713507|ref|YP_206282.1| thiol:disulfide interchange protein DsbD [Vibrio fischeri ES114]
    MTLFFLSLFSVSAIAQPTDEIQSNNIFNIIGIALLGGLILNIMPCVLPVLGMKLSNMLALSSMNSQSIRLQFLASASGIL
    VSFWLLAFSVLILRITGGMIGWGIQYQNPLFIGFMAITIGLFTANLLGLFEIQLSHRFSTFIAQKGDNSTLGNFIQGMFA
    TLLATPCSAPFLGTAIAFALGASTLEMLLIFTFLGLGMALPWLFFAVFPHLISYMPKSGPWMNKVKIVFGLMMLSSTLWL
    LSLLSPFIGVLLTVIIALLFSIYLLYKIAHIHGKNTVITIIAVIIFLSSSILIVGSMTTKYWVTPTEDNLRWESLDERTI
    DDYVKQGKTVFVNVSADW
    CITCKTNKIGVILQNPVYPALQQENVITMQGDWTHPSHKITEYLKKHQRYGVPLTVVYGPNT
    PQGLTLPVLLDGDEVIHALNYAKGSSNQ

    >gi|59713518|ref|YP_206293.1| osmotically inducible protein C [Vibrio fischeri ES114]
    MTTLYTTKATALAGRNGQVKTDDNMLDLALSYPKEMGGTGEATNPEQLFAAGYSACFSNAILHVAREMKIKLTQAPVTAE
    VGIGPNSAGGFALTVVLAVVLDLEDQQAQQLVKTAHQV
    CPYSNAVKGNIDVKLSVNGVAL

    >gi|59713640|ref|YP_206415.1| putative lipoprotein [Vibrio fischeri ES114]
    MRILMKSFIKPLLLILSSALFLTACSDNNDPKEGVQYEVLSTSLENDGMAPVTEVFALSCGHCRNMENFLPVISQEAGTD
    IGKMHITFNQSAHIASMFYYAAEMQVDGAPDHAFMEDLFAATQMGEGTTLTEQQEAYSKAFTSRGLVSPYDFNEEQRDTL
    IKKVDNAKMLSEKSGISSVPTFVVNGKYNVLIGGHDDPKQIADTIRYLLEK

    >gi|59714004|ref|YP_206779.1| glutathione S-transferase [Vibrio fischeri ES114]
    MIKLISFNNCPFVQRVMGALVTKNVAFEIEYIELNNKPQWFLDIAPNGQVPVLITEDKTVLFESDAIVEYLDDKYAPIED
    LTPEQRAIDRAWSYQASKHYMPQCGTMGSKDKETFETRLANLSKAFAKAEGKLSDSLFFKGDYISNVDIAWLPLLHRAAV
    IKDQSGFDMLDGFPKVQKWQASLIESGLAEKTVPQDFVATFSGFYLKNTYLAHVMNGTEAECAEGRCSTDSSSCCN

    >gi|59714072|ref|YP_206847.1| lipid hydroperoxide peroxidase [Vibrio fischeri ES114]
    MKSVTFQGNPVDISGNFPSKGQTIKNFLLCNSDLSDITLDNFEERNLIMYTYPSVDTPVCSKSLVYLNAKAKTLTNTTVL
    CISADLPFATNRFCKNEELTSIQTASFFRSENFTEDYGVNLNKGVLRGLAARSIIIVNSMGIIVHSELVDEITNEPDYDT
    INEVLETL

    >gi|59714073|ref|YP_206848.1| thioredoxin peroxidase [Vibrio fischeri ES114]
    MKKITLLIGMLLSTSVFAEKQFEITQKNAAFGTQQTVTLENKVNFNLSGNAIKVGDYFPSIELITSNLQSFDTSESGRVK
    IYSLLTSIDTPV
    CVQQAIDLAKFTTKHSNMNNGIEFYAISADTPFAQQRFINKYNLNGLKFLSDSIEHNFGKETGAQIKE
    LGLLTRSIIVVDKNNKIAYYQRVPELTTIPDLNKAVNIAKTLI

    >gi|59714223|ref|YP_206998.1| glutaredoxin [Vibrio fischeri ES114]
    MKRVVLYVADKCPHCKEAQRYLDSKGIKYRLTNAKMQRGRKELEAIGARSVPVLKIGDQMMAGWNQKNFDKMYNS

    >gi|59714011|ref|YP_206786.1| glutaredoxin 2 [Vibrio fischeri ES114]
    MKVIRFVLGKVILGLDCVFSPSGVKRDPAKQTEIDAETAKYSLYQFEACPFCVKVRRTIKRQSLNIELRDAKHNEEHRAA
    LLAGGGRIKVPCLRIDNENGETQWMYESADIMSFLESKYP

    >gi|59711895|ref|YP_204671.1| glutaredoxin-like domain-containing protein [Vibrio fischeri ES114]
    MITLYSTEGCHLCEQAFDLLVEVGVDMEQVDTVDIAFNDELFSRYGVTIPVVANGLSELNWPFDASQLKNWLEDNGITYN