Verminephrobacter eiseniae EF01 2 uid58675

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|121607038|ref|YP_994845.1| UBA/THIF-type NAD/FAD binding protein [Verminephrobacter eiseniae EF01-2]
    MTDDQLLRYSRHILLDEMGIEGQERVLAAHALIIGVGGLGSPAALYLAGAGVGHITLVDDDVVDLTNLQRQIAHTTARVG
    RPKVESAAAALAALNPQVRVTGLQARVDAATLDGLVQKATVVLDCSDNYATRHAINAACVRQAKPLVAGAVLRFDGQLTV
    LDPRDAQSPCYACIFAPDADFEEAR
    CATMGVFAPLVGVVGALQAAEALKLLAGIGQSLAGRLWMLDGRSMRWNCIRVQRS
    PGCTVCAPR

    >gi|121607043|ref|YP_994850.1| rhodanese domain-containing protein [Verminephrobacter eiseniae EF01-2]
    MKFIIDNWYLFLVALASGGMLLWPLIKNARDGALTPARVVQMINREKAVVIDVCETEEFAAGHVVGARNLPLGQIEERLP
    GVVKNKALPVVLV
    CATGARARRAVTMARKLGYDNAQAMAGGLAAWRAASLPVEKT

    >gi|121607044|ref|YP_994851.1| glutaredoxin 3 [Verminephrobacter eiseniae EF01-2]
    MQAVKMYTTAVCPYCVRAKQLLKARGVEQIEELRIDADPAARQQMMALTGRRTVPQIFIGQTHVGGYDDLVALDGRGQLM
    PLLGAA

    >gi|121607159|ref|YP_994966.1| thiol-disulfide interchange protein DsbD-like protein [Verminephrobacter eiseniae EF01-2]
    MHQRRFHRLAAALVLALCLASASWTGASAQSGLGFGAAAGSSVVATPHLRAELLAHAPQGVTAGQPLWLGLAIDHQPGWH
    TYWKNPGDSGLPIQLDWTLQAGLEAGEIAWPLPRKIPIGTLLNYGYEGTMLLPVPVTVASTFAPGPLAQDIRIDLHASWL
    VCRETCLPEEGRFTLQLPIRSSTALNGAAFEAAWQARPRPLADGAQGQAQPDGQHLQISVPGLPAALRGKTLDLFPETPQ
    VIASASPWTQAWNGDLWTARIPVSPERSSSPATLPVVLVEQSAERAVGQGAERPGYRAELQVPGPWPPVAAVAGVSPALQ
    SALEANAAQAAGTAVSGAPAPALLAALLGALLGGLILNLMPCVFPILAIKLVGFTRHGAGHGAGSAQRARHALRANGLAY
    TAGVLLSFIALGALMLGLRAAGQAIGWGFQLQSPAVVAALAALFTLIALNLAGAFEFGHLLPSSLAGLHLRHPVADSFLT
    GVLAVAVASPCTAPFMGAALGLAAQLPAPWALAVFAALGLGLALPCLVASWVPAVARALPRPGAWMDIARRLLAFPMFAT
    VVWLVWVLGQQSGIDGAGALLILLVGLGLVVWAMSLTGRARRWMATGSIAVMALLLWAFAPQVIRLAPATPSADASTRWQ
    AWAPGAAEQIVASGRPVFVDFTAAW
    CVTCQYNKQTTLANAEVLADLARKNVALLRADWTRRDPAITAALTALGRNGVPVY
    VLYRPGHPPVLLPEVLSVAQLRAAIAGL

    >gi|121607459|ref|YP_995266.1| putative thiol:disulphide interchange protein (periplasmic) [Verminephrobacter eiseniae EF01-2]
    MKLTTALLTTAAAITLALSLSANAQEAQIRQALAERFPKLEKIDEVRATPLVGLYEVRIGTDLYYTDAKGDYVLHGNLID
    AKSRRNLTQERVNKLLAVDFSTLPLKDAVTIVRGDGRRRLAIFEDPN
    CGYCKLLERSLQQVNDITVYLFLYPILNDDSTQ
    KSRNIWCAKDKAGAWQDQMLRNKPAAAADCDTSALQRNLAFGAKHKITGTPTMIFANGSRVPGALDAQEVEKRLAEAAGG
    KSPSTP

    >gi|121607570|ref|YP_995377.1| DSBA oxidoreductase [Verminephrobacter eiseniae EF01-2]
    MKRREFSLSAAAVLATGTLSKPALAQARQFREGRDFRRLGTPVTPDAPAGKVEVIEFFWYSCPHCHAFEATLSAWAKTAP
    KDMHLRRMPVAFNSSFVPQQKLFYALEGMGKLGEMHTKVFRAIHEEKQKLDKDQDILAWAGKQGLNAAKFKEFYNSFNVS
    NQARRATQLQDIYGVEGVPAMGVAGKFYTDGQMTGGGLQTVLQVVDYLVAMSRTPSSPAPDKP

    >gi|121607640|ref|YP_995447.1| thioredoxin [Verminephrobacter eiseniae EF01-2]
    MTSALIKHVSDASFEADVLQADTPVLVDYWAPWCGPCKMIAPLLDDAADRYQGRLQIVKMDVDDNRQTPAKFGIRGVPTL
    MLFKDGQPAATQVGALGRAQLTEFLDQQLAA

    >gi|121607768|ref|YP_995575.1| thioredoxin domain-containing protein [Verminephrobacter eiseniae EF01-2]
    MPYAAQYLALAPSREEVGRLAGAAVLEFGAPWCPHCQRAQPLIGQALQGRADLAHLKVEDGPGQRLGRSFGVRLWPTLVF
    LRDGQEQARLVRPQTGAEIRAGVQAISAQTP

    >gi|121607811|ref|YP_995618.1| uncharacterized peroxidase-related enzyme [Verminephrobacter eiseniae EF01-2]
    MSSIIKSHGFTNEVLQWHAWLDVIDLDQASEDQIKVLEESHPKAKTSDYYLFLGHQPEILRQRSAAFNAIMYAPGGMSRA
    ERELGSMLVSRVNGCVY
    CASVHAQRFEQLTKRNDTVQQVFDDPYTAGADAREKAIAQFAIALTKAPNDIGATNIQALKDA
    GLSEQEILDLIHSVAIFAWANRLMLNLGEPVFPATE

    >gi|121607854|ref|YP_995661.1| peroxidase [Verminephrobacter eiseniae EF01-2]
    MSTLRLGDTAPDFTQESTAGTIRFHQWAGDSWVVLFSHPADFTPVCTTELGKTAALATEFARRKTRPIAVSVDPVDAHQR
    WVQDINDTQNTTVDFPILADADRKVADLYDMIHPNASTTATVRSVFIIDPQKIIRTTFTYPASTGRNFDEILRVIDSLQL
    TDRHKVATPVNWKDGDDVIIVPSLQDPAEIARRFPKGFKAVRPYLRITPQPDK

    >gi|121607860|ref|YP_995667.1| disulphide bond formation protein DsbB [Verminephrobacter eiseniae EF01-2]
    MMVWNWIDRTPRRVLALISLACVALLACGLYLQHVVGLVPCPMCIVQRYALIGLALLTGLASARSAKGWWLTLSALAALT
    AGFGATVAARQSWLQWYPPQSVS
    CGRDFYGMIESFPLSRAIPMILRGSGDCAAVDWSLLGGSIANWSFLCFALLGLLLLA
    LLARGVRGARQRAPAPV

    >gi|121607976|ref|YP_995783.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Verminephrobacter eiseniae EF01-2]
    MAIVVNKPLPEFETNATGGIKVSNSSHLGQILVLYFYPKDNTPGCTTEAMQFRDRYKDFVKAGAAVFGVSRDNMKSHDDF
    KEKLELPFELIADTEEKMCHMFGVVKNKIMYGKKVKGIERSTFLIGPDGLLVQEWRGLKVPGHVDEVLKTVKSIKTLKKA
    A

    >gi|121608045|ref|YP_995852.1| heavy metal translocating P-type ATPase [Verminephrobacter eiseniae EF01-2]
    MNTTIASAASGQTLDLGICGMSCASCVGRVERALRQVPGVQQASVNLATESARITFAAGTDAAAMAALSCRAVRNAGYEP
    RVAGPQEAPEALSRQAAVPGFLPVGLGLLLSAPLLLPMLGALFDRHWMLPAWAQCALATPVQFILGARLYKAGWHALKAL
    SGNMELLVALGTSAGWGLSMWLWLTAGHPDHVPPLYFEASAVVVTLVLLGKWLEARAKRQTMAAIRALHALRPDVAHLLG
    PDGEVPVPVAELLVGDKLVLRPGERIPVDGRVHEGCTQVDESMLTGEPLPVARAVGERLTGGSVNGDGRIVMEVTAVGAE
    TVLARIIRLVADAQAAKAPIQRLVDRVSAIFVPVVLLLALATLLGWCRAGAGVEAALIHAVTVLVVACPCALGLATPAAI
    MAGTGVAAGNGILIKDAQALELAHRVDTVVFDKTGTLTLGQPRLTAFEAAPGLDATALLAAVASVQSGSGHPLARAVVQA
    ARERGLTLLPLDDMRAVPGRGSEGELQGQSYRVGSLRWMQESGVNLGPLAPRAEALQRAGATVSAVAQRSAQGWEPRALM
    AFADTPKPGARAALAALKARGIRVLMLSGDSRGAAEAMARQLGLDPDAGEVMAQVLPGDKAQCIRDLQQGGYGLGKPGKR
    HTVAMVGDGVNDAPALAVADVGMAMGNGTDAAMHAAGITLMRGDIRLVMAALDISRRTVVKIRQNLFWAFVYNLLGLALA
    ALGQFGPMLAGAAMALSSVSVIANALLLKRWRMQ

    >gi|121608078|ref|YP_995885.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Verminephrobacter eiseniae EF01-2]
    MLDETLKTQLSTYLERVTQPLELQACLDDSQTAREMRELLQTIAALRSDMIHLRTDGSDARQPSFSLRRAGSQMQLRFAG
    LPLGHEFNSLVLALLWAGGHPPKVGQELIEQVQALDGDLRFEVYMGLD
    CHNCPDVVQALTLMAVLNPRISTTVIEGGAFR
    QEVSEREVMAVPTVFMNGRFFASGRMMLEEILARLDTGAAARDAARLSAKAPYDMLIVGAGPAGVAAAVYAARKGLRTGL
    VTERFGGQVNDTLAIENYIGVPQTDGPRYASALQAHLRAYDVDLMNLQRAGQLVAPAQPGGLTTVQLANGGALKARTVIL
    STGARWRNVNVPGEAEYRNKGVTY
    CPHCDGPLFKGKRTAVIGGGNSGVEAAIDLAGIVAHVTLIEFAEQLKADAVLVDRL
    KSLPNVSIHTNAQTTCITGAGGKVDGIRFRDRATGLEHGVELDGVFVQIGLVPNTDWLKGQVALSPSGEVVIDARGQTSL
    PGVFAAGDCTTVPYKQIVIAAGDGAKAALSAFEHLIRMPVAAAAAVPAAADPVLA

    >gi|121608079|ref|YP_995886.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Verminephrobacter eiseniae EF01-2]
    MSLINTPIQPFKTTAFIHRGGKGEFIEVTDDSLKGKWSVLIFMPAAFTFNCPTEIEDAAEHYAEFQKAGAEVYIVTTDTH
    FSHKVWHETSPAVGKARFPLVGDPTHQLTHAFGVHIPQEGLALRGTFIINPDGLIKTAEIHSNEIARDVKETVRKLKAAQ
    YTAANPGQVCPAKWNEGAKTLTPSLDLVGKI

    >gi|121608155|ref|YP_995962.1| heavy metal translocating P-type ATPase [Verminephrobacter eiseniae EF01-2]
    MSMSRSAAQLLLLDDPQEWSAFGRLHSPAAPAGPADPATVWDSQVVLEGMHCAACALTIEDALRAVPGVLQADVSAATRR
    ARVLWQPGLVRPSQWLQAVHQAGYRAMPAVDALAREQRLRASRQALWRWLVAGFCMMQVMMYAWPAYVAEPGDLTGEMEQ
    LLRWACWVISLAVVVFCCGPFFAGALRDIRLRRVSMDLPVALGMAITFGVSTAGTFDPSGIFGREVFYDSLTMFVFFLLT
    GRWLESRLRDRTAGALEAVLNRLPDSVERRCADGSFSRVATRRLAVGDTIRVLPGEAFAADGRITLGSTCADEALLTGES
    TPVARPVGSKVLAGSYNLQSPVEMLVEGTDGQTRWAQIVALMDSAALQKPRLAQLADRIARPFLVLVLAAAALAALHGWS
    ADPGHALMVAVAVLIVTCPCALSLATPVAMLTAAGTLARHGVLVRNLQGLEALARVDTVVFDKTGTLTRDGMALRAVHTA
    AGRGADEALALAAALARHSMHPAARAVVAAAAAVTVADGRWRLADWQEEAGLGLRATVQDGAGAVRIVRLGSARHAGLAA
    QQDSGAPQVLLSEQGPDGAVLELARFDLVEDLRCEAAAVVQALERQGLSVQLLSGDRIGAVQRVAALAGIATDRAQGDCT
    PQGKLAALQALQAGGRHVAMVGDGLNDGPVLAGADVSFAFGRAVPLARSRADFVVLGDDLALVVQTLLLARRTLRVVRQN
    LCWAALYNALCVPLALLGWMPAWLAGLGMALSSLLVVLNAARLSKPLRFADGPAKPVSRRPLAWGAAAAPAAGDAGDAQR
    DERPQPPPPMRAVQRTS

    >gi|121608253|ref|YP_996060.1| redoxin domain-containing protein [Verminephrobacter eiseniae EF01-2]
    MIKVGDRLPATTLMEYHEVEGPGCSVGPNPVPVVEATAGKTIALFALPGAFTPTCSARHLPGYLQKADEFKAAGVDEIWC
    ISVNDAFVMGAWAREQKSAGKLRLLADGDATFTKATGLTLDLSGKGLGLRSNRYSMLVRDGKVVTLNVEAPGQFEVSGAD
    RLLAQAKG

    >gi|121608257|ref|YP_996064.1| redoxin domain-containing protein [Verminephrobacter eiseniae EF01-2]
    MAIKQWAAGVTVAAFVAVGAYLYLDMGGHAAPESTFVLLDGSRQSMADLRGKVTLVNFWATNCSTCVAEMPALAATYDKY
    HTQGFDTLAVAMSYDPPSYVVNFAATRKLPFKVAIDNTGQLARDWGDVRLTPTSFLVNKRGEVVKSFVGAPDFPALHRLI
    EQLLAQS

    >gi|121608459|ref|YP_996266.1| redoxin domain-containing protein [Verminephrobacter eiseniae EF01-2]
    MTPPGAPEASESPECAPASAARRRLLYAGVAGAAALGGLACWRFAPWAGPSGAEQALWGLQFDTPEGRVLVLKSFAGRPL
    LINFWATW
    CPPCVQELPMLNAFYREHAARGWQVLGLAVDRPASVRRFLQHTPLEFPVGLAGLGGADLSRSLGNPSGALPF
    TVVLDARQGRVRERKSGPLTAQELRQWAA

    >gi|121608517|ref|YP_996324.1| thioredoxin [Verminephrobacter eiseniae EF01-2]
    MIDVTVENFETEVLAASAHVPVLVDFWAPWCGPCKSLGPVLEKLETEYAGRFKLAKIDSDQQQQLAGMFGVRSIPTCMLL
    MNGQPVDGFTGALPESQLRSFLDKHLPSVAELVANAEEEQALQALAEGDTDTALEKLQHAVMADPANDDARFDYVKLLLQ
    LDRAGDARTAFAPVLAKAAGSRKFGALKAWLDALDFAATGAYDADAEAGFAARIAANKRDFDTRYARARWLMAGQRWTDA
    LDELLEILMRDKGWNDEAARKTCVAVLEIIEPPKPKVAEGQIPPEDPVVASYRRRLSSVVLS

    >gi|121608526|ref|YP_996333.1| glutaredoxin-like protein [Verminephrobacter eiseniae EF01-2]
    MSDTRQRLDALVKSSDILLFMKGNASFPMCGFSGRAIQILKACGVDPKAVVTVNVLEDEAIRQGIKEYSNWPTIPQLYVK
    GEFIGGSDIMMQMYESGELRQVLGT

    >gi|121608564|ref|YP_996371.1| alkylhydroperoxidase [Verminephrobacter eiseniae EF01-2]
    MKSSLRLPYYELSPQLLQGLRQIKVDLEASPLGLPLIELVYLRVAQINGCSYCLNMHTKTLRERNETDRRLAELAGWRVS
    SQFSQREKSALEWAESLTHVADTHAPDEAFFPLKEHFSDQEISDLTFAIALMNAMTRLAIGMRQ

    >gi|121608590|ref|YP_996397.1| selenophosphate synthetase [Verminephrobacter eiseniae EF01-2]
    MAADTIITTATATATSARDPVRLTRYSHGAGCGCKLSPQVLEVILAGSSGAHGLFPGLWVGNASRDDAAVHALDDERAVV
    STTDFFMPIVDDPYDFGRIAATNAISDIYAMGADPLMAIAILGWPVNMLPAEVARTVVDGGRAACAAAGIALAGGHSIDA
    PEPFFGLAVTGVVEKRHLKRNDTATAGCRLYLTKPLGIGILTTAEKQSRLRPQDAGLARDLMCTLNRPGSRFGRLAGVQA
    MTDVTGFGLLGHLLEMAEGSGLTAVLDAAAVPRLAGIGHYLDQGCVPGGTQRNFDSYGAKVSPLSAAQKHLLCDPQTSGG
    LLVAVAPDGEREFLAVAAQQGLALDPIGHLTARQALAVVLR

    >gi|121608723|ref|YP_996530.1| thioredoxin reductase [Verminephrobacter eiseniae EF01-2]
    MSTPTATAAATTRHAQVLILGSGPAGYTAAVYAARANLNPVLITGLAQGGQLMTTTDVDNWPADADGVQGPDLMQRFLQH
    AERFKTQVIFDHIHRADLGQRPFTLSGDSGTYTCDALILATGASAKYLGLPSEQAFMGKGVSG
    CATCDGFFYRGQDVCVV
    GGGNTAVQEALYLSNIARKVTLVHRRDRFKAEPILVDQIGQKVAAGKIELRLLHTLDEVLGDHSGVTGVRIKSTRDGSTQ
    SIALQGCFIAIGHSPNTDLFQGQLAMDNGYLITQGGLNGMATQTSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRF
    LEQARN

    >gi|121608765|ref|YP_996572.1| hypothetical protein Veis_1800 [Verminephrobacter eiseniae EF01-2]
    MAWQHGFAALGADFFTELRPSPLPAAHWVGRSSAVARLLGLDAAWLHSDAALQAFTGNGPLAGARPLASVYGGHQFGVWA
    GQLGDGRAIMLGETAAGWEIQLKGAGRTPYSRMGDGRAVLRSSIREFLCSEAMHGLGIPTTRALCITGSPAPVRREETET
    AAVVTRVAPSFVRFGHFEHFCAQRQTPQLQALADYVIARYYPQCRAGAANPYAALLQAVSERTARLMAQWQAVGFCHGVM
    NTDNMSILGLTMDYGPFQFLDAFIPEHRCNHSDTQGRYAYQRQPDVAYWNLLCLAQALLPLIGERDGALAALASYPGVFS
    AEFMAGMRAKLGLLQARDGDAALIDGVLMLLARHRVDYTIFWRRLSQAVGCGDFEPVRALFAQRADAERWLLLFSEHTTH
    MDHAQMAGMMLKTNPKFVLRNHLGEQAIRAAQQGDFGAIETLLRLLERPFDEHPGHDAYAAFPPDWAATIAIS
    CSS

    >gi|121608766|ref|YP_996573.1| methionine-R-sulfoxide reductase [Verminephrobacter eiseniae EF01-2]
    MNAPVQKTDAQWQAILHAKGAEPMALQVTRHAATERPFTGKYQAHWADGSYHCICCGAKLFDSDSKFDAGCGWPSFCQAI
    PGAITRIADRSHGMLRTETVCAQCGAHLGHVFDDGPAPGGLRY
    CMNSAALDFESGKA

    >gi|121608771|ref|YP_996578.1| alkylhydroperoxidase [Verminephrobacter eiseniae EF01-2]
    MKSSLRLPYYELSPQLLQGLRQIKVDLEASPLGLPLIELVYLRVAQINGCSYCLNMHTKTLRERNETDRRLAELAGWRVS
    SQFSQREKSALEWAESLTHVADTHAPDEAFFPLKEHFSDQEISDLTFAIALMNAMTRLAIGMRQ

    >gi|121608881|ref|YP_996688.1| dihydrolipoamide dehydrogenase [Verminephrobacter eiseniae EF01-2]
    MAIIDIKVPDIGDFSEVAIIEVLVKPGDTIRAEQSLVTVESDKASMEIPSSHAGVVQELRVQLGDKVAEGSVLLTLQEPQ
    HARSAASERQPVAAHDRQTPSAIDVQASNWAGTADLECDLLVLGGGPGGYSAAFRAADLGLKAVIVERYATLGGV
    CLNVG
    CIPSKALLHVAAVIDEVRHLSTAGIDFGAPEVNLERLRGHKEKVIGKLTGGLAAMARMRKVTTVRGYGAFVGAHHLQVQE
    TTGAGQEQTGSKKIIAFKKAIIAAGSQALRLPFMPEDPRVIDATGALALKEIPKRMLILGGGIIGLEMGTVYSTLGARLD
    VVEMLDGLMQGADRDLVKVWQKMNAHRFDRIMLGTQTIGAQARPEGIEVSFARVAKEHPSAPQTDLQTYDLVLQAVGRRP
    NGKQIGAEKAGVTVTDRGFIDVDRQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEVIAGELQGDKALAGAAFDARVI
    PSVAYTDPEVAWVGLTEDQAKAQGIRVKKGLFPWTASGRAIANGRDEGYTKLLFDDAPEARGHGKILGGGMVGSHAGDMI
    GEIALAIEMGADAVDIAKTIHPHPTLGESIGMAAEIAHGSCTDVPPVKK

    >gi|121609308|ref|YP_997115.1| rhodanese domain-containing protein [Verminephrobacter eiseniae EF01-2]
    MIDHIRPAQLPAWFAAAGPRPLVLDVREPWERQTASVHAQGFELLAIPMGALPASLATLDPARAIACLCHHGTRSLRVAE
    FLAQHGFDRVANITGGIDAWSQEIDPAVPRY

    >gi|121609332|ref|YP_997139.1| iron-sulfur cluster assembly protein IscA [Verminephrobacter eiseniae EF01-2]
    MAITLTQAAARHVSRYLARRGKGLGVRLGVRTTGCSGLAYKLEYVDDAAPEDIVFEHHGVKVLIDPKSLAYIDGTELDFV
    REGLNEGFKFNNPNERDRCGCGESFRV

    >gi|121609517|ref|YP_997324.1| methylated-DNA--protein-cysteine methyltransferase [Verminephrobacter eiseniae EF01-2]
    MHFHSHTVQTRITTPLGPVRLAASPAGLAGLWFEGQRHEPLPLLHGASAWSHAPDHPLLQAASGQLQQYLRGARAGFELP
    LDLSGGTAFQQSVWRALLTIARGQTISYGALSQQLGRPRAVRAVGAAVGRNPLSVVVP
    CHRVLGTDGSLTGYAGGLERKT
    ALLTLDDAPHPHPGPHQGNA

    >gi|121609596|ref|YP_997403.1| iron-sulfur cluster insertion protein ErpA [Verminephrobacter eiseniae EF01-2]
    MSAVAENIQTGMPAPILFTDSAAAKVAQLIAEEGNPELKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMTKNGVSLLIDA
    MSYQYLVGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFSA

    >gi|121609613|ref|YP_997420.1| hypothetical protein Veis_2659 [Verminephrobacter eiseniae EF01-2]
    MQPDAPNAAADPWWAICLCPDWCGACRDYRSSFDALARAHPGVRFEWVDIEDEADIAGDLEFETFPTLLIGHRRRALFLG
    PLLPRAPVLERLLGSLQAAHQGADQGGHGPTQAGAQAQELFDRVRAARRG

    >gi|121609989|ref|YP_997796.1| peptide methionine sulfoxide reductase [Verminephrobacter eiseniae EF01-2]
    MKVQDRKMTETIVLGGGCFWCTEAVFDQVRGITEVESGYSNGHTVDPDYEQVCRGDTGHAEVVRLRFDPAIISLREILEI
    FFATHDPTTLNRQGNDVGTQYRSGIYYDNPAHGDIANDMIRQMSQDNSFGAPITTEVKPRSLYSAAEDYHQDYFANHPNQ
    GYCAFVVGPKVDKLRKTFARYLKVRD

    >gi|121610219|ref|YP_998026.1| 3-mercaptopyruvate sulfurtransferase [Verminephrobacter eiseniae EF01-2]
    MPATGRHHLTQWAPSPAAPSSPLPCLSPTPMTTCTTLISAGELQSLIASGAPLMVFDCSFDLAQPTAGAQQYAQAHIPGA
    VYADLNHDLSAKPGAPGASGTTPEADRPASGGRHPLPSRERFAQWLSALGFANHMQAVVYDRQGANYCARLWWMLKWAGH
    DAVAVLDGGLQAWQAAAGAVSSGAGPAPLPADFRLAAPLRQLRTAAEVLARLQTPGQTVVDARAAPRYRGEVEPLDPVAG
    HIPGALNRPFNLNMAADGRFKPAAELHAEFATLLAGRDPASVVHQ
    CGSGVSALPNLLAMEIAGLGQTALFAGSWSEWCSD
    ATRPVERGAA

    >gi|121610309|ref|YP_998116.1| arsenate reductase and related [Verminephrobacter eiseniae EF01-2]
    MMRGMTRPRITIYGIANCDTVKKSRHWFTQQGLEHQFHDFKKQGLPAGRLPAWMAAVGWDKLLNRQGTTWRKLDSATQAT
    VQDPATASAVMQARPSVIKRPVVEWQPDGPTHVTHISVGYVPEQWQTWGHQPSRA

    >gi|121610850|ref|YP_998657.1| glutathione S-transferase domain-containing protein [Verminephrobacter eiseniae EF01-2]
    MMVLYSGTTCPFSHRCRFVLFEKGMDFEIRDVDLYNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PGDPVDRARVRLFLLNFEKELFVHVNVLESRATKGNEKALEKARAHIRDRLTQLAPVFLKNKYMLGDNFSMLDVAIAPLL
    WRLDYYGIDLSKNAAPLLKYAERIFSRPAYIEALTPSEKVMRK

    >gi|121610895|ref|YP_998702.1| dihydrolipoamide dehydrogenase [Verminephrobacter eiseniae EF01-2]
    MSQAFDVIVIGAGPGGYIAAIRAAQLGLNTACIDASQNDQGGAAPGGTCTNVGCIPSKALLQSSEHFEQATHWADHGITV
    AGVQIDVAKMQARKSAVVRQNNDGIQYLFKKNKVRFFHGRGSFVQAVEGGYRIAVQALAQGAAPELLTGKQIIVATGSSA
    RALPGTPFDEERVLSNDGALRLAAVPKRLALIGAGVIGLEIGSVWRRLGAEVTILESLPTFLGAVDEQIAKEAKKAFDKQ
    GLAIELGAQVGQVSVGKKGAQAVHIAYTDAKGQAQALDVDQLIVAIGRVPNTQGLNAEAVGLPLDERGALVVDADCKTPV
    PGIWAVGDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNLGTIPWVIYTHPEIAWVGRSEQQLKAEGIGYRAGVFPFLANG
    RARALGDTAGMVKMLADAGTDEILGVHIVGPQASELIAQAVLAMEFKASSEDIARICHAHPTLSEAIKEAALAVDKRTLN
    F

    >gi|121611052|ref|YP_998859.1| rhodanese domain-containing protein [Verminephrobacter eiseniae EF01-2]
    MTSHIDPKTLKAWLHDGGEIALLDVREHGQYGQAHLFYGIPLPFSRLEADAPRLVPRRSVRLVAYDDGASAVALRSAERL
    AALGYTGVHVLQGGAPAWEAAGYRLFAGVNLPSKTFGELAEEAYRTPRVSANELAGMLARKNEVVVLDGRPVSEFHKMSI
    PGATCCPNGELAYRVRRLVPDTGTPIVIN
    CAGRTRSIIGAQTLINLGLPNPVYALENGTQGWFLNDHKLAHGGTQRYAPD
    SGNTDLRPAAKALAERFGVPTVTAKTVQQWAAQADRTLFLCDVRTPEEFAVRSLPGAQHTPGGQLLQAGDQYFGVRGARL
    VLFDSDGVRAPTVASWLRQMGHDASVLEGGLDGGRASGLSLAPAAAPTAPALKTIDAQSLSARLAQGGVAPIDVRGSMQF
    RAGHIPQARWSIRPRLAADTKGETRQIVLVADDAALAAWAAMSELDGHAPLLLEGGMPAWRAAGLPLQATPALPADADCI
    DYLFFVHDRHDGNKEAARRYLAWETGLVAQLDAQERAAFRLPSAASHA

    >gi|121611230|ref|YP_999037.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Verminephrobacter eiseniae EF01-2]
    MIETDAVVIGAGPVGLFQAFQLGLQGIGAHLIDALPQAGGQCVTLYGDKPIYDIAGIPVCTGRELIDRLLAQLAPFKPHW
    HLNTLVAALAPQPDARLLLETDTGARLLARSVFIAAGVGAFVPRTLKMAGMERFVGTQLFYQVLPAGMDVTGRQVIVHGG
    DEGAVACAVELAEQGRAARVSLLYRRDLFQAPEALLQRLQRLRAAGRIAVEVGQITGIASSGMPQCSTLRALQVVDAQGA
    SHALPVDVLVAVLGISPRLGPLTDWGMAMARKQLQVDTEAFRTSVPGIYAVGDINTYPGKRRLILCGFHEATLAAFAAAE
    ALKGDKVALQYTTTSAHLHRLLGVAPASGATGP

    >gi|121611512|ref|YP_999319.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Verminephrobacter eiseniae EF01-2]
    MNTDSCIVIVGAGLAGAEAAFALRDGGHEGRIVMIGREAWPPYERPPLSKSFLQGDLARDRLWLRPAKSYTEQHIELQLG
    TEVTAIERARRCVRLDTGEVLGYDKLLLATGGEARRLTMPGAELDGVCELKSLDDAV
    CLRGRLVEGRSVVIIGGGYVGME
    FAATACRAGCEVTVLESQALVLSRSLPAVIARYLQGEHDKRGVRVLTQSSVARIEGDERVTAVVLADGTRLPADVVLVSI
    GNQASDALARGNGLPVDRGIVVDREGRTTDPHVFAAGDCTVSRHEGFDAPVRLESVQSATLQARRAAAAMLGQPAVSDEV
    PWFWSDQFDIKLQMAGLPLPGDTELLRGDPHGGRFSVVHQNADRITAIQCVNASGDFAAAKKMIAQRRSFAPALLCDPSV
    SLRDIRLGRSTDEPTP

    >gi|121611757|ref|YP_999564.1| methyltransferase type 11 [Verminephrobacter eiseniae EF01-2]
    MQRRGNAMPATAQTTRRRGNRFPTLLGESMDLISTAPNYTGHWDEKFRSRSWGRYPPEDLVRFMGRRFRAADKGAVKVLE
    VGCGPGANLWFMHREGFAVHGIDISPTAIAIANARLANENAGIPSPAADLRVGHFARLPWPDGHFDLVVDIFALYANTTD
    VIGQTLVEIARVLKPGALFYSKLWGTHCTGYGLGRQIEPGTFDEIPEGP
    CRGMGVAHFFTRAEIDTLFGGCFQATAIDRV
    IRSDVGAHQQIEEFHCQFTRARR

    >gi|121608888|ref|YP_996695.1| glutaredoxin [Verminephrobacter eiseniae EF01-2]
    MHQPLFAPLLASLLLTLACASAQAQTVYRIVGPDGKVSFSDRPPPDAKAQPVRAPAPAAANGAALPYDLRQIVNRFPVTI
    YTGDD
    CAPCASVRIMLTARGVPFTERTVSSNEDIAALQRLSGSSSLPFGTIGGQQLTGYSDTEWTQYLDAAGYPKQSQLP
    GNYRRPAPSPLVAIKAVEPAAPQNRTPAPAERVAAPVNDGPTPSNPAGIRF