Variovorax paradoxus S110 uid59437

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|239813049|ref|YP_002941959.1| Heavy metal transport/detoxification protein [Variovorax paradoxus S110]
    MSQKFQVSGMSCGHCVSAVQNAVQTVDPEAQVTVDLETGHVDVVSAQPRKDIVAAIENAGYRVQ

    >gi|239813050|ref|YP_002941960.1| heavy metal translocating P-type ATPase [Variovorax paradoxus S110]
    MDNLLHNLHDPMSTLDLSVGGMTCASCVMRVERALKNVPGVQDVSVNLATESARVVTAAGGEDMNARLRRAVRAAGYEPR
    AASSAADDAAALSPWYGFGPVGVGLLLSIPLLAPMLGQPFGQDWMLAPWLQLLLAAPVQFWLGARFYRAGWHAARAGTGN
    MDLLVALGTSAAFGLSLWLWWRAATGDHAGHGGMPHLYFEASAVVITLVLLGKWLEARAKRQATSAIRALQQLRPETAHL
    VGPRGESDVPLAEVMVGDRLAVRPGERVPADARVIEGQSEVDESMLTGEPLPVPKGPGDALTGGAVNGDGRMVVEVSAVG
    AESVLARIIRLVEDAQAAKAPIQRLVDQVAAVFVPVVLAIALATLAGWLLAGAGIELAMIHAVAVLVIACPCALGLATPV
    AVMAGTGVAARRGILIKDARALELAHRVGTVAFDKTGTLTLGRPVLTALVPVAGGGDEAALLAIAASLQGGSEHPLARAV
    MAAAAQRGLQPPPLSAMQAMPGRGVRGLVDGEPWAIASLRWCAELGAMPDAAQLERLHAQGATVSALLRFDAAGAARVQA
    LLAFADEPKPEAAQAIRTLHARGLRVVMISGDNLRAAQAMAARLGIAAEDVRAEVLPADKAAQVSALKKNGQVVAMIGDG
    ANDAPALAAADVGIAMAPAGGGTDVAMEAAGITLMRGDLALVAEALELSARTVAKIRQNLFWAFAYNVAGIPLAAFGLLS
    PVVAGAAMALSSVSVMANALLLRRWKP

    >gi|239813118|ref|YP_002942028.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Variovorax paradoxus S110]
    MHYDALVVGGSFAGLSAALQLARARKTVCIVDAGAPRNRFAAASHGFFGQDGTPPLKMIADARAKVLAYPNASFVEGRVA
    EARADGAGGFAVSLEGGGAPLTASRIVLAFGVEDGFPEIEGVRERWGRSVLH
    CPYCHGYEVSGRRLGILIERPHAPEHAI
    LFAEWGSATLFLNGNNTVDDETRARLQARGVAIEPGRIAALEGPSPTELSGVRFADGRRVSLDAMFLVPRTRLSSPLAEQ
    LGCAIDEGGFGPLIRTDAMKMTTVPGVFAAGDAAMMFHNATMASADGVMAGISLHRASVFGH

    >gi|239813245|ref|YP_002942155.1| Peroxiredoxin [Variovorax paradoxus S110]
    MTTSIYDFEANRIDGKKVKLSDFRGKVLLIVNTASQCGFTPQFAGLEQLHEKYASQGLVVLGFPSNQFGSQDPGTNEEIG
    AFCTTNYGVSFPMMEKIDVNGGNAAPLYQWLTKEKPGLLGSTAIKWNFTKFLVGRDGRVRKRYAPLDTPASIAREIEAAL
    AAG

    >gi|239813438|ref|YP_002942348.1| uncharacterized peroxidase-related enzyme [Variovorax paradoxus S110]
    MSTSNTNTPIRIKGFTNEVLSWKPWLDPVDVASATPAQLAALDEMSPQARTSPYFLLLAHQPEMLLQRSIAFNAIMFAPG
    GMPRAERELGATVESRVNGCVY
    CASVHAQRFEQLAKRSDVISQVFEEPASAGTTPREKAIVEFSIQLGAEPGKVSADNVR
    TLKAVGLAELEILDLVHSVALFAWANRLMLNLGEPVFPPVTAAS

    >gi|239813482|ref|YP_002942392.1| DSBA oxidoreductase [Variovorax paradoxus S110]
    MKRRDFSLAATSLGLLSLAGNTAHAQARAPKAGTEYLVLDKRVPVDAPAGKVEVIEFFSYNCPHCNDFEPQLEAWLKTVP
    KEVAFRRVPVPFVGNDVEAKQRLYYALEAMGKVDEFQPKVFDAIHKQRQNVNGDANIIAWAGANGLDGAKFKEVFTSFGV
    ASKAKRAAQLTDAYKVAGVPALAVNGRWYVDGELAGNMTKALQVTNYLIGEAKKG

    >gi|239813739|ref|YP_002942649.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Variovorax paradoxus S110]
    MSLSPSSDSRSIRAARHARAALSRASRRAVVAAAVALGATFLMGNNAFAAPAVGQQAPDFVAVDTSGAKHKLSDFAGKFV
    VLEWTNPG
    CPFVRKHYNSGNMPATQKAATAQGVVWLSVNSTERAASDYLQPAALDAWMKSQKAAPTAVLMDEDGVIGQAY
    GARTTPHIFIIDPKGMLVYAGGIDSIASARPDDIKSATNYVNQALGEAFGGKPISTASTRPYGCSVKYKS

    >gi|239813740|ref|YP_002942650.1| cytochrome c biogenesis protein, transmembrane region [Variovorax paradoxus S110]
    MPAAAQLASRPGAVVTTPHVRAELVAHAPEGVAPGAPVWVGLQITHQPEWHTYWKNAGDSGLPTELNWTLPSGVAAGEIA
    WPVPRKIPVGNLANYGYEGTVLLPVPLEVSSNFKPPLALGAGASALDVRLKASWLVCRKECIPEEGEFTLALPLQGSTAL
    HKAEFDAAQAAQPQPLAKPGAVEVSGNNLQVRLDGLPASARGKTLGFFPETPELIRTAAESGKDWTQNWQGGTWTATLPL
    ADQRSASPTTLPLVVALAEADRQPGQPVAWRTEAPVSGSWPAAAPRAEVSPALQAALAANAAAAPSSPSSDLPPQPTVTL
    MAALLGALLGGLLLNLMPCVFPILAIKVLGFARQAGNHSAHRTAGLAYTAGVMLSVLALGGAMLALRAAGAQLGWGFQLQ
    SPAVVAALAALFTLIGLNLAGLFEFGRAAPLSLCSAQARHPIANDFLSGVLAVVIASPCTAPFMGVSLGFAIGLPATQAL
    LLFAALGLGLALPYLVAGFIPAVALLLPKPGPWMNTLRRLLAFPMFATVAWLVWVLGQQSGIDGAGTLLALLVCMAAIVW
    ALTLRGRTRLVIATLMVAFTAVLAAAIGRNVLQTVEPARMAATAGQRWQPWSAERVAELTGAGQPVFIDFTAAW
    CVTCQY
    NKKATLADAEVLADFDSKKVAMLRADWTRRDPAITAALTALGRSGVPLYVLQAPGKAPVVLTEILGKDEVRAALAAL

    >gi|239813848|ref|YP_002942758.1| L-carnitine dehydratase/bile acid-inducible protein F [Variovorax paradoxus S110]
    MPMLNSSLPLAGVRVLDLSRILAGPWCGMVLADMGAEVIKVEHPGRGDDTRDWGLRVGKTETAYFNSVNRNKRSVTLDLQ
    TPEGQQIARDLAKQCDVVIQNFKFGGIDKLGLGYEQLSKEHPGLIY
    CSISGYDRTGPEAARPGYDLVVQGEAGLMALNGE
    ASQPPLKFGVAMVDLFTGMYSAQAVLAALYQREKTGKGRHVEMALFDCGLMITAYYGLEALLMGEDPPRYGNSHPSIVPY
    GVFDAADGPLVITVGNNAQFARFCTEVIERPDLAADERFKTNILRSANRAVLLPELHAELARRQRADLLARLSASGIPCG
    EVLGLLEALNSRRAADAGLVTEQPHPVAGKVNVLAPPYRFDGERLPVRSAPPQLGEGTHEVLQSLLGLSDDRLAQLKTSG
    VV

    >gi|239813955|ref|YP_002942865.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Variovorax paradoxus S110]
    MTSSPTRRGLLYGGVAVAAAAAGLGGAWWRERGSSSPKGEVLAASFWTQRFERPEGGELVFSDLRGKPLLLNFWATWCPP
    CVEEMPMIDRFFRENGANGWQVVGLAIDQPSAVRKFLQKTPVSYPTGLAGLQGTELVKNLGNTGGGLPFTLVLNGTGEVA
    ARKMGKLEAADLDAWRRELVHG

    >gi|239814210|ref|YP_002943120.1| Glutathione S-transferase domain protein [Variovorax paradoxus S110]
    MMVLYSGTTCPFSHRCRFVLFEKGMDFEIRDVDLYNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PGDPVDRARVRLFLLNFEKELFVHVAALENRTAKGNEKALEKARSHIRDRLTQLAPVFLKNKYMLGDNFSMLDVAIAPLL
    WRLDYYGIDLSKNAAPLLKYAERIFSRPAYIEALTPSEKVMRK

    >gi|239814290|ref|YP_002943200.1| thioredoxin reductase [Variovorax paradoxus S110]
    MSAPQHAKVLILGSGPAGYTAAVYAARANLQPLLITGIAQGGQLMTTTEVDNWPADVHGVQGPELMQRFLEHAERFKTQI
    VFDHINKVDLGKRPFTLTGDSGTYTCDSLIIATGASAKYLGIDSEQKFMGRGVSA
    CATCDGFFYREQEVCVIGGGNTAVE
    EALYLANIANKVTLVHRRDKFRAEPILIDKLMEKVAEGKIVLKLHNELDQVLGDDTGVTGIRIKNTQSGATEQIDLKGCF
    IAIGHHPNTDIFQGQLEMKDNYILTRSGLQGFATMTSIPGVFAAGDVQDNVYRQAITSAGTGCMAALDAQRFLEQDGTL

    >gi|239814573|ref|YP_002943483.1| Rhodanese domain protein [Variovorax paradoxus S110]
    MYTTLVSVEQLQQLQAGDAPHMVFDCSFDLMKPEAGAQQYAAAHIPGAVYANLDTDLSAKHGMPGAQGDVVIAQEDGVPA
    SGGRHPLPSREKFAAWLSSIGFSNDMQAVVYDRNGANYCGRLWWMLKWMGHDAVAVLDGGLQAWQAAGGEVTNREEPAHF
    QSNFVMGEPLVQLVTTDVVARRLGQPDQNLIDARAAARYRGEVEPLDPIAGHIPGAVNRPFAENLGPDGKFKPASQLRAE
    FEALLAGRDPATVVHQ
    CGSGVSAVPNLLAMQIAGLGTTALYAGSWSEWSNTPGLPTRQGAEP

    >gi|239814678|ref|YP_002943588.1| Thioredoxin domain protein [Variovorax paradoxus S110]
    MSALPAAPVSAEPASDAPWVVCLCAEWCGTCRDYRPLLEQVARAHPQFRFAWVDIEDHAEIADAFDVETFPTLLIAGADG
    TRFLGPLLPHAETLSRMLGALQAPQPSSLDVDLLLAVLEKRPGEFAV

    >gi|239814819|ref|YP_002943729.1| peroxiredoxin [Variovorax paradoxus S110]
    MSLINTQVQPFKTQAYLNGKFIDVSDETLKGKWSVLIFMPAAFTFNCPTEVEDAADNYPEFQKLGAEVYIVTTDTHFSHK
    VWHDTSPAVGKAKFPLVGDPTHTLTNAFGVHIPEEGLALRGTFVINPEGIIKTAEVHSNEIARDVKETLRKLKAAVYTAA
    HPNEVCPAKWNEGDKTIAPSFDLVGKI

    >gi|239814820|ref|YP_002943730.1| alkyl hydroperoxide reductase, F subunit [Variovorax paradoxus S110]
    MLDASTKAQLKSYLERATQPIEIVASLDDSKASGEMLSLLKDVAEASPLVKLTESRDDNHRKPSFSVNRPSENHGPRFAG
    LPMGHEFTSLILALLQIGGYPPKVEQAVLDQIRALDGDFEFEIYVSLT
    CHNCPDVVQALNLMAIQNPRIRTTMIEGGTFQ
    EEVKERQVMAVPTVFLNGTEFGQGRMSLEEILAKIDTSGVEREAKKIAAKDPFDVLIVGGGPAGAAAAVYAARKGIRTGV
    ASERFGGQVLDTLGIENFISIKETEGPKFAHALEEHVRDYDVDIMNLQRAKALVPGKDLIEVQLESGASLKSKSIIISTG
    ARWRNINVPGEHEFKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVGHVTLIEFDTQLRADAVLQRKLKSL
    KNVDVFTNAQTTEITGDQKVNGLVYKDRATGELKKVELEGVFIQIGLVPNTDWLKGVVELTKHGEIVVDARGQTSVPGVF
    AAGDVTTVPFKQIIIAAGDGAKAALGAFDHLIRTSAPAEQAAQ

    >gi|239814834|ref|YP_002943744.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Variovorax paradoxus S110]
    MAIVVNKPIPEFDANATGGLKVSNTSHLGHVLVMYFYPKDNTPGCTTEAMQFRDRYKDFEKAGATVFGVSRDNMKSHDEF
    KAKLELPFELIADTEEKMCHMFGVVKNKIMYGKKVKGIERSTFLIGADGILKAEWRGLKVPGHVDDVLKAVKALKKAA

    >gi|239814858|ref|YP_002943768.1| arsenate reductase [Variovorax paradoxus S110]
    MAARTPTTDYPMTIFHKPNCSTSRNVLGLIRESGVEPEIVLYLETPPSKKKLRELAKAMGLGARDLLRTKEAPYEELKLA
    DPKWSDDQLFDFIAANPILLQRPIVISPRGTLMCRPWERVREILPTA

    >gi|239814888|ref|YP_002943798.1| Rhodanese domain protein [Variovorax paradoxus S110]
    MSLSELSVETAGNDVASERARAVEAFLAQVRSLLLPGAAASHDTLQPVADALVRLGQRRALFPAAHFPVDAEHPAQVYRL
    AEDADGGFALYLSAGLAGKAQPPHDHTTWAVIAGVEGSERNELYRREKTGDPARDALVHQRTVDVAAGSAVVLLADDVHT
    IELVGGQDGRHLHFYGRALELLDERVVFEGAAGGSYRQFAAPKNIRHPAITPQALKAALSDGEEIALLDVREAGVFVRSH
    ILLAASAPLWRLEVLIDRLVPRRSTRIVLADADESLAHQAAAKLVRLGWRNVSVLAGGTQGWAAAGYELFSGSNVPSKAF
    GEVIEHRKHTPWISVDELHERVERGDDIVVVDSRTPEEFADFSLPFAHSLPGAELVYRIQALAPRPETLVVVN
    CAGRTRS
    IVGAQTLIDAGIPNPVVSLKDGTMAWLLAGRKLSHGRAAPLPEPDAHARQQARARAESVAARAGVRRIDAATLARFEAEA
    GERSLYRFDVRTRQEYEAGHLEGWRWAPGGQLVQATDEYVGTRRARIVLADWDGVRALTTGAWLAQLGGREVFVLSPPAL
    PVLVLGPEAVRVLQLRTGAPQIAPREAAAALEAGTAVVFDVERRSAYERRHVAGARFSVPDRLQEFIADLPASQRIVLTS
    SDGVLARIVAAELAARIGREVHALAGGTQAWAAARLPTGSGPEGVLTGDDDHGYSPYAHADLARRDAGFKQYLDWEVGLV
    AQLEREGDVGIRLVEPASA

    >gi|239814963|ref|YP_002943873.1| arsenate reductase [Variovorax paradoxus S110]
    MQSTRPSITIFHNPACGTSRNTLAMIRNSGEEPHVIEYLKTPPTRETLRELLAAMAVAPRALLRRKGTPYDELGLDDPKW
    SDEQLLDFMLAHPILINRPIVVTPIGTRLCRPSEAVLDILPSPQKGPFTKEDGEPVIDAEGRRVERAA

    >gi|239815052|ref|YP_002943962.1| selenide, water dikinase [Variovorax paradoxus S110]
    MNAALPQAPAAEPRLTSLSHGGGCGCKIAPGVLSEILKGTARMPMPPELLVGIETADDAAVYQLNDEQALIATTDFFMPI
    VDDPFDFGRIAATNAISDVYAMGGKPILALALVGMPINVLSTATIGRILEGGESVCRAAGIPIAGGHTIDSVEAIYGLVA
    LGLVHPKRVKRNAGAKAGDLLVLGKPLGVGILSAALKKEALDAAGYQRMIATTTRLNTPGPELAALDGVHALTDVTGFGL
    AGHALELARGAKLSLEIDWQQVPVLEGVRGLVQSGHVTGASGRNWAGYGSDVALPQNFAEEERALLTDPQTSGGLLVSCA
    PEALDEVLAIFRRHGFDDAAVIGTASAQGSAPRLVIR

    >gi|239815093|ref|YP_002944003.1| OsmC family protein [Variovorax paradoxus S110]
    MKNATKPFVSIEAIRETQNVVRKQPELGNVTFKVRGEAKGGLVFMGETGPLIQNGQADQSRSGKYSATSDEPVSLLGTDT
    GISPAEYILQALGG
    CYTVTLASMAAAKGIELDGIELNLSFDINLNGFLGLDENIRKGAQGINIDVKLESSSSTREQLEEL
    VRELPMNSPIHDTLANPVKVSARLC

    >gi|239815100|ref|YP_002944010.1| DSBA oxidoreductase [Variovorax paradoxus S110]
    MKLVKVEIWSDFVCPWCWIAKRRFESVAKALAEEIQVAPTYKSYRLSPGMVPTGFKAALAKKFGSARAAEELMATVSKQA
    ALDGLIYNFSNMKFGDTTDVHALVKSVASPTLQGLLIDRVFHAYISEGFNIFDRAVLQEIALQSGILSEQVDLDLYESIA
    AIEREEAEATRITGGVPLFVFNSKFVLSGAQPIEVFEQVLRRAAEESLATVTVANAGVCESEGCRI

    >gi|239815135|ref|YP_002944045.1| iron-sulfur cluster assembly protein IscA [Variovorax paradoxus S110]
    MAVTLTEAAARHVTRYLGKRGKGVGVRLGVKTTGCSGLAYKLEYVDEFAPEDVVFEDHGVKVLVDPKSLAYIDGTQLDFV
    REGLNEGFKFINPNERDRCGCGESFRI

    >gi|239815148|ref|YP_002944058.1| glutaredoxin [Variovorax paradoxus S110]
    MHPTHKKSSLHRLSGAALLLVAAGAMAQPIYRNVDKNGKVTFSDRAPTASTEPAAAPQAGITAPANAGLPYELRQVAQRY
    PVTLYSSEE
    CAPCGTARSLLVTRGIPFEERTVKSNQDVEALQRLSNQSSLPLLTIGSQQLKGYSDAEWSQYLDAAGYPKS
    NSLPAGYRNPPARPLVAAQPAPAAREPAPVAQPAPAAPAPSGPSPSNPAGIKF

    >gi|239815156|ref|YP_002944066.1| dihydrolipoamide dehydrogenase [Variovorax paradoxus S110]
    MSEQQIKVPDIGDFDEVAVIEVLVNVGDTVKAEQSLITVESDKASMEIPSSAAGVVKALAVKVGDKVKEGSVVLTLEVDG
    AAAPAPAPTAAAPAPAAAAPAPKAAAPAAAPAAAPAASSYGGKVDVECDVIVLGAGPGGYSAAFRAADLGLKVVLIERYA
    TLGGV
    CLNVGCIPSKALLHVASVMDEVKHFADLGVSFAAPTVDRAKLLGHKNKVVGKLTGGLTAMAKMRKVTVLRGVGNF
    IDPYHLEVEETSGTSWDTTGKKQTVKFRNAIIAAGSQSVSLPFMPKDPRVVDSTGALEMGTDPKRMLVLGGGIIGLEMGT
    VYSTLGARLDVVEMLDGLMQGADRDLVKVWQKMNAPRFDNIMLKTKTVGAEATKEGIKVTFEGEQAPKEPQVYDLVLQAV
    GRSPNGKKIGAEKAGVAVSDRGFIPVDIQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEVIAGEQKGDKELSSAAFN
    ARVIPSVAYTDPEVAWVGLTEDQAKAEGIKIKKGHFPWTASGRAIANGRDEGFTKLLFDAQTHRILGGGIVGTHAGDMIG
    EIALAIEMGADEIDIGKTIHPHPTLGESIGMAAEVAHGTCTDLPPAKKAA

    >gi|239815164|ref|YP_002944074.1| dihydrolipoamide dehydrogenase [Variovorax paradoxus S110]
    MANKQFDVIVIGGGPGGYIAAIRAAQLGFNVACIDEWKNGKGGPAPGGTCTNVGCIPSKALLQSSEHFDQAGHHFADHGI
    KVEGLGLDLDKMLARKDQVVKQNNDGILYLFKKNKITFFHGRGSFVKAGEAGYEIKVAGAAEESIEGKHIIVATGSNARA
    LPGAPFDEENILSNDGALRIGAVPKKLGLIGSGVIGLEMGSVWRRLGAEVTVLEALPTFLGAVDEQIAKEAKKAFDKQKL
    KIELGVKVGEIKSSKKGVSVAWTNAKGEAQTLEVDKLIVSIGRVPNTIGLNAEAVGLKLDERGAIAVDDDCKTSLPNVWA
    IGDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFNTVPWVIYTNPEIAWVGQTEQQLKAAGRAYKAGTFPFLANGRARAL
    GDTTGMVKFLADAATDEILGVHIVGPQASELISEAVVAMEFKASAEDIARICHAHPSLSEATKEAALAVDKRTLNF

    >gi|239815306|ref|YP_002944216.1| thioredoxin [Variovorax paradoxus S110]
    MASDLIKHISDSSFEADVLKSSQPVLVDYWAEWCGPCKMIAPILDEVSTAYEGKLQIAKLNVDENRDIPAKFGIRGIPTL
    MLFKDGQLAATKVGAMSKAQLTAFIDQQLA

    >gi|239815328|ref|YP_002944238.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Variovorax paradoxus S110]
    MARPILSRIALMSVAAGLALPAWAALDIGDPVPKFTANAALGGKTFRYSLAEALAKGPVVVYFFPAADSSDCSIEAHAFA
    EAVDQFAALGATVIGVSADDIDTLSKFSVKSCQSRFPVASDESKSVINGFDALMQTRPDFANRLSYVIAPNGKVAYYYQN
    LNPDKHVERMLNAVRALPRPGAGAPR

    >gi|239815792|ref|YP_002944702.1| heavy metal translocating P-type ATPase [Variovorax paradoxus S110]
    MQAALASFSPAAALPRAPREAWQVLDDPAEWPAFGHALDGGDAGTGRWESQVAVEGMHCAGCGLAVEAALLRVAGVLEVQ
    VNAASQRARVLWSAAQTRPSRWFEASEAAGYRLVPAADGSARERRSRELRLALWRWLVSGFCMMQVMMYAYPAYIAQPGE
    MTPDAAQLLRWASWVLTLPVLFFSCGPFFRSAWRDFRHARIGMDVPVAFGIAIAFAVSTAATFDGAGALGHEVYFDSLTM
    FVFFLLTGRWLEARLRDRTAGSLEAVMNRLPDGVERLGADGGWQRVAVRRLAVGDVVRVRPGEAFPADGVLIDGGTSTDE
    ALLTGESRPVARARGERVLAGSHNLSATVQLRIESVGEGTRFAQIVRLMESAALGKPRLAQLADRLARPFLVLVLVSAAG
    AAAFWWHADPGRALMVAVAVLIVTCPCALSLATPAAMLASAGALARGGVLTSNLQALEALASVDTVIFDKTGTLTGDTPR
    LERVYCRQGLRPGDALEIGAALGAHSLHPGARALVNAWNAQFRAPPGWEVTQPTELAGLGLEGLLRRSGDAGGPARRVRL
    GSASHCSVAPLQVEAPQVHLSDEQGWIASFVLAEELRPDAAAAVAALQAEGVTVRLLSGDRDSAAREIAARAGIEFAQGG
    CTPEDKLAVLWRLQAEGRQVAMVGDGLNDGPSLARANASFAFGRAVPLARARADFVVPGDALAAIPRTIAQARRTLRVVR
    QNLAWAAGYNALCVPLAVMGWLPAWLAGLGMAASSLVVVLNAARLAAPAASEARAVR

    >gi|239815879|ref|YP_002944789.1| methylated-DNA/protein-cysteine methyltransferase [Variovorax paradoxus S110]
    MNAASSSTDSETIEPGFALFETAIGTCALAWGPRGLVGVQLPEENGEAATRARMRLRFADLFEAEPPDSARRAIAAIQGL
    LNGESDDLSGIVLDMSHVSEFHQRIYAIARRIPPGQTRTYGEIAAELGDKGLSRAVGQAMGHNPFAPVVP
    CHRVLAAGNK
    PGGFSAGGGALTKLRMLDIEGARPNGMASLF

    >gi|239815911|ref|YP_002944821.1| protein of unknown function UPF0061 [Variovorax paradoxus S110]
    MSLLAEDTAAADLGLRWKPGFRALGPAFLTELRPTPLPDPPYWVGHSEAAARLLGLPADWRQSEGTLAALTGNLPVAGTL
    PFATVYSGHQFGVWAGQLGDGRAIMLGETEGGLEVQLKGAGRTPYSRGADGRAVLRSSIREFLCSEAMHGLGIPTTRALC
    VTGSDARVYREMPETAAVVTRVAPSFIRFGHFEHFSASQRDAELRALADYVIDRYYPDCRSTSRFNGNAYAAFLEAVSER
    TAALLAQWQAVGFCHGVMNTDNMSILGLTIDYGPFQFLDGFDPRHICNHSDTSGRYAFNQQPNVAYWNLFCLAQALLPLI
    GDQEIAVAALESYKTVFPREFESRMRAKLGLAEPAEGDRALIEGVLKLMAAEKVDYTIFWRRLSQHMAGGNAEPVRDLFL
    DRAGFDAWLLSFSERHAQLPRAQAADLMLRSNPKYVLRNHLGQQAIEAASQKDFSAVATLLALLETPFEEHPGADAYAGF
    PPDWASTIEIS
    CSS

    >gi|239815912|ref|YP_002944822.1| methionine-R-sulfoxide reductase [Variovorax paradoxus S110]
    MTTPIEKTDAEWKALLAEKGAEPAAFEVTRHAATERPFTGKYEAHWDDGTYHCICCGAKLFESSTKFDAGCGWPSFSQEA
    VPGAIRNIVDRSHGMVRTENVCANCGAHLGHVFPDGPTETGLRY
    CMNSASLDFKKK

    >gi|239815933|ref|YP_002944843.1| Disulphide bond formation protein DsbB [Variovorax paradoxus S110]
    MGFPLIDWYFGAPRRAYGLICLACVLMLAFGLYLQHVVGLEPCPMCIVQRYALVLVALFTGLAGVFRSRGLQATGGVLAL
    VAAAGGAYTAAAQSWLQWNPPEVVT
    CGRDLYGMIETFPLKRALPMIFRGGGDCSKVDWSLFGLTLANWSFIAFVVLSVLL
    LVLLFRRPAAR

    >gi|239815939|ref|YP_002944849.1| Peroxidase [Variovorax paradoxus S110]
    MATLRLGDTAPNFTQDSSEGPLDFYQWAGDSWVVFFSHPADFTPVCTTELGKTAALSGEFAKRGVKPIALSVDPATKHKE
    WIGDINETQNTTVNFPIIADHDRKVADLYDLIHPNASATATVRSVFIIDPKKVIRATITYPASTGRNFDEILRVIDSLQL
    TDSHKVATPVNWKDGDDVVIIPSIQDPAELAERFPKGFKAVKPYLRITPQPNK

    >gi|239815968|ref|YP_002944878.1| peptide methionine sulfoxide reductase [Variovorax paradoxus S110]
    MRFPALTAGMLAAAVLAWHAAPSFAEPARRVPAAAVDLTAPPTLKYDTAVFAGGCFWGVQGVFQRVKGVNNAVSGYAGGD
    ARTARYEDVGSGRTGHAEAVRITYDPRQISYGKLLQIYFSVAHDPTQFNRQGPDVGPQYRSTVFAENLEQARVAKAYIAQ
    LNQAKTFNRQLATTIEMSKPFYAAEAYHQDFLTRHPSHEYIVFNDLPKIDDLKKLFPESYRPTPVLVNAAKGG

    >gi|239816255|ref|YP_002945165.1| uncharacterized peroxidase-related enzyme [Variovorax paradoxus S110]
    MADRYPLAELKDLPEDIRTAILAVQEKAGFVPNVFLALARRPAEWRAFFAYHDALMLKEEGSLTKGDREMIVTTTSAANR
    CLY
    CVVAHGALLRIYEKKPLVADQVAVNYRKADITPRQRAMLDFAMKVCERSHEVEDADFAALHAHGFDDEDIWDIASIT
    AFFGLSNRLASFSGMQPNTEFFLMGRLPREKK

    >gi|239816292|ref|YP_002945202.1| DSBA oxidoreductase [Variovorax paradoxus S110]
    MAGMTSHLKIDFVSDVSCPWCAVGLGSLEAALRRVAPGITAELHFQPFELNPQMPPEGQDTFEHLSQKYGSTREQQAESR
    EMIRQRGAEVGFEFSPEGRPRIYNTFDAHRLLHWAELESPARQAALKKLLLKAYFTDRQNPSDHEVLVRLAAEAGLDAAR
    AREILASDEFARETRERERMYTDAGIHSVPAIIINDQHLISGGQPVEVFERALRQIAGAAPASVAVA

    >gi|239816614|ref|YP_002945524.1| Glutathione S-transferase domain protein [Variovorax paradoxus S110]
    MQDPRLPILYSFCRCPYAMRARLALAASGERCELREVVLKNKPPDMLAASPKGTVPVLVLPDAAVLEQSLDIMRWALGRN
    DPLRWLAPEAGTLDGMLALVAACDNHFKPQLDRYKYPGRFADAPAGTARELGAQFLLELEARLASGSGPQLFGARAALAD
    AAVMPFVRQFAMVEPAWFESQPWPLLRAWLAGWTTSPLFERAMHKYAPWAPGEAGAAYPPA

    >gi|239816637|ref|YP_002945547.1| Peroxiredoxin [Variovorax paradoxus S110]
    MAADKHASVHWEGAGKTGKGQVSTETGALKDYPYGFASRFEDDKRGTNPEEIVGAAHAACFTMAFAFALEKEGLTATRID
    TKAAVRLAKDGEGFKIDRIALELDAAVPNLEEAKFQQIAAAAKAG
    CPLSKALASVPEITLKATLAG

    >gi|239816674|ref|YP_002945584.1| Glutathione S-transferase domain protein [Variovorax paradoxus S110]
    MSNKPLTLVSHLLCPYVQRAAIALAEKNVPFERVVIDLANKPDWFIAISPLGKVPLLRLQRPDGSEAVLFESNVICEYLE
    ETQPGPRLHPEDPLTRAEHRAWMEFGSAILGDLWGYETTRDAEVFEQKRLALAAKFERVEAALGAGPYFAGKNFSLVDAV
    FAPIFRYFEVFDEISNSHIFDALPKVNAWRKALAARPSVQSAVVPEYPQHLREFLRKHEAHLLALA

    >gi|239816691|ref|YP_002945601.1| peptide methionine sulfoxide reductase [Variovorax paradoxus S110]
    MSSSSSPTETIVLGGGCFWCTEAVFDRVQGVVDVESGYCNGQVVNPSYEQVCTGRTGHAEVVKVEFDPAAISLREILEIF
    FVVHDPTSLNRQGNDVGTQYRSGIYYTSDAQKQVAEEVIREIEASKTYSAPLVTEVAPLANYSAAEAYHQDYFLNNPNQG
    YCAFVVGPKVEKFQKTFASRVKA

    >gi|239816694|ref|YP_002945604.1| Rhodanese domain protein [Variovorax paradoxus S110]
    MIDQVRPADLAAWFAQHPEAPPVLLDVREPWELQTASVAPQGFTLVAIPMNEIPARLAELDEGQRIACLCHHGARSQRVA
    AFLSQNGFAELANVAGGIDAWSAQHDPSVPRY

    >gi|239816699|ref|YP_002945609.1| methylated-DNA/protein-cysteine methyltransferase [Variovorax paradoxus S110]
    MKFKSKVIYTSHIDTPLGGITMAATDEGLAGVWFDQQRHWPDTTGWQARDDHPALVEAGAQLRDYFAGRRDSFDVKLDLS
    HGTAFQQSVWQALLAIPAGKTMTYGALSANVGNPAAVRAVGAAVGRNPISVIVP
    CHRVLGADGSLTGYAGGLHRKTALLE
    LEAK

    >gi|239816735|ref|YP_002945645.1| arsenate reductase and related [Variovorax paradoxus S110]
    MTTLYGIPNCDTVKRARTWLDDHGVAYTFHDFKKQGVPEVELDQWLRKPGWEALVNRRGTTWRKLDEATRNAVVDAASAR
    AVLLANPSLIKRPVVNWAPKTGVTTGFDAEAWTTVNAVNAVNAV

    >gi|239816846|ref|YP_002945756.1| Rhodanese domain protein [Variovorax paradoxus S110]
    MTTTAFPLLPFAAVRARLLARDETALLDVREEDPFAQEHPLWAANLPLSRIEIEAWRRIPRRDTFIVLYGAHNGTELAPL
    AARTLAAIGYTNLHLLEGGLEGWRAAGGELFRDVNVPSKSFGELVEHERHTPSLSAPEVKALVEGQADVVVLDARRFDEY
    RTMSIPSATSVPGAELVLRVRELAPDPATQVIVN
    CAGRTRSIIGTQSLVNAGIPNPVAALRNGTIGWKLAGQVLDHGADR
    KAPAVVSDAHRVQAQADARRVAERAGVRRIGLDALHALEAPGRTVYRFDVRTPEEYEAGHLPGFASAPGGQLVQETDHQV
    PVRGARIVLADDDGVRASMSASWLAQMGWEVYVPDAVPPASAFTETAAPPPAYPPAAAAVAEISPVELAALLKQQIGTAV
    IDVTTSANYVKRHIPGAWYAIRAQLAGAIDAAIPASQRYVLTCGSSLLARYAAADLRLLLDARGQRDVEVLSLAGGNAAW
    FAAGLEAETGETRLATPRTDRYRRPYEGTDAPAEAMQAYLDWEYGLVAQLARDGTHHFHVI

    >gi|239816935|ref|YP_002945845.1| OsmC family protein [Variovorax paradoxus S110]
    MSITVRRDGITGTRHILKIRNHEIPIDASPAGGGSDAGPQPHDLYDASLAACKALTVLIYARRKGMPVEDIEVIIDRDDS
    EERKGVYRLKSSLRVTGELTEAQRDELLRVAGKCPVHRLMTEVKTEIETGWA

    >gi|239816944|ref|YP_002945854.1| Rhodanese domain protein [Variovorax paradoxus S110]
    MLSMTSFIDPKTLKSWLHDGGEIALLDVREHGQYGEAHLFYGIPLPFSRLELDAPRLMPRRSVRVVAYDGGDSDVAERAA
    RRLAALDYTDVHVLQGGTRAWKAAGHALFAGVNLPSKTFGELAEEAYHTPRVSADQLAEMLARKDKVVVLDGRPVSEFHK
    MNIPTATCCPNGELAYRVRRLVPDTTTPIVIN
    CAGRTRSIIGAQTLINLGLPNPVYALENGTQGWYLNDHALEHGGTRRY
    AADSGNTDLRPAAKALAERFGVPTVTAQTVQQWAGDGSRSLFLCDVRTPEEFAARTLPGAQHTPGGQLMQAGDQYVGVRG
    ARLVLFDDDGVRAPTIAHWLRQMGHEASVLEGGLASGLSLAPAAAPAAPALATIDAEALSARLAQGEVALVDLRPSMQFR
    AGHIPQARWSIRPRLAQDAKSETRQLVLVADDAALAAWAAASELAGLSPAPLLLEGGMAAWRDAGLPVQATPALPADADC
    IDYLFFVHDRHDGNKEAARRYLAWETGLVAQLDAQERSAFRLPTASAARHA

    >gi|239816965|ref|YP_002945875.1| Rhodanese domain protein [Variovorax paradoxus S110]
    MAQLMSLLVQNAIAIVFAASFAARLGLPVPAAAVLVVSGALLAAGNVSVAGVVLAAVLANVLGDGAWFYAGRRFGYRFMR
    LLCRISLSPDSCVRRGESLIGRWGGLSLVAAKFVPGVSVVAPPMAGALGMSVWRFIGFDIGAALVWTVVFLGLGWAFRDQ
    IQEVLAMLAQAGGIATAALVVVLAVMLAVRYWRRRAFMRLTGMPRISVDELHELLASEAPPLVIDVRGEAGVQVDPRRIP
    GALPYTLKALQQRHPELPLVGGRDVVLYCN
    CPNEVSAALAARVLLARGARRALPLTGGLDAWVASGRPTSLH

    >gi|239817070|ref|YP_002945980.1| glutaredoxin 3 [Variovorax paradoxus S110]
    MQAVKMYTTAFCPYCVRAKQILKSKGVEEIEEIRIDSDPAARSTMMEITQRRTVPQIFIGDTHVGGCDDLVALDGRGGLV
    PLLQGA

    >gi|239817071|ref|YP_002945981.1| Rhodanese domain protein [Variovorax paradoxus S110]
    MKLIEFVTANWMLILIALSSGGMLAWPLVRGAGGGTLTAQGAVHLINRERAVLVDVREPEEFATGHMIGAKNVPLNQLEE
    KLTGAVKNKGVPLLLV
    CATGARAQRAVAMAKKLGYEQAQAVSGGLKAWKEANLPVEKA

    >gi|239817074|ref|YP_002945984.1| UBA/THIF-type NAD/FAD binding protein [Variovorax paradoxus S110]
    MDDHDLLRYSRHILLEEFGIDGQARVGAGHALVIGAGGLGSPVALYLAAAGVGHIALVDDDEVDLTNLQRQVAHTNDRVG
    RLKVESAAEAMRAINPDIAIETHALRADEALLSRLVAAADVVVDCCDNFATRHAVNRACVAHGKPLVAGAAIRFDGQLSV
    YDTRDAASPCYACIFPPDAAFEETR
    CAVLGVFGPVVGTIGTLQASEALKLLAGIRPSLAGKLLMFDGRRTAFDTLKIARD
    PHCSVCAQRPA

    >gi|239817177|ref|YP_002946087.1| glutaredoxin-like protein [Variovorax paradoxus S110]
    MSDAQQRIDDLVKTNDLVLFMKGNASFPMCGFSGRAIQILKAVGVDTRTLKTVNVLEDDGIRQGIKEYSNWPTIPQLYVK
    GEFVGGSDIMMEMYESGELQQVLGGGSNAA

    >gi|239817348|ref|YP_002946258.1| electron transport protein SCO1/SenC [Variovorax paradoxus S110]
    MPVPMNKRNALKLIAGGAGWAGMAATLGLGLSACSEAKPSFNAVDITGADYARDFSLKDADGKLRTLADFKGKVVVLFFG
    YAQ
    CPDVCPTTMTEMAQVKQQLGSDGDKLQVLFVTVDPARDTPEVLKAYMGAFDPGFVALIPTADQLAQVAKDFKVYFKK
    VEGKTPTSYSMDHSAASFVYDTDGRLRLYARYGAGVAPMVSDVKALLKS

    >gi|239817393|ref|YP_002946303.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Variovorax paradoxus S110]
    MLILFIAYMGGVLTILSPCILPVLPFVFARADRPFRSHGLPMLMGMALAFAAVATLAAVGGGWIVTLNEYGRHGAIALLA
    LFGLTLLFPGVAERLSRPLVALGLRMSEPRGSDGAAPASGFSPLLLGVGTGLLWAPCAGPILGLILTGAALNGASVGTSL
    LLLAYAAGACTSLAAALLFGGRLLSVMKRSLHTGEWVRRAAGAAVLVGVGAIALGLDTGLLARLSVGTTSALEQALVDRI
    KPGKPQAEPVAAREDAGLLRVSDNRTAPPPARELRVEGRFPSLAGATEWINSAPLAPEALRGKVVLVDFWTYS
    CINCLRT
    LPYLRAWAEKYKDAGLVVIGVHSPEFAFEKQPANVRKAVQDLDIGFPVALDNDFAIWRGFDNQAWPAFYFIDAEGRIRHH
    QFGENRYDKAEQVIQQLLAEAGQTRIAAGLVAPLGQGTQAAPGAEPPLSGETYLGHERAHGFASPGGIVGDHAKAYQPAA
    SALRTNQWSLAGDWTVEAERAVLNSANGRIAYRFQARDLHLVLGPAANRKPVRFRVLVDGKPPLADHGSDTDVQGYGVID
    AQKLYQLVRQAEGSRERLFEIEFLDAGAQAYAFTFG

    >gi|239817395|ref|YP_002946305.1| OsmC family protein [Variovorax paradoxus S110]
    MTRIEKVLYTGKTRTSSGGRDGEARSSDGRLDIKLSSPGSAGSGTNPEQLFAAGWSACFIGAMGKAAGRMKVALPPDLAV
    DAEVDLGTAGSEYFLQARLNVSLPGLDREVAQALTDAAHQT
    CPYSKATRGNIDVSIHLV

    >gi|239817605|ref|YP_002946515.1| thiol:disulfide interchange protein DsbC [Variovorax paradoxus S110]
    MKLARNLLLAACTLAAAATALAGEAEIRKNLPARIPQFPAIDEVTKSPLPGLYEVRVNGFQIYYTDEQGNYLLQGNLIDV
    NARKNLTEERIEKLSQVSFDKLPMKDAIKIVRGSGKRKLAVFEDPN
    CGYCKRFEKDMKTVDNVTVYLFLYPVLGPDSAVK
    SRDIWCSKDKGKAWGDWMETSVKPATAATSCDVTALQRNVEFGRKYNITGTPTLIFSDGTRTPGAIPADQVEKQLAASIN


    >gi|239817637|ref|YP_002946547.1| iron-sulfur cluster assembly accessory protein [Variovorax paradoxus S110]
    MSAVAENIQTQMPEPIVFTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMTKNGVSLLIDA
    MSYQYLVGAEIDYKEDLQGAQFVIKNPNATSTCGCGSSFSA

    >gi|239817687|ref|YP_002946597.1| Thioredoxin domain protein [Variovorax paradoxus S110]
    MTSEYKTEQPDRAEIDALKGPAVVEFGTNWCGICKAAQPHIAEAFAKYPDIPRIKVEDGSGRPLGRSFNVRLWPTLVFMR
    DGQQVAKLVRPEDSQSIADALALIAQPG

    >gi|239817817|ref|YP_002946727.1| thioredoxin [Variovorax paradoxus S110]
    MTDTPSLHIVCPHCHTTNRVRAAQLGSAPDCGNCHRALFTGHSTALPDEKTFDRHIARNEIPVLVDFWAPWCGPCRQMAP
    GYEQAAAQLEPQVRLAKVDTEAVPALGARFNIRSIPTLALFRGGREVARQAGAMGAADIVRWVKAHGAG

    >gi|239817861|ref|YP_002946771.1| Redoxin domain protein [Variovorax paradoxus S110]
    MKKYITVAAVALALAAGVGVYLGSGTTEAPASTFVLLDGSKKSTNDLKGKVTLVNFWATSCVTCVAEMPKVIATYDKYKS
    KGYDTLAVAMSYDPPSYVVNFAETRKLPFKVAIDNTGSVAQAWGDVKLTPTTYLVNKKGEIVKRYVGEPDFAELHKLIEK
    LLAEA

    >gi|239817863|ref|YP_002946773.1| Redoxin domain protein [Variovorax paradoxus S110]
    MIKVGDTLPSATLQEYSEVEGEGCSIGPNPVDVSKATAGKTIALFALPGAFTPTCSAKHVPGYVQHYDDFKAAGVDEIWC
    VSVNDAFVMGAWARDQKTGAKVRMLADGSADFAKATGLTLDLTGRGMGLRSNRYSMLVKDGKVATLNVEAPGKFEVSNAE
    TLLAQARG

    >gi|239817915|ref|YP_002946825.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Variovorax paradoxus S110]
    MPTFDFDLFVIGGGSGGVRAARMAAQQGVRVGLAEAADLGGTCVNVGCIPKKLYSYAAGYAESFEEAAGYGWQLPQAPQF
    DWAHLKAQRAKEIKRLNGVYASLLKNSGVVLVTGWAQLLDGHTVEVDGKRHTARHLLVATGGTPYVPDFPGREHVATSDA
    MFDLDPFPKRLLVVGGGYIACEFASIFNGLGAQVTQLHRRAHLLTGFDDDVRQFLANEMGKAGVDVRLNCEAASITRGAH
    GLTVTLERGQQIEADTVLFATGRVPNTQGLGLEAAGVKLDERGAIAVDAHYRSSVPSIHAVGDVSTRVQLTPVALAEAMV
    VVDELFGKGRRRLDYEFIPTAVFTHPNIGTCGYTELDARAKFGDVAVFSSEFKSLRHTLSGRTERTFMKLVVDKASDRVV
    GLHMVGADAGEVVQGFAVAMRAGATKALFDSTIGIHPTAAEEFVTMREPMPG

    >gi|239817927|ref|YP_002946837.1| OsmC family protein [Variovorax paradoxus S110]
    MTTKLDKVLYTAEAHTIGGRDGAGKSSDGAIDVKLSSPGSGKPGTNPEQLFAVGYAACFIGAMKAVGPKIGVKVPEDVAI
    DSSVSLGPTNGGAAYGIAVKLAITLPGLDAEQKQKLVDAAHQV
    CPYSNATRGNIDVELSIA

    >gi|239818052|ref|YP_002946962.1| thioredoxin [Variovorax paradoxus S110]
    MIDITLENFQAELIEGSVATPVLLDIWAEWCGPCKQLGPVLEKLETEYAGRFTLAKLDADKVPQISSQLSEMFGVRSIPF
    CVMFKDGQPVDGFVGAIPADKIREFLDKHVPAAEQLEAASQEAAAQEALAEGDTEGALERLQHAVATDPANDDARFDYIK
    LLLQMGRIDDAKVAFAPVIARTTLVRRFDSLQRWMDAIDFAAPASGAAPAIAEFDAKIAAGKRDFDARFGRARLLMAEQR
    WTDAMDELLEILMRDKAWNEELARKTYIAILDLIEPPKVKVADGQIPPDDPVVATYRRRLSSVVLS

    >gi|239818120|ref|YP_002947030.1| alkylhydroperoxidase like protein, AhpD family [Variovorax paradoxus S110]
    MSSTTTPRLAWFKIAPKAFQAMIAVNGAIESSSLGKVLIDVVFARVSQINGCAYCLDMHVRDLRQQGEDWQRINSLATWR
    EVSFFSERERAALDWAETLTRLPGHHEARDAEFEALQAHFSELEIVELSIAIAQINAWNRMGVGMRLPVAAKAMP

    >gi|239818123|ref|YP_002947033.1| Peroxiredoxin [Variovorax paradoxus S110]
    MRIPAALAACLLAAGTAVAQAPSPNSSPSPTAAPADGTAAAACPSTLQHTFPRLQDEKPQSLCQYAGKVVLVVNTASFCG
    FTPQYKGLEALDSKYRARGLVVLGFPSNDFAQESGSNKEIADFCESTFGVKFPMFAKSSVRGANANPLFKQLALASGTTP
    KWNFYKYLIGRDGKVVQAWSSMTAPDESAFVKVIESQLAAGG

    >gi|239820019|ref|YP_002947204.1| dihydrolipoamide dehydrogenase [Variovorax paradoxus S110]
    MAHMVEVKVPDIGEFKDVAVIELLVKPGEVIAVDTGLIMVESDKASMEIPSSHAGTVKELKVGLGDKVSEGSVILVIETA
    AAGAGAPPPQPSPASGRGSEAAAAPAPVPAPAAGSYAGKVDLECEVLVLGAGPGGYSAAFRSADLGMKTVLVERYATLGG
    V
    CLNVGCIPSKALLHTAGVMDEVKLLARHGIRYTAPEVDIDALRGFKDGVIKKLTGGLAGMAKARKVEVVTGVGSFLDAH
    HVEVVGGGGGKRVLKFAKAIIAAGSQAVKLPFMPEDERVVDSTGALLLKSIPRRMLVIGGGIIGLEMATVYSTLGTRIDV
    VEMLDGLMQGADRDLVKVWEKFNAPRFDNVMLKTKTVGAKATQAGIEVSFEGEKAPKEAQVYDLVLVAVGRSPNGKKIAA
    DKAGVAVTERGFIEVDRQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEVAHGEAAYFDARQIPSVAYTDPEVAWAGK
    TEEQCKAEGLKVGKAVFPWAASGRAIANGRDEGFTKLLFDEATHRIVGGGIVGTHAGDLIGELCLAIEMGCEPADIGKTI
    HPHPTLGESIGMAAELFEGVCTDLPPVKKK

    >gi|239820075|ref|YP_002947260.1| alkylhydroperoxidase like protein, AhpD family [Variovorax paradoxus S110]
    MTNRLNYIKQSPELFKKLIEFSTLVDSGTIEQSIRDLVAIRASQINGCAFCLDMHIKEARIHGERELRIHHLAAWRESTL
    FVPRERAALAWTEVLTRLPEHGVPDDIYERVRTQLSEKELSDLSFSVMAINAWNRVNVAFQTVPGSSDKAFGLDKANLS

    >gi|239820104|ref|YP_002947289.1| Glutathione transferase [Variovorax paradoxus S110]
    MKLYHMPGACSLADLIVLQWIGADHEPVRMSLDSIKSPDYLAINPGGTVPLLAHGDLSLTENVAILGYLADLYPEARLLG
    DGSPRARAEVMRWLGFLNSDVHKAFKPIFTPQRFLKDAAMAPVLADNARGHVREYLARLDGQLEGRDWLTGERSIADPYL
    FVLSRWSAAKKVDMQGLDNLARFARMMDADAGVQAALDAERSMPQ

    >gi|239820106|ref|YP_002947291.1| OsmC family protein [Variovorax paradoxus S110]
    MPTRPFEFLNRNGHRLSGSLEMPEGIPRGWALFAHCFTCGKNNLAAVRIARTLASVGIGVLRFDFTGLGGSEGNFADASF
    SLNVQDLVSAASAMEAAGMPPRLLIGHSLGGSAMLAAADRIAGAHAIATIAAPFDVAQVLHLLDPAGLARLQTEEQALVQ
    VVGRPMAVGKAFVDDLRTHDPGARIAALHRPLLLLHAPQDRTVDIENATRIFLAARHPKSFVSLDDADHLLSKREDAEQV
    ARLIATWADRYLPEPAAGRPVAADAEAEETGLGKFQLALRSGGSRWLADEPETVGGLGSGPTPYNLLSSALAA
    CTTMTLR
    HYADSKGWPVTRIRTAVNHRKDKAISPPDVFSRRVSIDGAITEAQRTQLLDMAQRCPVHRTLEGGARFEPVEGEPPA

    >gi|239820110|ref|YP_002947295.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Variovorax paradoxus S110]
    MSTTSSSDSAADAVFDATGIAARAKRAGDLAPDATLPDGAGRLVRLSDEWRKGPLVLVFYRGGWCGYCSLQLRAWHQRAD
    DLARLGATLLAISPQTPDHSMRTAEDNQFTFTVLSDSNLEAASGFELAFTLPPELVSFYGSVGTDIPVLNGNGLWVLPVP
    ATYVIDEDGRIRFAHIEEDIRKRAEPADVLRAIEDMVRGRALAAASAP

    >gi|239820112|ref|YP_002947297.1| alkylhydroperoxidase like protein, AhpD family [Variovorax paradoxus S110]
    MTQRVNYVEQSPELFKKFVEFLNAIKEGAIEEPIRNLVSIRTSQLNGCAFCLDMHVKQARIQGERELRLYHLAAWRESTL
    FIPRERAALAWTEVLTRLPEQGVPDDIYERVRTQLSEKEISDLTFLVMSTNAWSRLNIGFKSVPGASDKVFGLDKAKLA

    >gi|239820115|ref|YP_002947300.1| OsmC family protein [Variovorax paradoxus S110]
    MPTPKDTVPVSAAQAVQSSPLQPPPVTLLDKYKGQEFEPIYSTVVTVSGGEAEHGRASGVARSDDGNLNLELRLPAALGG
    GGGGTNPEQLFAAAYAACFHGALNLLAAKKKIPVHDATVEASVVFGRDPVDGLFVLTADVRIHLPDVEKSVAEELVRSTE
    RF
    CPYAKMARNGITSIVALAA

    >gi|239820187|ref|YP_002947372.1| L-carnitine dehydratase/bile acid-inducible protein F [Variovorax paradoxus S110]
    MKNHLSMQPLAGVRVLDLSRVMAGPLCGMALADLGADVIKVEHPERGDDTRDWGVRIGRHNTSYFNSCNRNKRSICVDLQ
    DEDGQALVRELAAQCDVVIQNFKYGGAQKMGLGYEDLRKLNPGIIY
    CSISGYSVLGPEKARPGYDLVIQGETGLMAMNGE
    EGQGPLKFGIAAVDMFTGMYSAQAILAVLYERTRTGEGRHIQMSLYDSGMMITSYYGLTAWLNEGDPAKFGNSHPSIVPY
    GVFEAADGPLVIAVGNNSQFRKFCDEVILCPELPADPKFATNTERAKHRHELLPILLGRIAQFPRADLLARMDKAGIPCG
    EVLGLYEALQSERTAQAGVWHRFEDAEAGAQAVHAPPYVIDGARSDVRHPPPHLGEHTGEVLRELLEMGEGRLDSLVRRS
    VIR

    >gi|239820428|ref|YP_002947613.1| manganese and iron superoxide dismutase [Variovorax paradoxus S110]
    MDARIQPLPFDPAMLRGLSEKLLASHHQNNYGGAVKRLNAIRAQLAATPFASTPGFQLNGLKREELIASNSMLLHELYFA
    SLGGDGQSMEPAMALALAASFGSAERWREEFAALGKALGGGSGWVLLAFQPREGTLVNQWAADHTHALAGATPILALDMY
    EHAYHLDHGAAAGAYVDAFMDNIHWGQVYARYQQAVHAASEPFGATQDEIAGSVLLDVRRAGVFERAAAMLPGARWRDPA
    AVDSWASELPAGSDVVVY
    CVYGHEVGRSTAMRLRAAGLNARYLRGGIDGWQAAGGPLEARAGVQGAAP

    >gi|239820580|ref|YP_002947765.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Variovorax paradoxus S110]
    MAERAVDAIIIGAGQAGPSLAGRLDATGHKVVLIERHLVGGTCVNTGCKPTKTLIASAYAAHTARRGSDYGFSVASPVTM
    DMPAVAARARKVILDSRRGNEEWLAGMRNVELIRGHARFVAEGTVDVNDQRLTAPKIFINVGARAQVPDLPGVDEVPFLT
    NTDMVALETLPRRLVIVGGSYIGLEFAQMYRRFGAEVTVVERADRLIAREDPDVSSAVREILEAEGIAIRTGAECISFKA
    HETGVCVDVDCKEGEPSVTGTHVLLAMGRRPNTDDLGLAQAGIAVDARGYIGVDDQLQTNVPGIWALGDCNGRGAFTHTA
    YNDFEIVAANLLDGADRRVSQRLPGYALYIDPPLARVGMTDAEAAKDGRRLLYSKRSMTRVGRAVEKGESQGFMKVVADA
    DSRKILGAAILGTGGDEAIHGILDMMHADQTIDTLRWAVPIHPTVSELIPTVLLDLSAKGP

    >gi|239820816|ref|YP_002948001.1| Redoxin domain protein [Variovorax paradoxus S110]
    MTTRSNVLIGIAAVAASVGIFTAAAAPSGGDIPASAAQTAPEFQNIDQWLNSPPLKLQDLRGKVVLVDFWTYTCINCLNH
    LPYVQAWNEKYKDKGLVVVGVHTPEFAYEKSTRNVQDAISRLQIKHAVAQDNHYATWKAFNNQYWPAVYLIDKQGKIVYS
    HFGEGSYATTEKKIQSLLAEPASAAGS