Ureaplasma urealyticum serovar 10 ATCC 33699 uid59011

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|209554196|ref|YP_002284493.1| thioredoxin-disulfide reductase [Ureaplasma urealyticum serovar 10 str. ATCC 33699]
    MNQQIYDLVIIGAGPAGLAAAVYAKRSGLNVIIVEKQFPGGKVALTANVENYLGINSISGPELAYKMYEQVLNLDILVIY
    ELADEITLKEKYKEVKLATQTLIAKTVIIATGTENRRLNIPGELTFENKGISY
    CAICDGPLYKNKVVSVIGSGNSAVEEA
    IYLATIAKEVHLIANKPEFKAERQMVEIVKNTSNIKIHYNKQTFEFFGEEFLQGLRFKDLVTNEITTLNVEANFTFIGLL
    PSRINASNLNIFNETNGFITTNKNMETNVHGIFAAGDIVDKSVRQIATAINDGVIAALYAKEYITRNNW

    >gi|209554494|ref|YP_002284572.1| hypothetical protein UUR10_0167 [Ureaplasma urealyticum serovar 10 str. ATCC 33699]
    MIYVLYSPNCAVCKKVVRFFRNNQIEITKIIIGEDKIERSMLIDILSLCEDGFGTIISFKTESSKRLNITSKTFLDLSTK
    ELLNLIQEDLNLIRRPLIYQTKNNKPYRLQIGYDSEEIEIFKRVVHEGR

    >gi|209554181|ref|YP_002284689.1| methionine sulfoxide reductase A [Ureaplasma urealyticum serovar 10 str. ATCC 33699]
    MVKSIWVAGGCFWGIQKYFDSIKGVRHTIVGYSQGNVINPSYEQVCTQTTNHTETVQVDYDDRFVSLTSILEHLYQIIDP
    FSLNKQGEDIGNQYRSGIYYVDHEDALIIKNFLLQKQNQTSKKIMIEVHKLHNFNIAEEYHQKYLDKNPNGYCHVNLSLS
    KKRFN

    >gi|209554233|ref|YP_002284691.1| glutathione peroxidase [Ureaplasma urealyticum serovar 10 str. ATCC 33699]
    MKLSDYPVLDIDKKLFDWSKIKNKLVLIVNVASKCGYAKQYEQLEYLYQKYKNKGFVIIAFPCRQFMFQEFDDNNKIKEF
    CTTKYNVSFPIMYLTNVIGSNISPLYKQLITEYPWSPKAKAVKWNFEKFFVKNDEVIGRFESKCEPNDLEEFIKNNL

    >gi|209554592|ref|YP_002285044.1| thioredoxin [Ureaplasma urealyticum serovar 10 str. ATCC 33699]
    MLIKLENNQNLNQILKDNHSKPVLIDFYADWCPPCRMLSPVLDSIEKKYGDEFTIIKVNVDHFPELSAQYQVKSIPSLFY
    VKNEEIKTNSLGFIDENSLVNKLRSI