Bacillus subtilis spizizenii W23 uid51879

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|305672900|ref|YP_003864571.1| glutaredoxin [Bacillus subtilis subsp. spizizenii str. W23]
    MLKLYQREPCPYCKPVREKLTELNVTYINVNLPKDRALRTELIEKTGVPYIPALIDEEDNVIISGKLEYNQHVLDYIEKK
    FGQNR

    >gi|305673169|ref|YP_003864841.1| putative thioredoxin or thiol-disulfide isomerase [Bacillus subtilis subsp. spizizenii str. W23]
    MKKITTNEQFNELIQSDKEIIVKFYADWCPDCTRMNMFIGDILEEYNQNDWYELNKDELPELAEKYQVMGIPSLLIFKNG
    EKTAHLHSANAKTPEEVTEFLSEHIS

    >gi|305673230|ref|YP_003864902.1| hypothetical protein BSUW23_02675 [Bacillus subtilis subsp. spizizenii str. W23]
    MSQRVSYYDVAPEGMKMMMDMEKYTKQSSINRTTRELIKIRVSQINGCAFCLDMHTSDARKMGETEQRIYCLHAWNECDF
    YSPEEKAALELSEHITLIPSKRVPDVLYHRVREHYDEKQYVDLVLIINQINSWNRISIAMGNQATSR

    >gi|305673246|ref|YP_003864918.1| putative thioredoxin or thiol-disulfide isomerase [Bacillus subtilis subsp. spizizenii str. W23]
    MNEMTELHSLDAIDDFIKQHQFSFIYISRPGCTVCHAVLPQLRILLDQFPNITLGHINADDVEEVAGRFSVFTVPVLLLF
    IDETEFLREARFVHFEQLEERLKRVYQLYQDE

    >gi|305673514|ref|YP_003865186.1| dihydrolipoamide dehydrogenase [Bacillus subtilis subsp. spizizenii str. W23]
    MTLAIIGGGPAGYAAAVSAAQQGRNVLLIDKGPLGGTCLNEGCIPTKSLLESANVLDKIKDADHFGIELPAGAISVDWSK
    MQNRKQQVVRQLVQGVQYLMKKNQIQVVKGKASFLSDRKLLIEGVNGKEIREADQVLIASGSEPIELPFAPYDGEWIIDS
    KDALSLSEIPSSLVIVGGGVIGCEYAGLFARLGSKVTIIETAGQLIPAEDEEIARLFQGKLEEDGVEVHTSSRLERVDQT
    AKTAIWKSGQREFKTKADYVLVAIGRKPRLDGLQLEQAGVDFSPKGIPVNGHMQTNVPHIYACGDAIGGIQLAHAAFHEG
    IIAASHASGRDVKINEKHVPRCIYTSPEIACIGLTEQQARSVYGDVKIGEFPFSANGKALIKQQAEGKVKIMAEPEFGEI
    VGVSMIGPDVTELIGQVAAIMNGEMTADMAEHFIAAHPTLSETLHEALLSTIGLAVHA

    >gi|305673569|ref|YP_003865241.1| putative bacterioferritin comigratory protein; putative peroxiredoxin [Bacillus subtilis subsp. spizizenii str. W23]
    MTIEIGQKAPDLELKGDHGETVTLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKF
    KEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLVKEWRKVKVKDHVAEALQTLKDMSEK

    >gi|305673852|ref|YP_003865524.1| redox-sensitive regulator enzyme [Bacillus subtilis subsp. spizizenii str. W23]
    MVTLYTSPSCTSCRKARAWLEEHEIPFEERNIFSEPLSIDEIKQILRMTEDGTDEIISTRSKVFQKLNVNVESMPLQDLY
    RLINEHPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRKVRSFQLREAQRLAN

    >gi|305673873|ref|YP_003865545.1| bifunctional adenylate transferase/sulfur transferase [Bacillus subtilis subsp. spizizenii str. W23]
    MTDRYSRQELFAPIGPAGQKKLKEARAVIIGAGALGTASAEMLVRAGVGSVKIADRDYVEWSNLQRQQLYTEDDVRKEIP
    KAAAAEHRLRSINSDVDVTGLVMDVTAENIFELIKGASIIVDAADNFETRLIVNDAAVKEGIPFLYGACVGSYGLTFTVV
    PGSTPCLHCLLDTLPIGGAT
    CDTVGIISPAVLQVAVFQVTDALKLLTGEECEPVLRSFDLWKNERSEVRAAGLKHDACPS
    CGTKDFPFLSYENQTKAAVLCGRNTVQIRSSFTKEADLEVLAGQLRQAGLEVAANPYLISCRSDDMKMVLFRDGRALIHG
    TNDIARAKSIYHKWIG

    >gi|305674031|ref|YP_003865703.1| peroxiredoxin [Bacillus subtilis subsp. spizizenii str. W23]
    MSQPLFTATVSAVGGREGKVISSDHVLELDVAMPGTPRAKKLEKATNPEQLFAAGYAACFDSALQLVARTERVKVETEVT
    AHVSLLKDEADQGYKLGVTLQVKGKGVSASELQALVQKAHGV
    CPYSKATSGNIDVTLEVAE

    >gi|305674033|ref|YP_003865705.1| organic hydroperoxide resistance reductase B [Bacillus subtilis subsp. spizizenii str. W23]
    MALFTAKVTARGGRAGHITSDDGVLDFDIVMPNAKKEGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDSEVEGQVS
    LMKDESDDGFKIGVTLVVNTKNLDRDKAQELVNAAHDF
    CPYSKATRGNIDVKLELK

    >gi|305674075|ref|YP_003865747.1| O6-alkylguanine DNA alkyltransferase [Bacillus subtilis subsp. spizizenii str. W23]
    MNYYTTAETPLGELIIAEEGGQITRLFLSQEDWMDWKETVQHTEHKETPYLAEAKKQLHEYFAGERKTFSLPLSQKGTPF
    QQKVWEALAMIPYGESRSYADIAAAVGSPKAVRAVGQANKRNDLPIFVP
    CHRVIGKNSALTGYAGSKTDIKAFLLNIEQI
    SYKEK

    >gi|305674105|ref|YP_003865777.1| thiol-disulfide isomerase [Bacillus subtilis subsp. spizizenii str. W23]
    MTKRLLTVCLMLLGMIAWFPDVAAAEDKQPAVPAVFLMKTIEGEDISIPHKGQKTILHFWTSWCPPCKKELPQFQSFYNA
    HQSDGVKLVTVNLVNSEQNQQAVEDFIKANKLTFPIVLDSKGELMKEYHIITIPTSFLLNEKGEIEKTKIGPMTAEQLKE
    WTEE

    >gi|305674146|ref|YP_003865818.1| putative 2-cys peroxiredoxin [Bacillus subtilis subsp. spizizenii str. W23]
    MAERMVGKQAPRFEMEAVLASKEFGKVSLEENMKNDKWTVLFFYPMDFTFVCPTEITAMSDRYDEFEDLDADVIGVSTDT
    IHTHLAWINTDRKENGLGKLKYPLAADTNHEVSREYGVLIEEEGVALRGLFIINPEGELQYQTVFHNNIGRDVDETLRVL
    QALQTGGLCPANWKPGQKTL

    >gi|305674147|ref|YP_003865819.1| thiol-disulfide isomerase [Bacillus subtilis subsp. spizizenii str. W23]
    MKLRQPMPELTGEKAWFNGEVTREQLIGEKPTLIHFWSISCHLCKEAMPQVNEFRDKYQDKLNVVAVHMPRSEDDLDLGK
    IKEVAAEHDITQPIFVDSDHALTDAFENEFVPAYYVFDKTGQLRHFQAGGSGMKMLEKRVNRVLTETEQASE

    >gi|305674151|ref|YP_003865823.1| thiamine/molybdopterin biosynthesis adenylyltransferase [Bacillus subtilis subsp. spizizenii str. W23]
    MEERYSRQIRFKQIGEIGQKRLGDSHVLVVGAGALGTAGAEGLSRAGVGTITLIDRDYVEWSNLQRQQLYTESDAKLRMP
    KAMAAKEHLSAINSGIHIEAYVAEGTAETLEPLIEKADVVIDATDNFETRMLINDLAQKTKTPWVYGACVSSQGMFMTII
    PGVTPCLSCLFEQIPVGGAT
    CDTAGIIPPAVHIVSAYQQAEALKLLTGQTDAIQRGFVTFDVWNNSHMEINVDHVRREDC
    PSCGAHAVYPYLQDWNTPKAAVLCGRDTVQVRSESLKRIPKQELIKRLKTIGKVEANAFLLHIFYEDFRIVIFNDGRALV
    HGTNDVKEANSVLARVIGL

    >gi|305674188|ref|YP_003865860.1| dihydrolipoamide dehydrogenase [Bacillus subtilis subsp. spizizenii str. W23]
    MVVGDFPIETDTLVIGAGPGGYVAAIRAAQLGQKVTVVEKATLGGVCLNVGCIPSKALINAGHRYENAKHSDDMGITAEN
    VSVDFTKVQEWKASVVNKLTGGVAGLLKGNKVDVVKGEAYFVDSNSVRVMDENSAQTYTFKNAIIATGSRPIELPNFKYT
    ERVLNSTGALALKEIPKKLVVIGGGYIGTELGTAYANFGTELVILEGGDEILPGFEKQMSSLVTRRLKKKGNVEIHTNAM
    AKGVEERPDGVTVTFEVKGEEKTVDADYVLITVGRRPNTDELGLEQVGIEMTDRGVVKTDKQCRTNVPNIYAIGDIIEGP
    PLAHKASYEGKIAAEAIAGEPAEIDYLGIPAVVFSEPELASVGYTEAQAKEEGLDIVAAKFPFAANGRALSLNETDGFMK
    LITRKEDGLVIGAQIAGASASDMISELSLAIEGGMTAEDIAMTIHAHPTLGEITMEAAEVAIGSPIHIVK

    >gi|305674461|ref|YP_003866133.1| putative peroxiredoxin-related protein [Bacillus subtilis subsp. spizizenii str. W23]
    MADHHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSGLEKEDLQMES
    EGIVDVTKGVFTYKKIIHRPSVVLKHDASPEDVALAHKLCEKAESS
    CMISRAIQGNVELQLEASVKRAGE

    >gi|305674534|ref|YP_003866206.1| putative membrane-bound proteins with a thioredoxin-like domain [Bacillus subtilis subsp. spizizenii str. W23]
    MLKKWLAGILLIVLAGYMGWNLYQTYSKKEVGIEEGQQAPDFSLRTLSGEKSSLQDTKGKKVLLNFWATWCKPCRQEMPA
    MEQLQKKHADELAVVAVNFTSAEKSEKQVRAFADTYDLTFPILIDKKGINADYNVMSYPTTYILNEKGVIQDIHIGTMTK
    KEMEQKLDLD

    >gi|305674798|ref|YP_003866470.1| peptide methionine R-sulfoxide reductase [Bacillus subtilis subsp. spizizenii str. W23]
    MAYNKEEKIQSLNRMQYEVTQNNGTEPPFQNEYWNHKEEGLYVDIVSGKPLFTSKDKFDSHCGWPSFTKPIEEEEVEEKL
    DTSHGMIRTEVRSRTADSHLGHVFNDGPGPSGLRY
    CINSAALRFVPKDKLKEEGYESYLDLFNK

    >gi|305674799|ref|YP_003866471.1| peptide methionine S-sulfoxide reductase [Bacillus subtilis subsp. spizizenii str. W23]
    MSEKKEIATFAGGCFWCMVKPFDEQPGIEKVVSGYTGGHTENPTYEEVCSETTGHREAVQITFNPDVFPYEKLLELFWQQ
    IDPTDAGGQFADRGSSYRAAIFYHNDKQKELAEASKQRLAESGIFKDPIVTDILKAEPFYEAEGYHQHFYKKNPGHYQRY
    RTGSGRAGFISEHWGAK

    >gi|305674805|ref|YP_003866477.1| assembly factor BSco of the Cu(A) site of cytochrome c oxidase [Bacillus subtilis subsp. spizizenii str. W23]
    MKVIKGLTAGLFFLLLCACGGQQIKDPLNYEVEPFTFQNQDGKNVSLESLKGEVWLADFIFTNCETVCPPMTAHMTDLQK
    KLKAENIDVRIVSFSVDPENDKPKQLKKFAANYPLSFDNWDFLTGYSQSDIEAFALKSFKAIVKKPEGEDQVIHQSSFYL
    VGPNGKVLKDYNGVENTPYDDIIADVKSASTLK

    >gi|305674821|ref|YP_003866493.1| putative peroxidase [Bacillus subtilis subsp. spizizenii str. W23]
    MSIYDMRVRTITGKDMTLQPFAGKVLMIVNTASKCGFTPQLKQLQELYDTYQQEGLEILGFPCNQFMNQEPGDEADIQDF
    CETNYGVTFPMFSKVEVNGKNAHPLYVYLTEHAKGMLGTKAIKWNFTKFIVDRNGEIIGRYPPNTNPKELEDVILKLLGQ


    >gi|305674951|ref|YP_003866623.1| cytochrome c maturation extracytoplasmic thioredoxin [Bacillus subtilis subsp. spizizenii str. W23]
    MKKKRRLFIRTGILLVLICALGYTIYNAVFAGKESISEGSDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKE
    FPYMANQYKHFKDQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTM
    TESMIHDYMNLIKPGETSG

    >gi|305675009|ref|YP_003866681.1| hypothetical protein BSUW23_11660 [Bacillus subtilis subsp. spizizenii str. W23]
    MNIHVTDAAKQALQQAFDANPGKKAQLRYDAEGCGCAVSGVPTIWLAEELTGQCEQLETNGIPLYIQSSQKVFFDDQMTI
    DYNEKAKTLALKSPAEMLSPRMSILVK

    >gi|305675054|ref|YP_003866726.1| branched-chain alpha-keto acid dehydrogenase E3 subunit (dihydrolipoamide dehydrogenase) [Bacillus subtilis subsp. spizizenii str. W23]
    MATEYDVVILGGGTGGYVAAIRAAQLGLKTAVVEKEKLGGTCLHKGCIPSKALLRSAEVYRTAREADQFGVETAGVSLNF
    EKVQQRKQAVVDKLAAGVNHLMKKGKIDVYDGYGRILGPSIFSPLPGTISVERGNGEENDMLIPKQVIIATGSRPRMLPG
    LEADGKHVLTSDEALQMEELPKSIIIVGGGVIGIEWASMLHDFGVKVTVIEYADRILPTEDQDISKEMESLLKKKGIQFV
    TGAKVLPDTMTKTSEDISIQAEKDGKTVTYSAEKMLVSIGRQANIEGIGIENTDIITEKGVISVNESCQTKESHIYAIGD
    VIGGLQLAHVASHEGIIAVEHFAGLNPHSLDPTLVPKCIYSSPEAASVGLTEDEAKENGHNVKVGKFPFMAIGKALVYGE
    SDGFVKIVADRDTDDILGVHMIGPHVTDMISEAGLAKVLDATPWEVGQTIHPHPTLSEAIGEAALAADGKAIHF

    >gi|305675105|ref|YP_003866777.1| putative sulfur transferase [Bacillus subtilis subsp. spizizenii str. W23]
    MSNMIVLIIFAAFIIYMIASYVYQQRIMKTLTEEEFRAGYRKAQLIDVREPNEFEGGHILGARNIPLSQLKQRKNEIRPD
    KPVYLY
    CQNSVRSGRAAQTLRKNGCTEIYNLKGGFKKWGGKIKAKK

    >gi|305675129|ref|YP_003866801.1| transcriptional regulator of stress [Bacillus subtilis subsp. spizizenii str. W23]
    MEQLIFYSYPSCTSCRKTKHWLKAHQIEFNERHLFRETPTVEELRYILSLTTEGIDEILATRSQTFKNLNLNIEEMTVNE
    VLELLIEKPKLLRRPILVDNKKLVIGYNPGELLKLSKKKTVHQSA

    >gi|305675439|ref|YP_003867111.1| thioredoxin [Bacillus subtilis subsp. spizizenii str. W23]
    MAIVKATDQSFSAETSEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKD
    GEVVETSVGFKPKEALQELVNKHL

    >gi|305675531|ref|YP_003867203.1| thiol peroxidase [Bacillus subtilis subsp. spizizenii str. W23]
    MAEITFKGGPVTLVGQEVKVGDQAPDFTVLTNSLEEKSLADMKGKVTIISVIPSIDTGVCDAQTRRFNEEAAKLGDVNVY
    TISADLPFAQARWCGANGIDKVETLSDHRDMSFGEAFGVYIKELRLLARSVFVLDENGKVVYAEYVSEATNHPNYEKPIE
    AAKALVK

    >gi|305675566|ref|YP_003867238.1| putative thiol-disulfide oxidoreductase with thiroedoxin domain [Bacillus subtilis subsp. spizizenii str. W23]
    MKKIESTQELEKAVKDDWAVFMFSADWCPDCRFVEPLLPELEANFPEFTYYYVDRDKFIDTCAEWEIYGIPSFVVFNEGK
    EVNRFVSKDRKTKEEIEQFLTDSLAKA

    >gi|305675587|ref|YP_003867259.1| putative NAD(FAD) dehydrogenase [Bacillus subtilis subsp. spizizenii str. W23]
    MIKMKQYDVIVIGGGPSGLMAAIAAGEQGADVLLIDKGNKLGRKLAISGGGRCNVTNRLPVEEIIKHIPGNGRFLYSAFS
    EFSNEDIIKFFENLGIQLKEEDHGRMFPVTDKAQSVVDALLNRLKQLGVTIRTNEKIKSVIYEDGQAAGIVTNNGEMIHS
    QAVIIAVGGKSVPHTGSTGDGYEWAEAAGHTITELFPTEVPVTSAEPFIKQKTLQGLSLRDVAVSVLNKKGKPIITHKMD
    MLFTHFGLSGPAILRCSQFVVKELKKQPQVPIRIDLYPDINEETLFQKMYKELKEAPKKAIKNVLKPWMQERYLLFLLEK
    NSISPNVSFSELPKDPFRQFVKDCKQFTVLANGTLSLDKAFVTGGGVSVKEIDPKKMASKKMEGLYFCGEILDIHGYTGG
    YNITSALVTGRLAGLNAGRFARS

    >gi|305675612|ref|YP_003867284.1| putative sulfur transferase [Bacillus subtilis subsp. spizizenii str. W23]
    MKIKEISTAALKEKIEADEELYLIDVREDEEVAEGMIPQAVHIRMGDIPEKVDTLDKDKEYVFICRSGMRSMNVCRYLDE
    QGFKTVNVEGGMMAWEGETKPKN

    >gi|305675810|ref|YP_003867482.1| putative chaperone involved in Fe-S cluster assembly [Bacillus subtilis subsp. spizizenii str. W23]
    MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKGESDSMFDQHGITVLVDKESLDIMNGTVI
    DYKQSMLGGGFTIDNPNAIASCGCGSSFRTATNTGTPEEC

    >gi|305675814|ref|YP_003867486.1| putative NADH dehydrogenase [Bacillus subtilis subsp. spizizenii str. W23]
    MKKLVLIGGGYGNMRVLHRLLPNQLPDDVSITLIDRNPYHCLKTEYYALAAGTISDHHIRVSFPEHPRLDVQYGDISSID
    IAQKQVLFQDREPISYDDAVIGLGCEDKYHNVPGAPEFTYSIQTIDQSRETYQKLNNLSANATVAIVGAGLSGVELASEL
    RESRDDLNIILFDRGNLILSSFPERLSKYVQNWFEEHGVRIINRANITKVEENIVYNHDEPISADAIVWTAGIQPNKVVR
    DLDVEKDAQGRIVLTPHHNLPGDEHLYVVGDCASLPHAPSAQLAEAQAEQIVQILQKRWNGEALPESMPQFKLKGVLGSL
    GKKAGFGLVADRPLIGRVPRMLKSGLLWMYKHHNG

    >gi|305675871|ref|YP_003867543.1| hypothetical protein BSUW23_15995 [Bacillus subtilis subsp. spizizenii str. W23]
    MEGFSLNQDRGSMQDALKQYKLGLGTFEQKMPLMGRKFNEFTEQCFAGNSLTEREKQLIALGIAINAQDEYCMIYHTKGC
    LDEGATEENILEAVSVAAAFGGGAALSQGVTVVQQCIEEFGNTTH

    >gi|305675876|ref|YP_003867548.1| putative thiol-disulfide oxidoreductase with thioredoxin domain [Bacillus subtilis subsp. spizizenii str. W23]
    MKELQEHELEHIADDVYLLYLYTPFCGTCQLASKMLTVVKEMLPDVAFYKNNVNYSPTFAKAYQIESVPCFLLFKGGKVV
    ERGYAFHSVSYLYELIKQKSSSASHL

    >gi|305675881|ref|YP_003867553.1| putative oxidoreductase with thioredoxin domain [Bacillus subtilis subsp. spizizenii str. W23]
    MSLTFYWYPKCGTCRKAKKWLEEHGKEINEIHIAEQPPSKEELKALYEKSGLDLKKFFNTSGMKYRELNLKEKLYHMSED
    EQLELLASDGMLIKRPLTTDGEKVTVGFKEDQFEENWA

    >gi|305675953|ref|YP_003867625.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. spizizenii str. W23]
    MKKKQQSSAKFAVILTVVVVVLLAAIVIFNNKTEQGNEAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIF
    PKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWAFHEKLFEKQPDTEQEWVTPAVLGDLAKSTTKIK
    PETLKDNLDKETFASQVEKDSELNQKMNIQATPTIYVNDKVINKFMDYDEIKETIEKELKGK

    >gi|305675954|ref|YP_003867626.1| copper(I)-transporting ATPase [Bacillus subtilis subsp. spizizenii str. W23]
    MKQEYVLDGLDCSNCAQKIENGVKGIKGIDGCAVNFAASTLTVSADGKEEQWVTNKVEKKVKSIDPHVTVRQKHKKKSAD
    DGYRHRMINMLIRMAAAVILGAAAYLVHSGTIEFFLFLAAYLIIGGDIIIRAVKNITRGQVFDEHFLMALATIGAFLIQQ
    YPEGVAVMLFYQIGELFQGAAVSRSRKSISALMDIRPDYANVKTENGIELVSPEDVQIGDIIVVNPGESIPLDGKVVQGL
    AMVDTSALTGESVPRKAAEGQDVMSGFINQNGVLHIEVTKGYQESAVSKILDLVQNASSRKARTENFITKFAKYYTPAVV
    IIAVLLAFVPPLVLPGAALSDWVYRALIFLVISCPCALVVSIPLGFFGGIGAASKAGVLVKGSNYLEALNQVKYAVFDKT
    GTLTKGSFEVTEIKPAEGFTKESLLEAAAYAELHSQHPIAESVRKAYGKMLSSDAIESYEEISGHGIFAKVNGTEILAGN
    KKLMEREQIEGVPVLNAGTIVHIAVDQRYAGAIIIADEVKEDAAQAIADLKSFGIKQTVMLTGDSKQTGEAVGKQLGIDE
    VYAELLPQDKVARVEALEAKLSPNEKLIFVGDGINDTPVLARADIGAAMGGLGSDAAVEAADVVLMTDQPSKITEAIRIA
    KRTRRIVWQNIGFALGVKAIFLILGAFGIATMWEAVFSDVGVTLLAVANAMRVMRLKNG

    >gi|305675955|ref|YP_003867627.1| copper transporter ATPase [Bacillus subtilis subsp. spizizenii str. W23]
    MSEQKEIAMRVSGMTCAACASRIEKGLKRMPGVTDANVNLATETSNVTFDPAETGAAAIQEKIEKLGYHVITEKAEFDIE
    GMT
    CAACANRIEKRLNKIEGVTNAPVNFALETVTIEYNPKETSVTDLKEVVDKLGYKLQPKGDEEREATASKKKEERKQT
    ARLIFSAVLSFPLLWAMVSHFTFTSFIWVPDIFLNPWMQFALATPVQFLIGWPFYAGAYKALRNKSANMDVLVALGTSAA
    YAYSLYLTIRSVGSHGHTDGLYYETSAILLTLILLGKLFETKAKGRSSDAIKKLMKLKAKTATVVRDGQEKIIPIDEVLV
    NDIVYVKPGERIPVDGEVVEGRSAVDESMITGESLPVDKNPGDSVTGATVNANGFLKIKAVNVGKDTALSHIIKIVEEAQ
    GSKAPIQRLADQISGIFVPIVLGVAVLTFIIWYLWAAPGDFSEAISKFIAVLVIACPCALGLATPTSIMAGSGRAAEFGI
    LFKGGEHLEKTHRLDTIVLDKTGTVTNGKPRLTDAIPFGRFEETDLLQFAAAAEMGSEHPLGEAIVAGVKEKGLEIPNLT
    RFEAKIGSGILAEAGGKTILVGTRKLMESEQVEHGALLAQMEELEAEGKTVMLVSIDGEAAGLVAVADTIKDTSRAAVAR
    LKELGLDVIMMTGDNRRTAEAIAREAGITSVIAEVLPEQKAAEISRLQKEGRQTAMVGDGINDTPALATADIGMAIGTGT
    DIAMETADITLIRGDLNSIADAIRMSRLTMKNIKQNLFWALGYNSLGIPIAALGFLAPWIAGAAMAFSSVSVVLNALRLQ
    KVK

    >gi|305675956|ref|YP_003867628.1| copper insertion chaperone and transporter component [Bacillus subtilis subsp. spizizenii str. W23]
    MEQKTLQVEGMSCQHCVKAVESSVGELDGVNAVHVNLEAGKVDVSFDADKVSVKDIADAIEDQGYDVAE

    >gi|305676082|ref|YP_003867754.1| thioredoxin reductase [Bacillus subtilis subsp. spizizenii str. W23]
    MSEEKVYDVIIIGAGPAGMTAAVYTSRANLSTLMIERGIPGGQMANTEDVENYPGFESILGPELSNKMFEHAKKFGAEYA
    YGDIKEVVDGKEYKVVKAGSKEYKARAVIIAAGAEYKKIGVPGEKELGGRGVSY
    CAVCDGAFFKGKELVVVGGGDSAVEE
    GVYLTRFASKVTIVHRRDKLRAQSILQARAFDNEKVDFLWNKTVKEIHEENGKVGNVTLVDTVTGEESEFKTDGVFIYIG
    MLPLSKPFENLGITNEEGYIETNDRMETKVEGIFAAGDIREKSLRQIVTATGDGSIAAQSVQHYVEELQETLKTLK

    >gi|305676455|ref|YP_003868127.1| putative sulfur oxido-reductase [Bacillus subtilis subsp. spizizenii str. W23]
    MTVHIKVYSDYVCPFCFIGKAAFEEAIKEKDVEVEWMPFELRPSPSPQLDPVNDPSKQYMWQTAIQPMADKLGVEINFPN
    VSPHPYTDLAFEGFHFAKEYNKGHEYNTRIFQAFFQEGQNIGDIDILTKLAEEVGLDRASFKSALETRTYQDVQRQALKH
    AYEEADITAVPTFIIGDTVIPGAAGKDVFEKAISDEQQK

    >gi|305676667|ref|YP_003868339.1| alkyl hydroperoxide reductase small subunit [Bacillus subtilis subsp. spizizenii str. W23]
    MSLIGKEVLPFEAKAFKNGEFIDVTNEDLKGQWSVFCFYPADFSFVCPTELEDLQEQYAALKELGVEVYSISTDTHFVHK
    GWHDSSEKIGKITYAMIGDPSQTISRNFDVLDEESGLADRGTFIIDPDGVIQTVEINAGGIGRDASNLISKVKAAQYVRQ
    NPGEVCPAKWEEGGETLTPSLDLVGKI

    >gi|305676668|ref|YP_003868340.1| alkyl hydroperoxide reductase large subunit [Bacillus subtilis subsp. spizizenii str. W23]
    MVLDANIKAQLNQYMQLIENDIVLKVSAGEDDTSKDMLALVDELASMSSKISVEKAELNRTPSFSVNRVGEDTGVTFAGI
    PLGHEFTSLVLALLQVSGRPPKVDQKVIDQVKKISGEYHFESYISLT
    CHNCPDVVQALNMMSVLNPNITHTMIDGAAYKS
    EVESKNIMAVPTVYLNGESFGSGRMTLEEILAKMGSGADASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
    FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKEYDIDVMNLQRAKRLEKKDLFELELENGAVLKSKTVILSTGARWRN
    VNVPGEQEFKNKGVAY
    CPHCDGPLFEGKDVAVIGGGNSGIEAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTV
    LKNAQTKEITGDQSVNGITYVDRETGEEKHVELQGVFVQIGLVPNTEWLDETVERNRIGEIVVDKHGATSVPGLFAAGDC
    TDSAFNQIIISMGSGATAALGAFDYLIRN

    >gi|305676735|ref|YP_003868407.1| hypothetical protein BSUW23_20330 [Bacillus subtilis subsp. spizizenii str. W23]
    MKVGDPMPNKSKPNRLIAEKSPYLLQHAHNPVEWFPWGEEAFEKAKRENKPVLVSIGYSTCHWCHVMAHESFEDEEIARL
    LNERFVAIKVDREERPDVDSVYMRICQLMTGQGGWPLNVFITPDQKPFYAGTYFPKTSKFNRPGFVDVLEHLSETFANDR
    EHVEDIAENAAKHLQTKTAAKSGEGLSKSAIHRTFQQLANGFDTIYGGFGQAPKFPMPHMLMYLLRYDHNTGQENALYNV
    TKTLDSMANGGIYDHIGYGFARYSTDDEWLVPHFEKMLYDNALLLTAYTEAYQVTQNSRYKEICEQIITFIQREMTHEDG
    SFFSALDADTEGEEGKYYVWSKEEILKTLGDDLGMLYCQVYDITEEGNFEGKNIPNLIHTMQEQIKADAGLTKEELSLKL
    ENARQQLLKTREERTYPHVDDKVLTSWNALMIAGLAKAAKVYQEPKYLSLAEDAITFIENQLIIDGRVMVRYRDGEVKNK
    GFIDDYAFLLWAYLDLYEASFDLSYLQKAKKLTDDMIGLFWDEEHGGFYFTGHDAEALIVREKEVYDGAVPSGNSVAAVQ
    LLRLGQVTGDLSLIEKAETMFSVFKPDIEAYPSGHAFFMQSVLKHVMPKKEIVIFGSADDPARKQITTALQKAFKPNDSI
    LVAEHPDQCKDIAPFAADYRIIDGKTTVYICENFACQQPTTNIEEAIQTLISSRD