Acidithiobacillus ferrooxidans ATCC 23270 uid57649

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218665316|ref|YP_002424559.1| sulfur/pyrite/thiosulfate/sulfide-induced protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MFKRLANAAIPFALVGMLFGLSVSVASADDSGNQAAQQVLNARMEKFFADQKPFPYGTYQYTDRSLLLAISKDPSKYALI
    DIRTPTYHDFFCGVHSNKHVCTGRGWQRIYGYAQGHVPGAQNIPYLNLPAAIKSDSIPKNKTVILM
    CPTGQLSNQTAGVL
    RMLGYDAYALRGGVNGWKKAGYPIVIGKEPGTMAQACHPWQTCWRQFQYDNPQAH

    >gi|218667437|ref|YP_002424561.1| hypothetical protein AFE_0047 [Acidithiobacillus ferrooxidans ATCC 23270]
    MAKVAIIAMIGAFLLWISLIKPMLHKSDVATATIPLVNGKTLDVTALRGKVVVLNFWSPDCPPCIQELPDLERLYQTYRA
    QGLVVVGIATPGSSRSRSLAAAAMAHVTYPLSVDQNGTLTRAVGGIMVTPTQVIIDREGRVIDKYQGVVSGEEPMDEILR
    ALQQK

    >gi|218666833|ref|YP_002424567.1| hypothetical protein AFE_0053 [Acidithiobacillus ferrooxidans ATCC 23270]
    MFGAILQYARLNRFNTIAGMAVLQNLAVAKTMAFTVGLGMLLLQSEILLGWADYHVKPLILVGVVVGGLLFGVGMAVLGY
    CPGTVAISLGQGNLDALVGIIGGLCGALVFAVVYPSLNPLLGPNLGALSVRSLLPDDILFWSVTSAVAILFMGIALYLQK
    LQHHDWRWLHAAVGLALLNCVLTLPFVAGHPMGASTAFPYAAMTITELGAESYQAAIAAPGAWELWFLTGAFLAGLVFAL
    LHRSFRISSVPELWVRYHGPKPAKRFFWAFVGGFLLLFGARMAGG
    CTSGHVISGGMQLAISSLVFAVVVFAAFLTTGHYF
    YRIRQAVPIPPSPRIVEVNEMEAR

    >gi|218665323|ref|YP_002424660.1| rhodanese-like domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MTKSVINLAPQDAFHFLQKNPQAVLIDVRSEMEFLFVGHPKEALTIPWRDDPDWEINPDFLCRVRRATSLNRPVLLICRS
    GHRSLEAGQYLQANGFSAVYNVAHGFEGDLNDQHRRSSLNGWRFDGLPWEQI

    >gi|218666650|ref|YP_002424728.1| stringent starvation protein A [Acidithiobacillus ferrooxidans ATCC 23270]
    MATPSSKKTLMTLYSSNDCVFAHRVRFVLEEKAMEYQIIDVDLGNRPEDLAELNPYNQVPTLVDRDLAIHESVLIMEYLD
    ERFPHPPLIPVDPISRAKVRLGLLRFDRDWFAPLFQPGYGAEQVKTAKEQIRSTLAGLNSIFSQQRYLFGDDLSVLDCAI
    APLLWRMPVLDISLPAAARATQNYMDRIFGMESFKRSLTPAEKAMR

    >gi|218665087|ref|YP_002424781.1| disulfide bond formation protein B, putative [Acidithiobacillus ferrooxidans ATCC 23270]
    MERPTRRFLSPARLSGLIAVLVASAAAGAFVLVLWLQFARGYEPCSLCVYQRLANVAVLLIVVMGFFWAGAARRGLWMLA
    SVYALAGAGLAGWQWHLSAIASHAPEA
    CTAVDIFPSGGSFGPWGKEAASVFSGQGSCAAAGARTLAGWPVTHWSLVFFLT
    CAVLLWLAQWLSGRQDRR

    >gi|218665912|ref|YP_002424782.1| thiol:disulfide interchange domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MTIVHAVQTLARSLAIGGVILTTSVGIAQGATAATDHDLDYWQALSHTRYIEEGSKGPILYDFLDPNCPYCHQTYVWLQN
    PIDGGQLRVRFVIVGFLSPSSKGKAAAILAAPKPLAALRRTEKGFAMTPNGPEGGIKPADAAVVANVLNQLQFNQSRLDG
    KESELFGMEGAAVPFLVYQRGKKIHYLLGPPDNAQWKDLLDAS

    >gi|218665219|ref|YP_002424798.1| glutathione S-transferase family protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MPLELISFPLCPYVQRSVITLLHKQVGFTLTHIDLAHKPEWFLALSPLGKVPCLKIDEHTVLFDSQVINEYLDETIAPVL
    HPADPLERAQHRAWIAFGSEILGDQMQMMVAQGEERFTAASRQLFDKLERLDKAMGNGAFFAGDDFSLIDAALAPLFMRM
    EILHALRPLPRWESLGKLRRLTALLMELPEVAGSVTADFPDRLRNYISERGSLFLRTA

    >gi|218665096|ref|YP_002424866.1| hypothetical protein AFE_0363 [Acidithiobacillus ferrooxidans ATCC 23270]
    MADKLLMVMVNTDPSNPQELGAPFFQATVAAAMDFEVEVVLTARAGELAKKGVAEKMFVMPGSPKSVYDFIKDAHEAGVK
    FFV
    CTPTLELWECTKEDLIPEIQDIVGGAYVIEQAMDDDVVTFTY

    >gi|218665097|ref|YP_002424869.1| glutathione reductase [Acidithiobacillus ferrooxidans ATCC 23270]
    MTQSYDLIVIGGGSGGIAMANRAARYGAVTALVAAGPLGGTCVNAGCVPKKIYWNAAHLAGQMKMAGEYGFDTIEPRFHW
    EHLKQQRDTYIGRLNDRYAQGLDGNGVSLIRGHARFSGAHRIHVGDSTLEAAHILIATGGHPVWPDIPGAELGITSDGFF
    ALESRPRCVAVVGAGYIAVELAGVLHALGSDVSLVMRRRHFLNDFDPMLRESLMDAMLRQGISLLAQREVRELEKRADGL
    CLHFHDGDCLGGLDAVIWAIGRRPNSADLGLEFANITADPQGFIPVDAFQNTDAPGVYAVGDVTAGPALTPVAIAAGRRL
    ADRIFGNQTERHLDTLVVPTVIFSHPPIATVGLSEAVAKEQYGEEAVKVYQTTFTPMFRAFAAEPEKTAMKLVTVGREEK
    VVGLHAIGDGVDEMLQGFAVALRMGATKQDLDDTIAIHPTSAEEFVTMR

    >gi|218666302|ref|YP_002424870.1| AhpC/TSA family/glutaredoxin domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MKLTSIEGQGVPQAVFRTRDDNQWRDVSTDELFQGKTVIVFSLPGAYTPTCSSSHLPRYNELAPTFRENGVDDILCMSVN
    DAFVMDAWAKELAVENIHLIPDGNGEFTEGMGMLVDKSELGFGKRSWRYSMLVKNGIIEKMFIEPDKPGDPFEVSDADTM
    LHYINPEARDPEFVTIFTREG
    CPHCARAKAMLKEHGIAFEEIKTGMGTGVSSRTIRAVSGRSTVPQIFIGGRHIGGADDL
    EKYFHGK

    >gi|218665937|ref|YP_002424878.1| thioredoxin-disulfide reductase [Acidithiobacillus ferrooxidans ATCC 23270]
    MSDPKSVIDEKHCRLLILGSGPGGYTAAIYAARANLSPILVQGMEPGGQLMTTTEVDNWPGAADGIMGPELMQGLEKQAR
    RFDTEILFDHIHTADLRQRPFRLSGDQHCYTCDALILATGASAKYLGLPSEDKFRGKGVSA
    CATCDGFFYRGQAVAVVGG
    GNTAVEEALYLSNIAKHVTVIHRRNRFRAEKILQDKLMAKENVTVIWDHSVAEVLGDASGVTGLRIQHVENGSTQDLALM
    GVFIAIGHQPNTGIFKGQLKMDEGGYLVTRGGRDGMATATSIEGVFAAGDVQDYVYRQAVTSAGTGCMAALDAERWLEQQ
    QEG

    >gi|218666283|ref|YP_002425011.1| hypothetical protein AFE_0519 [Acidithiobacillus ferrooxidans ATCC 23270]
    MDKALLHFDNSYARDLEGFYAPWQAATAPAPRLLLLNQALAEELGLDSATLDDELGAAIFSGNQVPEGALPLAQAYAGHQ
    FGHFSPQLGDGRALLLGELIDRHGRRRDMQLKGSGRTPFSRGGDGKAALGPVLREYVIGEAMHALGIPTTRALAAVTTGE
    TVRRETWLPGAILTRIAASHIRVGTFQFFAARNENVRVKQLADYTIARHYPPLKGADNPYLELFAAVSAAQAALIARWML
    VGFIHGVMNTDNMSIAGETIDYGPCAFMDNYDPETVFSSIDAHGRYAYAHQPLIAQWNLTRFAETLIDLVHPDPDEAARL
    LTEQLNEFPKLYTRHWLDGMRAKMGLATAEDGDLALAQALLSAMEGQNADFTQVFRGLSAAVRGDPAQVRAHFVNQAPFD
    LWLAQWQARLAHESATAEARAEAMDQVNPLYIPRNHKVEEALAAATLNQDLTPFKALLAVLERPFAERPGLESYTQPAPE
    DFGPFKTF
    CGT

    >gi|218665695|ref|YP_002425021.1| rhodanese-like domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MGKSLADFIRAARRQIREIDCDTLEDWLRSRDDVLVVDVREASAFLDGHLPGAIHVPRGYLEALADPDYGHCHPELAVAR
    DRVVVLY
    CDSGTRSALAAVTLQEMGFTEVYNLGGGINVWDAEDKPVVS

    >gi|218667063|ref|YP_002425037.1| thiol:disulfide interchange protein DsbD [Acidithiobacillus ferrooxidans ATCC 23270]
    MARNDVGMRAGNGRRAGWAMGVQLWSGICGVLLLSWLSLGCAGTFLTPDQAFHFEARLSGRHQLQLHWDVAQGYHLYRDR
    IKFSVTPSNVLLGHYTLPAGVELNDPVFGKTRVLEGKNTLTVPFTVQGTAPAFIELKSTYQGCANAGVCYPEQVKTIKLA
    LTQQAVPPPAAVPVVPPPGTAVPAAAVSPVNDAGALAGALRDSFWLTLGLFFISGLGLAFTPCIFPMIPILSALIVGKEA
    GRGPQRSRALGLSVAYVLGMSLTYSIAGVLAAVSGAYMQAAFQSPWVLGAFAFVFVLLALSMFDFYELQMPSGIQTRLAG
    MGRGGHLFSTFVMGVLSALIIGPCVAAPLAGGLLFISQTGDVFLGGLSLFALSLGMGVPLLIIGTSAGHFLPRVGAWMNA
    VKAVFGVVLLGVAIWLLTRVLPGPVSLALWAALAVISAIYLGALDAIPAGASGWRRFWKGLGVLMLVYGLVMGVGALGGA
    SDPLQPLTGYTAAVPPENRAEALHFTTVKTPEALQSALVQARGRPVLVDYWASW
    CVECLRMDKVTFADPQVVAALRKRLL
    IRVDVTQDDAASRALLKRYNLVGPPAFIAVAADGRTTAQQEGYLGPEAFMGWLHQS

    >gi|218665619|ref|YP_002425141.1| molybdopterin biosynthesis MoeB protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MTDTLDDAALLRYARQILLPEIDIAGQQALAAGRVLIIGMGGLGCPAAQYLAAAGVGNLTVCDGDQVDLSNLQRQILYGE
    ADLGRPKALAARDRLRAMNQQIRVSAWVESAQPESLAAALDTHDVVLDCTDNFGSRHAINRACRNAGKPLVSAAAIRWEG
    QLAVFDFRVSESACYACLYPDGVEDTEDT
    CSRSGVLGPLLGVLGSMQAAEAIRLLCTGHSPLAGQLLLVDAQSWQWRQIA
    LRRDPACGVCA

    >gi|218668089|ref|YP_002425145.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 23270]
    MSDAILYVSDDSFETDVLKSSKPVLVDFWAEWCGPCKMIAPILEEIADEYADRLRVAKFNIDENPNTPPQYGIRGIPTLL
    LFKAGKLEATKVGALSKAQLTAFLDSQL

    >gi|218665449|ref|YP_002425163.1| iron-sulfur cluster assembly protein IscA [Acidithiobacillus ferrooxidans ATCC 23270]
    MALTLSESAARQVRKSIAKRGKGLGIRIGVKTSGCSGLSYVMEFVDVPNPEDLVFPHDDVNLFVDPKSLIYLDGTELDFT
    REGLNEGFRFNNPNVKDACGCGESFTT

    >gi|218668103|ref|YP_002425433.1| pyridine nucleotide-disulfide oxidoreductase [Acidithiobacillus ferrooxidans ATCC 23270]
    MSTDNYDVTIIGSGPGGYRAAVLAALRGKRTAIIERKTWGGTCLNRGCVPKKDWHETAKWIEQSRHFQKRGVIGPVLRGN
    MAQAWQHQHDVVETVRGSYLDYLKRLGIHLYDGTGSFLDARRIAVEGVGGLVEIHTETSIIATGSAPSLPRGIVPAAGKV
    LTSDMLYDNGVPHGDRVILVGGGVIGTEFAYIFTQLGKQVEWLVHSTPLAHTRYSPQARDILHAALAGLGIHPQSGFRIH
    RMETTTEGVTVFDDQGKPIHGDWVLLATGRHAYTEGLGLENTRITLDDHGFVQTDAALETGEPGIYAIGDAVGPIMNANQ
    ALNDARIVIHNLLSTEKQERDPLWVPELVYSAVELARIGMDDEAAEDAGFEPAVGFAAFETSPRALGQDDGVGFVRLLAD
    MDSGELLGGEIVGRDAGELIHLLANGGDHDGMLRRIVETRTNHPSRAEELVNATETLAARWGLEEQIFGPSD

    >gi|218667181|ref|YP_002425459.1| antioxidant, AhpC/Tsa family [Acidithiobacillus ferrooxidans ATCC 23270]
    MAVLVGKAAPDFVAPAVMPDNSINEKFQFSQHIKGKYAVLFFYPLDFTFVCPSEILAFNHRLNEFKSRNTEVIACSVDSH
    FTHLAWKNTPEEKGGIGHIQLPMVADLSKSIARNYDVLLNDEVALRGSFLIDREGIVRHEVVNDLPLGRNIDEMIRMVDA
    LQFSEEHGEVCPAQWQKGKAGMKPTSEGVADFLAHHGKEL

    >gi|218665103|ref|YP_002425491.1| thiol:disulfide interchange domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MGKNSRGILLALLMAMSALVTAHAADFLTRVQDQGTSFLIGRSGPVFTDFVDPDCPYCHQEFRELQPLLLSGKLRLRIVP
    VAVLDAGSLPRAATLLESRHPGETFLQAEAGFHNGHLALPRMQNVPPAMASAVERNNQLLEDIDPDGEVPAILFEDRAAG
    KVASLIGEQPITVMQRALIAAQ

    >gi|218667224|ref|YP_002425557.1| thiol:disulfide interchange domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MKLRKTILAGLLAAGVSGAAIAGVPNVGKDFQPGAEAIVAMSHGHAQILKAFHTGVADMDGYAVQLAPGHAMIMYASADG
    KYLFMGGMFNRKGTNESMKYAHEYLPSADLPKVFTPAAMGTAIQKTAHFLIGKPSAPKTVWMVMDPN
    CVFCHLTYEHLLP
    YLKKGAVRIELVPVGFLKPSSLPKAATILASKDPAKAWAYDETHYIMPPTEEGGTVPLKHIPQSDIRTIQANNTWMNQHG
    IGGTPYLIYRGPKHQWHVVNGMPSDMSSFVAGMG

    >gi|218665926|ref|YP_002425560.1| thiol:disulfide interchange protein, DsbA family [Acidithiobacillus ferrooxidans ATCC 23270]
    MRSKRLVGMLSAGLVLFSGLLPAGLLPAGLLPARMAFADGLPGMGIGSAGLAGLPGTSQPGAGMPGFKPYQTVHLGAHLD
    HSVIEVMAYE
    CPYCMRLETAMLRWSATLPRAIRFDQMPAAIGKRWVPMAQGFYAAAVIDPKAIPRFNAAAFSLVQKQGYA
    FQDPRTYALAAEEAGIPPSLYREMLGYKGVRQLVYNDEKIMLKTQIVKTPTLIICGRYLINPGDTQGNYSLFFQLANGLV
    SRCESLDKLKEPSE

    >gi|218667635|ref|YP_002425896.1| antioxidant, AhpC/Tsa family [Acidithiobacillus ferrooxidans ATCC 23270]
    MSSETITVGQPAPRFHAAAYGKAASISLDDLRGKVVVLYFYPKDDTPGCTTEGQEFTALYPEFQAAGAEILGVSRDTLAS
    HEKFSCKFNFPFPLLADTDAALCNAFDVLKKKNNYGKVSIGVERSTFVIDREGKIAYIGRKVKAAGHAAAILQIVKQLP

    >gi|218665401|ref|YP_002425930.1| ankyrin repeat protein/rhodanese-like domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MNTRSFHRIDVHKARELLQRPDTVLLDCRHPSDFRAGHIAGASPLGDYNADDHVLNIAKHRPVLIYCYHGNASQMRAQLF
    ADFGFAEVYSLDGGYEAWRKVHTPANSQLTEALQCWLMAQEFPAADIHARTRDGVTPLMRAAGEGDPARVAELLAAGADP
    HQRNNDGNQALWFACVSENLDTLDLLVAVGAHLNHQNDNGATCLMYAASAGKTAVVERLLAFGADRSLLSLDDFTALDMA
    ANLECLNLLRETPRRIKAVT

    >gi|218667051|ref|YP_002425937.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MLILTEKAIDVVKNLLAENPEASGLRVAVTGGGCSGYQYGMGLEAEAGAEDTVVAIEGVPVYVDNASATLLNGVVIDYVD
    ELSGSGFRFENPNATGTCGCGSSFTTGDEASASSASSCGHRS

    >gi|218668144|ref|YP_002425953.1| ADP-ribosyl-[dinitrogen reductase] hydrolase [Acidithiobacillus ferrooxidans ATCC 23270]
    MGYDLRERALGAYLGLAIGDALGATVEFMSPTEIREEYGVHRNMTGGGWLHLRPGQVTDDTQMCLVLGRSILADEQWSVT
    RFAEGMVQWLRSHPVDVGNTCRRGIRRFMLNGSTAAEPAEWDAGNGACVRNLPAVLATLSAPATFRRISVEQAHLTHHHP
    LSDVATLTLGEMLRCALRGEGVSSVRRLADALVARYPEFAFKEIPQAPTPYIVDTVRAVLYALLHTDNFKDCLIAVVNQG
    GDADTTGALAGMLAGGLYGTYGLPGTWLQRLDPAVQKEIAAQVDQLLIRGERTDHEQLPASMPPRIVFYEKPG
    CANNARQ
    IALLRAAGCVVEVHDLLQTAWTAETLRPYFSDRPVAEWFNPASPRVKSGEIVPEAFTEAGALAAMLLDPLLIRRPLMEAG
    DAKIAGFSEDQLRRWTSASLDVYAEGTGAATDSCRRSVPCPSVRQASNLTKTPAASSHANAS

    >gi|218667001|ref|YP_002425959.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MELTFTPKAERFIQRMITFGGGNASSAFRLAVKPGGCSGLSYDFRIVDAAEPGDVAITSNGIPVLLEQKSVPFLNGVIVD
    CEDSLMNTGLVFTNPNAAASCGCGTSFTPKE

    >gi|218665351|ref|YP_002425981.1| methylated-DNA--protein-cysteine methyltransferase [Acidithiobacillus ferrooxidans ATCC 23270]
    MLNQALRWQLDRVTTPLGVMLLVSDAQNTLRALDWADSEARMLDRLRLLYGSDGVTLTSGTAPQPVRNGLEAYWAGDLNA
    VSAIPVETAGTAFQQAAWAWLRSIPPGETRSYQEQARGMERASAVRAVGRANGANPIGIVIP
    CHRVIGANGTLTGYAGGI
    ERKRWLLRHEGGDF

    >gi|218666141|ref|YP_002426165.1| hypothetical protein AFE_1745 [Acidithiobacillus ferrooxidans ATCC 23270]
    MTILQIITPEEASGKTADLYQEIEGAFGRVPAVLQVYGSSPALLAQQWEGIQYYRHHPRLGAALLATIRMLISQANHCDY
    CVGFNEAMLINHLGQSAEAVAATKRDPGSAPLSDRDRAMLLLVLKAVKTPVLLTREDVETVLTHGWTESDVLDAVVHGAR
    NQMADVIINAFKVERDF

    >gi|218667269|ref|YP_002426221.1| pyridine nucleotide-disulfide oxidoreductase [Acidithiobacillus ferrooxidans ATCC 23270]
    MAETVTDILIVGGGPAGMMTGITAAQFSPHKKVLVIRPETDAVIPCGIPYIFGTLGGTDEDMAGRAPLLAAGGQLQIGTV
    QQIDRVAHTATLSDGNVMHWERLVLATGAENFIPPIPGTGLEGVFSIRKDYDYLDTLFSTLIPQIKKLAIIGGGFIGVEF
    ADEIRKRGIEVHIVEMLPHLMQAAFDPDACAAVEKQLRAHGVHIHTGARVEALLPDSGGRRVGQIQIAGQEALTVDAVLI
    AIGTRPQVALARDMGLTLSRSGGIWVDAFQRSREDPNIFAVGDCAHKQDFFTRKANHAMIASQAAAEGRIAGMNLYGLRQ
    LRYNAGSVSIYASEIDGLAFGVAGLTERQAELEGFPILVGETRLPDHHPASMPNTTEIYCRIIFAADSLQILGGQILGGA
    TTGELVNTIGLAIQMHASAPDLASMQFGSQPRLTPSLHPLVAAAGDALRRHYEPLHPCVTGDPHA

    >gi|218667246|ref|YP_002426232.1| alkylhydroperoxidase AhpD domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MSANDRVNEIAQLTERLKDKYPAEINAFLGFMGKTEGNPALGKAQKELINVALSVAAQCEWCIALHVKGAVTAGATRDEI
    MSAGFLAVLMHGGPALMYLVRLTEAVDAFLPEESHG

    >gi|218666894|ref|YP_002426277.1| heavy metal-binding protein, putative [Acidithiobacillus ferrooxidans ATCC 23270]
    MSDIRLKITGMTCGHCVRAVTKALEGIPGVEKADVTLEPGEAVVHGLADTATLIAVIREEGYEAEECKKSQSGS

    >gi|218665675|ref|YP_002426286.1| thiol:disulfide interchange protein, putative [Acidithiobacillus ferrooxidans ATCC 23270]
    MPGTGSGVSLGTAASLLESVTHGEAKAEKVFPGPGGLTGIEVTLQGHPTVAFATADGRYLVAGPVLNKQGEDEAHTAMVK
    LGLIPKPASAGALAAKAAGADSFVLGTGGPEITAFVDPN
    CIFCHKFYEEAKPLIEAGKLRVRYVVVAFLKPSSMPKAAAI
    LGAADPAAAMAKNEKGFDAVTEEGGIAPAQNPAAATLSAVENNTRLLGESGEMATPTLIYCNSKGEPTLVHGLGKESFMD
    FAAHIGNLQNGACRK

    >gi|218665061|ref|YP_002426306.1| pyridine nucleotide-disulfide oxidoreductase [Acidithiobacillus ferrooxidans ATCC 23270]
    MTIQYADLLTIGAGGGAYPAAFRLARAGRSVVMVDPKGLMSGNCLYEGCIPSKAVRETAEIYQSQRRFAERGLPGTITVD
    FAKIMAHKDSIQARRYQQHAADLAATPNIQLIQGEARFITPHEVAVDTADGERRFRCAQVIIASGSDVFVPPVPGAEF
    CL
    TSHDLYKPDATLKTLPERMIVIGGGYIGLETATFFAALGTRVTLLQKGRQLLNGMDPGMVALLTPLLDPSIRILTGVDVT
    AVEVTPEGGRRVHYTHGEENDTLDGDVVLMAVGRRPVIPAGAAEIGITVTRKGVAVGPDLQTVHPHIYACGDVNGRVPLF
    HAAVRQSMVAAHNILGGNIPMDYADFRHIPTTIFTLPAAAYVGITPALAEAQGIPLQTGRYDFEEDSRAQILERMEGGIQ
    LFFAADSLRLLGGWVVGIDAGSLIGQIGTAAAHGLTAYDLARFADQHPMSAEGIGKAARSLF

    >gi|218667823|ref|YP_002426352.1| dsbG domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MFKKSLVIMARALLAAWLVSSISACAKKTPASSTSTESAATATATSSMAAVPAKMTPSDLWKLMGKKLTYIQEGHHGPVV
    YDFTDTN
    CPFCHLIYVVEARLIREGKLTVRYVPVAIIKPSSMPEAAAILQADNPVAALQKAEDAIDKGMKTGKPAKLARA
    TDAIGKASPKTIEAIKKIEANNVFLQEVDIDELPDIIYLPKKGKLGLITGLISEKKLTELLPQMQ

    >gi|218667248|ref|YP_002426386.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 23270]
    MAIVELTQDNFDAVVAGNDMVLIDFWAPWCAPCRAFAPIFEAAAEKYPDVVFAKVNTDTEQELATSFQIRSIPTLTIFRQ
    QIGIFSQAGSLPASALEEVIQQARALDMDKVREEISAQPDTTH

    >gi|218667316|ref|YP_002426419.1| alkylhydroperoxidase AhpD family core domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MSTEHARIAYLSFTKTAPEVYAALLAMGKAVDDSGLEKPLTELIKVRVSQINGCAFCIQYHLNVARQIGMEPVKLDLVAG
    WRDAGVFSAREQAALAWAECLTALATQGAPDAVYETLQSQFTETEVTFLTVAIGAINHWNRLGVGLRFSPPPPRTGSHV

    >gi|218667960|ref|YP_002426425.1| copper-translocating P-type ATPase [Acidithiobacillus ferrooxidans ATCC 23270]
    MVDVEIGIEGMTCASCSSRVERTLSRLPGVRAAVVNLSTEHAAVQYDPAQISPDALITAIAESGYTPVIAETELVIEGMT
    CASCVGRVERSLRRLPGVLEATVNLATERAALRYLPDTVDQNTLIAAVTAAGYGARPVQGDVAVADRKAQAIRTMRRDVI
    LAVVLAVPILLLSMGMALVPAVDRLLSGLEPFPQFWAWVQAVLATIVLAGPGRRFFRPGFLAYRHLSPDMNSLVATGTGA
    AWLYSMLVLVAPDWFPASARHVYFDSAAVVIAAVLFGKYLEELAKGRTSAAIKQLLGLQAKEAHVLRDGTELQVAIGAVV
    PGDQVVVRPGERLPVDGVVVDGDSHVDTAMLTGEPLPERKKQGDPVVGGTVNREGRLLIRATSVGQGTVLAQIIRLVEQA
    QTGKLPIQGLADRVVRIFTPLVILIALLSFFFWLLFGPPPAITLAMLSAVAVLVVACPCAMGLATPAAVMVGTGRAAELG
    VLFRKGAALEALAAVDTVCLDKTGTLTYGRPAVTRIDAADPAYLLQMAAAVESASEHPLAQAVLAAAGERHLDIPAVGDF
    TAFPGKGVRGRVDGVTVLAGTPAWMEEQGVVMAGFSTGDLQQTGGTNVCVARDGRLLGLLEISDVARPESAQVVRALGTL
    GLRVAMVTGDAEAAARVIAGRLGIDDIYAQVLPQDKAEIVRRLQAEGHKVVFVGEGINDSPALAQADVGMALASGTDIAM
    EAADITLTHGDLGGVITAIQAARQSMRTIRGNLFWAFFYNILLIPVAAGVAIPLGIQLNPMLAGVAMGLSSVFVLSNSLR
    LKRLQPWAAAP

    >gi|218667351|ref|YP_002426645.1| dsbG domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MTNDSGIQNIMNSFLMFCVLCLMSMSVAMAGDAPHGGSKAHILWTQILRHRVTYIQDGTHGPVIYDVQDPNCPYCHVLYE
    NEIPLIESGKLTVRYIPVAILTPGSQGEAAAWLQASHPLFALQHFENIVGDAFRSENTSTLPTVTASASTRIRLHDNLLI
    IRSLGVTGTPAIIYRTEGGRIKIAMGLISRRRLVAMLPYFK

    >gi|218668168|ref|YP_002426752.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 23270]
    MTSVILLCPACGAVNRVPKERLGENPKCGKCHAQIFPDHPVNLSSSSFSQYIQKNELPVLVDFWAPWCGPCRTMAPQFEQ
    AGRAMRGRVLFAKVNTEDEPQIGNRFQIRSIPTMVLFKAGKELARMSGAMSAAELQRWLTGQGV

    >gi|218666858|ref|YP_002426753.1| glutaredoxin 3 [Acidithiobacillus ferrooxidans ATCC 23270]
    MVKGAVVRMYATGTCPYCRRAEALLSSKGITPEILRVDRDPALRQSMLKLAHGRHTVPQVFINGRHVGGYDDLAALDRHG
    ALDDLLQENGQGDG

    >gi|218667657|ref|YP_002426754.1| rhodanese-like domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MDHKILFFIESQWPLLLGAVALIIMIFKGPLTRRAAGIHEVDPATAVQLINHEDAVIIDVREQKEWSQGHLPGARHIPLG
    DLPKYMQDLEKHRGHHIICQ
    CASGMRSSRAAASLKKAGFDKIYSLRGGIGAWRSAGLPVEK

    >gi|218667942|ref|YP_002426833.1| hypothetical protein AFE_2449 [Acidithiobacillus ferrooxidans ATCC 23270]
    MAKVLLYTSPGCPDCAAVKRYLEMRGVAFDERDVTAPGVAEEAKSRYGVRVAPITVIDGGALYGTFAEQKSRLDAAFGG

    >gi|218665884|ref|YP_002426863.1| mercuric reductase [Acidithiobacillus ferrooxidans ATCC 23270]
    MTENAPTELAITGMTCDGCAAHVRKALEGVPGVREAQVSYPDATARVVLEGEVPMQRLIKAVVASGYGVHPRSDGASSTN
    DGQELHIAVIGSGGAAMACALKAVERGARVTLIERSTIGGT
    CVNIGCVPSKIMIRAAHIAHLRRESPFDGGIQAVAPTIQ
    RTALLVQQQARVDELRHAKYEGILDGNPAITVLRGEARFKDSRSVVVHLNDGGERVVMFDRCLVATGASPAVPPIPGLKD
    TPYWTSTEALVSESIPERLAVIGSSVVALELAQAFARLGSHVTILARGTLFLREDPAIGEAITAAFRAEGIEVLEHTQAS
    QVAYADGEFVLATGHGELRADKLLVATGRAPNTRRLNLEAAGVAINAQGAIVIDQGMRTNSPNIYAAGDCTDQPQFVYVA
    AAAGTRAAINMMGGSAALDLTAMPAVVFTDPQVATVGYSGAEAHRDGIETDSRTLTLDNVPRALANFNTRGFIKLVAEVG
    SGRLIGVQVVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFTRDVKQLSCCAG

    >gi|218665987|ref|YP_002426928.1| hypothetical protein AFE_2548 [Acidithiobacillus ferrooxidans ATCC 23270]
    MSDYHYLEDQGEKSVVIVMTSGPSTAHRCATPFYLGALLSSMDAEVKIFCTMEAVRLMQTGVAENLSAMAGGKRIIDFIR
    DAKNAGVEIQV
    CRPALPGYEIEADNLIDEVDAVASAGDLADLILSVDRLLFF

    >gi|218666670|ref|YP_002426933.1| pyridine nucleotide-disulfide oxidoreductase [Acidithiobacillus ferrooxidans ATCC 23270]
    MSAQDTVLVVGAGPAGLSAAATIASMGKKAVIVEKEDILGGAPIISGYAKLVPSGEWAKDAIGRMVSRVEGDGNISIHKS
    AKVTQVEGEAGNFTATLSNGDKVEAGAIILGTGFTHFDSINKPEWGFGTYEDVLTTTQMEQMVTAGQIR
    CPSDGRVPERV
    AILLCVGSRDRQIGREWCSKICCTVSTNLAMEIKEISPSTDVFIYYMDIRTFGLYEDKFYWKSQEEFKTKFVKARIAEVT
    KSPDGRLLVKGEDTLVKRPIVIPMDIVVHAIGMDPNALNPEIARTFGIGLEKHGFIDRAEQYTNSQGTTRKGIYVCGAAT
    GPEDIDSSVAQGQSAGARAVADLYGQQKIAS

    >gi|218665090|ref|YP_002426938.1| rhodanese-like domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MYGFQEITADQLKALREQGGAFTLIDVRSPGEVARGVIDGARHLPLHLLPMSVQQMDKSQPLVFYCLSGGRSAQAAAFAA
    SQGFGQVLNLRGGISAWVNRGFPLVQLSS

    >gi|218666024|ref|YP_002426970.1| thioredoxin, putative [Acidithiobacillus ferrooxidans ATCC 23270]
    MEKISELGFWQRMAAERGLIILFFSSAGCHSCRIWRGLLREYEMTREDLRVWEVDAGIDMGLTQEFEVYHLPALFLFKDG
    RYLRPLQVEARPQALHRLVESVKDLPGEEQP

    >gi|218665322|ref|YP_002426974.1| glutathione S-transferase [Acidithiobacillus ferrooxidans ATCC 23270]
    MKLYYSPGACSLSPHIILNEGGFSFDRERVDLASKKTETGADYAAINPDGYVPALLLDDGQVLTEGPAIIQYLADRVPEK
    KLAPPLGTLERYRLMQWLNFISTELHKGFSPLFHPQAPKEWKTVVAAQLGRRLSTVSRQLEGKDWLLGEGFTVADAYLFT
    VLGWGRHVGIDVEQWPVLQAYQGRVSTRPAVQSALKAEGLLQDT

    >gi|218666995|ref|YP_002427020.1| hypothetical protein AFE_2643 [Acidithiobacillus ferrooxidans ATCC 23270]
    MTIALIVLHAAPEADNPRADTAVRLAGAMLAEGKEVRLFLAGQGIGLLAPAREFAKSTRALFLELLDLGLTVQCCGTSLK
    SQGWAGSLPDGVTKSSMKGLSDWISAADEVVCF

    >gi|218667029|ref|YP_002427168.1| methylated-DNA--protein-cysteine methyltransferase [Acidithiobacillus ferrooxidans ATCC 23270]
    MPNEPLRLQMEHVATPLGTMLLVTDTQGRLRALDWADSEGRMRRLLQLHYGRQGFDLRMGAVQKHIHGCLDAYWSGDLGA
    LNAVPVKTGGTAFQQSVWTFLRTISAGHTRSYQEQARAIGRGSAVRAVAGANGANPVGIVVP
    CHRVIGSDGSLTGYAGGI
    ERKRWLLRHEGGNF

    >gi|218666652|ref|YP_002427218.1| thioredoxin, putative [Acidithiobacillus ferrooxidans ATCC 23270]
    MAVSGHVLEVNLDNFQEAVVGLSRKVLVLVDFWAPWCAPCRALGPVLEKLAEEMGGAFVLAKVNSDENADLSRQYQVRGI
    PAVKAFKDGKVVDEFTGALPESAVRRFIEKNLPLPGDDLRVQALDAIAQGKAAEAQALLEQAISIHPGNDPARLALAHLA
    IQQGRHADAQAQIDAMSPTFQMETEVEGLKALLEFTETAHSAPSMTTLEATIASEKGDLRAQAMYQRSLLLLLQGQEEAA
    LDQLIEMVERHKNYQDGLARKTVLKIFALQGNRGPLVERYRSRLSRALH

    >gi|218665267|ref|YP_002427237.1| thioredoxin family protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MSPERSEMKVQLLVSKWCPTCPQAEKIWAEAAQKLPMDLQILDVAERDGREVVSRLRIKTVPAVVVDGTLKAVGVQPLGD
    VLKLLGA

    >gi|218666479|ref|YP_002427312.1| methionine-R-sulfoxide reductase [Acidithiobacillus ferrooxidans ATCC 23270]
    MTRSSAGFDLTPIDAGKRAEMAQGLSAEARHVLFEHGTEPPFCGGLLHEQGDGTFVCALCGLPLFRSAAKFDSGTGWPSF
    REPFAPDHIHEIRDTSHGMVRTEIRCARCDSHLGHVFSDGPAPTGRRY
    CLNSAALRFQRTT

    >gi|218665715|ref|YP_002427313.1| peptide-methionine (S)-S-oxide reductase [Acidithiobacillus ferrooxidans ATCC 23270]
    MALTIPAPDREDAAADAPGVAVLAAGCFWCVEAVYLGLAGVTRIVSGYTGGAAQTANYRAVCTGTTGHAEAVEIHYDPAL
    LSFGRLLQVFFAVAHDPTQRDRQGNDVGTQYRSAIFTVNDAQMALARDYVAQLDQAKVFAGPIATEITPLTHFYPAEDYH
    QDYARQHPDQPYICAVALPKVEKLRTRFPQWLRENQRR

    >gi|218665533|ref|YP_002427314.1| thiol:disulfide interchange protein DsbG, putative [Acidithiobacillus ferrooxidans ATCC 23270]
    METEDRSGGKKARVGFGKSAGAALGALFFGPLLLAGCATTPDLQSAEHLVQDNFHGKARVVKVFPGPTQKLTGIIAENSQ
    HQQGILWMLSNRYLLLGPVVNDKGQDITRAATEKYLPQPRKVPAGQIAPAAMKAPGFTIGHAGPLMVVFADPN
    CIYCHLL
    WEALQKPVADGQLRVKLIPVGFLKDSSAAKAATILAAPDPAAAWAENEKGFDKSTEEGGTRPLAQIPAEDMKAVHANTAL
    LQSSGEEATPTLLFCRKKSPDIHATKGETGLRMVLVHGIAVRGLPALIHSLGGDVSAEGCTP

    >gi|218665492|ref|YP_002427405.1| glutaredoxin-related protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MATIQELIQEQVQKHPIVLYMKGSPRAPQCGFSARAVQLLQQSGVKELFTVDVLADPQIRDGIKQYSNWPTIPQLYIQGE
    FVGGSDIMSDLYQQGELQKLVSSAQAASAG

    >gi|218666508|ref|YP_002427434.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MMSTATETMTDLDSIPPVMTLTQNAADKIASLIEEEGSDDLKLRVFVTGGGCSGFQYGFTFDENMNEGDTEVHQLGVSLL
    IDPMSYQYLVGAEIDYSEGLEGAQFVIKNPNATTTCGCGSSFSA

    >gi|218666216|ref|YP_002427435.1| pyruvate dehydrogenase complex, E2 and E3 components [Acidithiobacillus ferrooxidans ATCC 23270]
    MAEPYVIKMPQLSDTMTEGVLVSWEKPAGARVERGDVVATVETDKAIMDVEVFRSGYLAGPLAEANSVIPVGGTIGYITD
    SAVETVAAPVPAAPAVVPTGPASATPPAPEGYAVKMPQLSDTMTEGVLVSWEKAPGDRIQRGDVVATVETDKAIMDVEVF
    REGYLSGPLVAVDAVVPVGEAIAWLVESPEQVSHENAVHDGGLRQPDATSAPVATPLPAAAMSGPVPGADPAPRPQQGAA
    SPFARQLAGQRGVDINGLRGTGPAGVIVAADVLGAAGGRAAPVASSGTAEPAVPGNGRAMTAIERAISQAMAASLSIPVF
    HVTVQVRPEALIRAAKAHKLSVTVAIAKAASQALHRHPLVNAAYQPVDKIVERSQHDIGIAATTEDGGLIVPVLRGVEGK
    TPEQLQTEWTSLLEKARKRRLSPPEYTNPTFTISNMGMYGIAQFDAIVTPGTAAIIAIAGNGPEGMPITITADHRVVNGA
    EAALFLNDLKQAIEHPENWLGSGGPVIPEGDYDVQVLVIGAGPGGEDCARELAENGIRVAMVNDAPLPGGE
    CLWRGCIPS
    KAWRAAADRIRDREHDAAMGITLGTPRLDWAQLEQHRRGILQTRGEMALKTDQGVKIQVLEGYARFTGDHSVEISGKDAR
    TLTFGACVIATGAPAFVPPIPGIQDALKSGAAVTSDTVWNLKQPPARLCVIGAGAIGMEMAQMFHDFGAEVRVLEALPRP
    VAEMEKEVAEQLMKAIAHNSLRLQVLTGVKVTEVAGQPGQLEVRYQSGDEAANYACDLLLVATGKRPDTSGLNLAAAGVA
    LGDRAVIAVDASGRTNVPHIYAVGDVIGGYMLAHTAGQQGRVAAASLLGHSARYEAAKDCGVTFTRPQCAFVGLSLEQAR
    AEGIDAVEVKVPLSIDAKAMMTGETDGLIKIVADKISHRIVGVHFLADHADTLVGEAVMMVSAGLTLEQVAGAIHPHPTQ
    TELFGEMARRLLSRLRRSARAAS

    >gi|218668162|ref|YP_002427594.1| OsmC/Ohr family protein [Acidithiobacillus ferrooxidans ATCC 23270]
    MEARVQWMGPGQMSFVADADSGHALVMDGAAEIGGRNLGPRPMELLLMGLGGCSSIDVVMILQKSRQDIRSCVVELAAQR
    AEQDPKVFTGIHLHFVVSGKALDPKRVSHAIGLSAEKYCSASIMLGKTAAITHDYEIREEC

    >gi|218666523|ref|YP_002426832.1| heavy metal-binding protein, putative [Acidithiobacillus ferrooxidans ATCC 23270]
    MSDIRLKITGMTCGHCVRAVTKALEGVSGVEKADVTLTPGEAVVHGQASAAALIAAVKEEGYDTAVQD