Ureaplasma parvum serovar 3 ATCC 700970 uid57711

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|13357630|ref|NP_077904.1| thioredoxin reductase [Ureaplasma parvum serovar 3 str. ATCC 700970]
    MNQEVYDLVIIGAGPAGLAAAVYAKRSGLNVIIVEKQFPGGKIALTSNVENYLGINSIPGPELAYKMYEQVLNLNVSIIY
    EAADEISLKEKYKKIKLTTQTLITKTVIIATGTENRRLNILGELEFENKGISY
    CAICDGPLYKNKAVSVIGSGNSAVEEA
    IYLATIAKEVHLIANKPQFKAEQQLVQIANNTPNIKIYYNKQTFEFFGHQFLEGLKFRDLITNEVTTLNIEANFTFIGLL
    PSRINTNNLCIFNEVNGFITTDKNMQTSVCGIFAAGDIVDKNVRQIATATNDGVIAALYAKEYITRNNW

    >gi|13357734|ref|NP_078008.1| hypothetical protein UU176 [Ureaplasma parvum serovar 3 str. ATCC 700970]
    MIYVLYSPNCAVCKKVVRFFRNNQIEITKIIIGEDKIERSMLLDILSLCEDGFGTIISFKTESSKRLNITSKTFLDLSTK
    ELLNLIQNDLNLIRRPLIYQTKNNRPYRLQIGYDSEEIEIFKRAVHEK

    >gi|13357849|ref|NP_078123.1| methionine sulfoxide reductase A [Ureaplasma parvum serovar 3 str. ATCC 700970]
    MIKSIWIAGGCFWGIQKYFDSIIGVNHTVVGYSQGNVINPSYEQVCTQTTNHTETVQIDYDDRFVSLISILEHLYQIIDP
    FSLNKQGDDVGSQYRSGIYYVDHDDEFIIKDFLLKKQNQTPKKIMIEVERLRNFNIAEEYHQKYLDKNPNSYCHVDLSLS
    KKEFR

    >gi|13357851|ref|NP_078125.1| glutathione peroxidase [Ureaplasma parvum serovar 3 str. ATCC 700970]
    MERLNMKLSDYPVLDIDKKLFNWSKVKNKLVLIVNVASKCGYAKQYEQLEYLYKKYKNKGFIIVAFPCRQFMFQEFDDNN
    KIKEFCSTKYNVTFPIMDLTNVVGSNISPLYKQLITEYPWSPKAKAVKWNFEKFFVKNDEIIGRFESKCEPNDLEEFIKN
    NL

    >gi|13358154|ref|NP_078428.1| thioredoxin [Ureaplasma parvum serovar 3 str. ATCC 700970]
    MLIKLESNQNLNELLKENHSKPILIDFYADWCPPCRMLIPVLDSIEKKHGDEFTIIKINVDHFPELSTQYQVKSIPALFY
    LKNGDIKATSLGFIDENSLVNKLRSI