Ureaplasma parvum serovar 3 ATCC 27815 uid58887

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|170762195|ref|YP_001752153.1| thioredoxin-disulfide reductase [Ureaplasma parvum serovar 3 str. ATCC 27815]
    MNQEVYDLVIIGAGPAGLAAAVYAKRSGLNVIIVEKQFPGGKIALTSNVENYLGINSIPGPELAYKMYEQVLNLNVSIIY
    EAADEISLKEKYKKIKLTTQTLITKTVIIATGTENRRLNILGELEFENKGISY
    CAICDGPLYKNKAVSVIGSGNSAVEEA
    IYLATIAKEVHLIANKPQFKAEQQLVQIANNTPNIKIYYNKQTFEFFGHQFLEGLKFRDLITNEVTTLNIEANFTFIGLL
    PSRINTNNLCIFNEVNGFITTDKNMQTSVCGIFAAGDIVDKNVRQIATATNDGVIAALYAKEYITRNNW

    >gi|170761908|ref|YP_001752258.1| hypothetical protein UPA3_0183 [Ureaplasma parvum serovar 3 str. ATCC 27815]
    MIYVLYSPNCAVCKKVVRFFRNNQIEITKIIIGEDKIERSMLLDILSLCEDGFGTIISFKTESSKRLNITSKTFLDLSTK
    ELLNLIQNDLNLIRRPLIYQTKNNRPYRLQIGYDSEEIEIFKRAVHEK

    >gi|170762212|ref|YP_001752372.1| methionine sulfoxide reductase A [Ureaplasma parvum serovar 3 str. ATCC 27815]
    MIKSIWIAGGCFWGIQKYFDSIIGVNHTVVGYSQGNVINPSYEQVCTQTTNHTETVQIDYDDRFVSLISILEHLYQIIDP
    FSLNKQGDDVGSQYRSGIYYVDHDDEFIIKDFLLKKQNQTPKKIMIEVERLRNFNIAEEYHQKYLDKNPNSYCHVDLSLS
    KKEFR

    >gi|170762368|ref|YP_001752374.1| glutathione peroxidase [Ureaplasma parvum serovar 3 str. ATCC 27815]
    MERLNMKLSDYPVLDIDKKLFNWSKVKNKLVLIVNVASKCGYAKQYEQLEYLYKKYKNKGFIIVAFPCRQFMFQEFDDNN
    KIKEFCSTKYNVTFPIMDLTNVVGSNISPLYKQLITEYPWSPKAKAVKWNFEKFFVKNDEIIGRFESKCEPNDLEEFIKN
    NL

    >gi|170762328|ref|YP_001752674.1| thioredoxin [Ureaplasma parvum serovar 3 str. ATCC 27815]
    MLIKLESNQNLNELLKENHSKPILIDFYADWCPPCRMLIPVLDSIEKKHGDEFTIIKINVDHFPELSTQYQVKSIPALFY
    LKNGDIKATSLGFIDENSLVNKLRSI