uncultured Termite group 1 bacterium phylotype Rs D17

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|189485014|ref|YP_001955955.1| thioredoxin [uncultured Termite group 1 bacterium phylotype Rs-D17]
    MAVEINKNNFAQEVLSSDKPVLVDFWAPWCNPCKMLSPIIEELAAEYEDSVKVGKVNTDENMSLSAKFQIVSIPCLILFK
    NGKTLHKTVGFRSKNDIKKIIDSALMVGDE

    >gi|189485015|ref|YP_001955956.1| thioredoxin reductase [uncultured Termite group 1 bacterium phylotype Rs-D17]
    MIYDVIIIGGGPAGLSAAIYASRARLKTLIIEKTGCGGQMTTTDLLENYPGFNGGINGFELAVKLEKQARDFGAEIIYDE
    VGAIEQGLSKKVITANSAYETKTVIIAAGTYAKKMNIPGESEFMGRGVSF
    CAVCDAPFYRDKNVLVVGGGDSAIEEAAYI
    SKFAKNVTVVHRRDKLRAAKILQERMKLHPNISVIYDSVPKEIFGSDSVEKVTITNVKTNESKGLIIDGVFVFTGLIPNT
    LFLSGVALDKTGYIITDEDMNTSSTGIFACGDIRKKQLRQVVTAASDGAQAAVSAQRCIENL

    >gi|189485416|ref|YP_001956357.1| glycine cleavage system L protein [uncultured Termite group 1 bacterium phylotype Rs-D17]
    MNFNKYDIAVIGLGPGGFTAAVRAAQLGAKVAVIEKSFTGGTCLNCGCIPTKFLWQSLKTKQKIQKSYEYGFKAVLEPVI
    FSDIIAKKDKNIANIRKGMEMVLASHKLDVIIGSALFKDKNTLTVLNNERGTVSEDVIYEVLADKIIIASGTKPSIIKGS
    AFDGSKVISSTEVLNLKEIPKNMLIIGGGAIGVEMATIFSGFGCQVTLSEYENCLLPNEDEEISEEIRKNLLRHGVNVLT
    SCADALDDIDKYEKVLIVTGRTPNNDLGLDNIGIKMAKKGFIETNEFCQTNIENIYAVGDIAGKNLLAYTAQNEGALTAE
    NVVRGNFIAVDNFIVPQAVFAMPQSASVKVLDFSKYQDVVFGKFPFTASGRAFIENERAGFVKCAVDKTTKKPLAFWIVG
    AHSDELINTASQILKSGMEYISRETMFHPSFSESLLNAYEYALGKCTELVKNKD

    >gi|189485475|ref|YP_001956416.1| 6-O-methylguanine-DNA methyltransferase-like protein [uncultured Termite group 1 bacterium phylotype Rs-D17]
    MKNYPDFYVKVWKACFKISAGKTLTYLQLAKNIGAPKAARAVGTALSKNPFAPVIPCHRVIRTDGKMGGYSAAGGIKKKL
    KMLRYEKETGKDASLD