Tsukamurella paurometabola DSM 20162 uid48829

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296137831|ref|YP_003645074.1| heavy metal translocating P-type ATPase [Tsukamurella paurometabola DSM 20162]
    MTDLQSAAPPASADESADATAEAQRTFLDVGGMTCAACVGRVERKLNKLDGVRAVVNLATRTATVEHAPTVTVEQLTGTV
    EAAGYTAAPKSPNPRRAMLAEERERRDVLRRLVVSLVLFVPAADLSIVLAIIPSTRFPGWQWVLLALSLPVVTWGAWPLH
    KKAWQGARHGAATMDTLVSVGIISATAWSVVTVLTPGRQRPDPHGLWNAIVQSDPIYLEVAMGVTVFVLAGRYFEASARA
    KAASALRDLSTRGARDVSVLVRDGSELRIPIGELREDQVFVVRPGETIATDGVVESGSAFVDNSAMTGESRPVPAGPGDR
    VVGGTVCQDGRLTVRAIAVGEDTTFAAMLRLVEDAQATKARMQRLADRVSAVFVPCVFAIAALTFAGWMLFGGSIDDAVK
    AAIAVLVIACPCALGLATPVAFMVASGRGAQLGVYVRGHQALEATESIDTVVFDKTGTVTTGLLEVAAIAVADGFTEAQV
    LRLAGAVETASEHAVARAVVARAGADLPAVEDFRAVPGLGATGTVDGRTVRVGNPRFVSPGVLAPAVDAAAEAGRTVAVV
    EVDGAVAAVMEIADTIKPDARAAITRLHEAGITTVLLTGDNAAAAAKVAAAVGIDDIRSDVLPEGKVAEIRALQAEGRRV
    AMVGDGVNDGPALAAADLGLAMGTGTDVAQGAADVVLMREELSAVPDALGLARATLKTIKTNLVWAFGYNVAAIPIAAAG
    LLNPLISAAAMSFSSFFVVWNSLRLRRFGSR

    >gi|296137856|ref|YP_003645099.1| hypothetical protein Tpau_0106 [Tsukamurella paurometabola DSM 20162]
    MEHRTPITIWLDPVCPYSWQTAAWLRETVDDPDALRWELMSLALLNEGRDLPERARARMRDSGAAGRLFAALGTELDDAA
    RWRALAAFSAWYHHDAPALDAAPVARLLTDLGLPTRYADALADASWDVAVRAEHARSQEAAGGSAGSPLVRIGEATFHGP
    VLTTVPEPEAAAALLAGLRSLAAVDAFTSVQRLRPDQ

    >gi|296137881|ref|YP_003645124.1| Rhodanese domain protein [Tsukamurella paurometabola DSM 20162]
    MMDARGFPTDDGLISIDALPEVATITLLDVREPDEWELGHAPGALHIPLSDLPLRFEEIDLDSDVYVICRGGGRSESAVR
    YLETVGVEAAVVDGGMIAWAAAAKPVVRSDGGPGVV

    >gi|296138325|ref|YP_003645568.1| DSBA oxidoreductase [Tsukamurella paurometabola DSM 20162]
    MRVDVWTDINCPFCYIGKARFDKALATFEHASDVQVIHRSFELDPSAAEGSSEPVVPMIAKKYGISEAEAAANERGLGAQ
    AQELGLQYQVAGRDAGNSFDMHRLLHWALELGRQEELLDALYAANFASPEPAFGDRNRLVAIAESAGFDGAAARAVLDDE
    TAYADAVRADEATASRIGVGGVPFFVFDGKYAVSGAQLPSVFTEALDRAWADRPEPLTVIGGDDAACGPDGCELPPRG

    >gi|296138407|ref|YP_003645650.1| Heavy metal transport/detoxification protein [Tsukamurella paurometabola DSM 20162]
    MAVETTYTVTGMTCGHCAASVREEISEIGGVTAVDVNVETGAVTVTSDADLTRDDVSAAVSEAGYTLA

    >gi|296138422|ref|YP_003645665.1| Redoxin domain protein [Tsukamurella paurometabola DSM 20162]
    MAAALLAGTLLLTGCTQYSDRSAEGGVIAPGGKLEQFYEPAKRSTVGELSGRSVTDPNTTLSLKDYEGKVVVINVWGSWC
    AP
    CRIEAPELEKVYVASKPRGVEFLGINVRETAGDDAARDFIDSFKLTYPSIYDPPGKTLLAIGEQYPTTVVPMTFVLDR
    QHRVAAVYLTTVGEKELTGTIEKVLGEQ

    >gi|296138718|ref|YP_003645961.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Tsukamurella paurometabola DSM 20162]
    MTNIVIIGGGPAGYEAALVAVAHGGDVTVVEADGIGGACVLYDCVPSKTFIASTGIRTETRRAVDLGIELHFERVEIDVE
    RINGRVKDLAAAQSADIRARLAGEGVRMIRGRASLAPSNPAMAQHMVNVITPTGGEQMLEADVVLVATGASPRVLDSAKP
    DGERIVTWRQLYDLEELPTHLVVVGSGVTGAEFVHAYTELGIKVTLVSSRDRVLPHEDEDAALVLEDALVDRGVSLVKRA
    YADKVERTDDGVVVRLTDGRTVEGSHCLMTVGSIPNTDGIGLADVGIELNKGGYIPVDRVSRTKVPGIYAAGDCTGVLPL
    ASVAAMQGRVAMYHALGEGVSPIKLKTVSSAIFTRPEIATVGVSQASIDDGTYQARTVMLPLATNPRAKMSGLKRGFVKV
    FCRPNTGVVIGGVVVAPNASELILPLTLAVQNGLSVDDVAQTFSVYPSLAGSVTEAARQLMRQDDLA

    >gi|296138763|ref|YP_003646006.1| Rhodanese domain protein [Tsukamurella paurometabola DSM 20162]
    MAIETDPSPELQDYAHPERLVTADWLSGHLGVPGLKVIESDEDVLLYDIGHIPTAQKVDWHLHLNDAVTRDYIDGEAFAE
    LMRSKGINRDDTVVIYGDKSNWWAAYALWVFTLFGHPDVRLLDGGRDLWISDGRDVSLDRPDYPRSDYPVVERDDARIRA
    FADEVRADLGRRALVDVRSPQEYTGERTHMPDYPEEGALRGGHIPTAVSIPWAKAARADGRFLPHAELSAVYGDLDPAAP
    VTAY
    CRIGERSSHTWFVLTHLLGFTDVKNYDGSWTEWGNTVRAPITRGAEPGSVPGS

    >gi|296138823|ref|YP_003646066.1| peptide methionine sulfoxide reductase [Tsukamurella paurometabola DSM 20162]
    MTDTGTITITDGTETAVLAGGCFWGMQDLIRRQPGVLATRVGYTGGSNPNATYRNHPGHAEAVEIVFDPNATDYRSILEF
    FFQIHDPSTKDRQGNDIGSSYRSAIFPLSAAQEEIARETIADVDASGLWPGKAVTTIEPAGPFWQAEPEHQDYLEKFPDG
    YTCHFPRPGWKLPKRADA

    >gi|296138851|ref|YP_003646094.1| UBA/THIF-type NAD/FAD binding protein [Tsukamurella paurometabola DSM 20162]
    MSTLPPLVEPAAELTRDEVARYSRHLIIPEMGVEGQKRLKNAKVLVIGAGGLGSPALLYLAAAGIGTIGIVEFDEVDASN
    LQRQVIHGVSDLGRPKAESARDSIAEINPLVTVNLHQERLEPENAVQLFEQYDLIVDGTDNFATRYLVNDAAVLAHKPYV
    WGSIFRFEGQASVFWEDAPDGPNGEKQGLNYRDLYPVAPPPGMVPS
    CAEGGVLGILCASIGAIMGTEAVKLITGIGDSLL
    GRLMVYDALDMTYRTIKIRKDPASPAITELIDYEEFCGVVSDEAQAAAAGSTITPAELVELGEQGVEYELIDVREPVEWD
    IVHIDGAKLVPKSVFETGEGLERVSADKKLVLY
    CKTGIRSAEVLAAVQGAGYRDAVHLQGGINAYARQVDPSLPVY

    >gi|296139047|ref|YP_003646290.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Tsukamurella paurometabola DSM 20162]
    MTTSARLEPGVSAPSFTLPDQNGNPVSLSDYRGRRVILYFYPAAMTPGCTKQACDFRDNLSDFEAAGLDVVGISPDKPDK
    LKKFVERDGLTFPLLSDPDKQVLTEYGAFGEKMMYGKTVTGVIRSTFVVGADGKIEVAQYNVRATGHVAKLRRDLKL

    >gi|296139123|ref|YP_003646366.1| DSBA oxidoreductase [Tsukamurella paurometabola DSM 20162]
    MTETAPSKDRVDFWFDPLCPWCWITSRWILEVEQVRDIDVNFHVMSLAVLNEGKDDLPEIYRELMKTAWGPVRVLIAAAQ
    LHGDQVLAPLYTALGTRIHNRGEQDHAAIIAESLAEAGLEADLADAATSTDYDEALRASHHAGMDKVGPDVGTPTIHVNG
    VAFFGPVLSRIPRGEDAGKVWDGTVLLASYPHFFELKRTRHEDPEFD

    >gi|296139249|ref|YP_003646492.1| iron-sulfur cluster assembly accessory protein [Tsukamurella paurometabola DSM 20162]
    MTAAEAQTEATGVVLTDAAASKAKALLDQEGRDDLALRIEVQPGGCAGLRYQLYFDDRSLDGDVVSEFGGVNLSVDRMSA
    PFLIGAKIDFVDSIEKQGFTIDNPNATGSCACGDSFN

    >gi|296139410|ref|YP_003646653.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Tsukamurella paurometabola DSM 20162]
    MSEQVFDLVIVGSGAGNTIPDERFDDRSIAIVDKGQDYNGAFGGTCLNVGCIPTKMFVYPADVADEAREAGPIGVDAEVT
    ATHWAQIRDRVFGRIDRYAAGGLRYRVDTCPNVTVFQQQAWFLPASGDGLHRLELADGTVVAGRDVVLAAGSRPVIPPVF
    AQGSAPVHTNDSIMRLESLPGRVIIVGGGYIAAEFAHVFAGLGAEVTVVARGPRLLRSQDQTIAEAFTQAVSQRWDVRLS
    TEVTATRAAGDGVEVDLTDGSTVAGDVLLVATGRTPNGDTLATSAIGIELDGAGRVPVDEHQRTPVRGVWALGDVSTPFP
    LRHVANHEARVVAENLLSGWDAPAATTDHRFVPGAVFSRPQVASVGLTEAVARDRGIDVAVVEQRYADIAYGWAMGDAEG
    VCKLIADRETGLLVGAHIVGHQASALIQSAITAMSFSIPAKEFARGQYWIHPALPELVENALLGLHTER

    >gi|296139604|ref|YP_003646847.1| methionine-R-sulfoxide reductase [Tsukamurella paurometabola DSM 20162]
    MSTPSEASDSTPRPTLQLSDSEWRKRLSASEYRVLRQAGTEAPFTGEYTDTKTTGVYRCRACNAELFRSDSKFDSHCGWP
    SFFSPLAGDAVIEREDTSLGMRRVEVLCANCGSHLGHVFEGEGYDTPTDLRY
    CINSISMRLEPDEA

    >gi|296139610|ref|YP_003646853.1| heavy metal translocating P-type ATPase [Tsukamurella paurometabola DSM 20162]
    MATETHAPTTVVDLDIDGMTCASCANRIERKLNKLDGVTATVNFATEKAHVTTPAGTDAAILIDAVEQAGYAAHVPAPSG
    DETIGDPTGRTHEPVDALRQRLVISAALTIPVIAMAMIPALQFDYWQWLSLTLAAPVVVWGALPFHRAAWTNLKHGTATM
    DTLVSIGTLAAFGWSVYALFWGAAGVTGMTHPFSFTIERMDGTANIYLEAAAGVTTFILAGRYFEAKSKRQAGAALRALL
    ELGAKDATVLRDGVETRIPISELTVGDEFVVRPGEKIATDGLVVSGQSAIDASLLTGESVPVEVCAGDAVTGATVNAGGR
    LVVRATRVGADTQLAQMSRLVEDAQAGKAKAQRLADRISGVFVPIVIAIAVGSLGFWLGSGQPASMALTAAVSVLIIACP
    CALGLATPTALLVGTGRGAQLGILIKGPEALESTRRVDTVLLDKTGTVTTGIMKLHAVHAAPGETETDVLATAGTLEAAS
    EHPIARAIAQAAQHRGTLAAVDQFVNVPGLGVQGMVGDRAVVAGRPTLLDDWAMPLPDDLRTAFDEAQHRGQTAIAVGWD
    GAARGVLVVSDEIKPSSKDAISRLRGLGLRPIMLTGDNEPAARFIADQVGIDEVIAEVLPEQKVDVVRRLQGEGRSVAMV
    GDGVNDAAALAGADLGIAMGTGTDAAIEAADLTLVSGDLRTVVDAIRLSRRTLSTIKTNLFWAFAYNLAALPLAAAGLLN
    PMLAGGAMALSSVFVVSNSLRLRGFRPQK

    >gi|296139751|ref|YP_003646994.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Tsukamurella paurometabola DSM 20162]
    MRTGGPAPDFALPDQSGTVRTLDELRAGRRAAVFFYLTAGLPVCVAEVGRFRDAATQFERLGTARIGISMDPLLRTQAFA
    EVMAPGFPLLTDADGAVAAEYGVKRGRYAMAPVRRQSFLVDTDGTVLQIVVGELRAVAHVEETLAFLRTLNP

    >gi|296140123|ref|YP_003647366.1| glutaredoxin-like protein NrdH [Tsukamurella paurometabola DSM 20162]
    MSSVTVYTKPACVQCTATYRALDKAGIEYTSVDISVDSDARDYVLALGYLQAPVVVIDGGDHWSGFRPDRIKALQAA

    >gi|296140196|ref|YP_003647439.1| thioredoxin [Tsukamurella paurometabola DSM 20162]
    MATTELTAEKFDQTVTGNDIVLVDFWASWCGPCRAFAPTFEKASDAHPDVVFAKVDTEAEQGLAAAANIRSIPTLMVFKK
    GNLVYNEAGALPPAALEDLIAQAKELDIEPADFSATDEKPAE

    >gi|296140411|ref|YP_003647654.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Tsukamurella paurometabola DSM 20162]
    MSAHAYDVIVIGAGPVGENVADRAVRGGLSAVLIESELVGGECSYWACMPSKALLRPGQAVAEARRVRGAAEAVIGTVDP
    IAVLARRNTVVHDWSDEGQVGWAEGAGISVIRGRGRLSGPKTVTVTAADGTESTLAARHAVVVATGTDATVPPVDGLRDV
    RPWTSREATSAKQVPGRLAVIGGGVVAAEMATAYASLGSTVTMVVRSGLLANMEPFVGALVGDALREQGVEVLLGTSPSR
    VTRAGEEVTIETSDGRSIVADEVLVATGRSPRTADIGLESVGLEPGSWLSVDETMLVDGFDWLYAVGDVNHRALLTHQGK
    YQARAAGDVIAARANGEQVCDGPWGTHAATADHTAVPQVVFTDPEVASVGLTEAAARAAGHSVTVADYDLGWVAGASLYA
    DGYAGRARMIVDGERGVLLGATLVGSAVAELLHAATIAVVGEVPIDRLWHAVPAYPTISEVWLRLLETYRDR

    >gi|296140414|ref|YP_003647657.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Tsukamurella paurometabola DSM 20162]
    MTDLPEGPLPVGSIAPDFTLRDQNNRPVSLSSYRGEKNVLLVFFPLAFTGTCESELGGIRDSLQLFENDDAAVIAISVGP
    PPTHKVWSGSQGYLFPVVSDFWPHGAVSRAYGVLNEKNGYPNRGTFVVDRDGVIRFAEMNEPGVPRDQSLWEHALAALAS
    TGRRV

    >gi|296140446|ref|YP_003647689.1| peroxiredoxin, Ohr subfamily [Tsukamurella paurometabola DSM 20162]
    MIDVKYTAEAIATGAGRDGHVRSDDGRVDLDLAIPVGMGGSGEGSNPEQLFASGYAACFHSALQLVARTRKVAIDGSSVG
    ARVGIGPNGDGGFGLTVTLEVVIPELDATTAQELADAAHQV
    CPYSNAVRGNVDVTVTVADD

    >gi|296140663|ref|YP_003647906.1| glutaredoxin-like protein NrdH [Tsukamurella paurometabola DSM 20162]
    MSQVEITVYTKPACVQCNATYKALDKAGLEYRLVDITEEPEARDYVMALGYLQAPVVVAGEDHWSGFRPDRIKALVAATA
    TA

    >gi|296140669|ref|YP_003647912.1| Rhodanese domain protein [Tsukamurella paurometabola DSM 20162]
    MGKIVLFYVFTPLADPEAIRLWQRALCEANGLRGRILVSPHGINVTVGGEIRAVKRYVRATKEYRAFAGADIKWSDGSAE
    DFPKLSVRARDEIVTFGVPDEIVVDADGVRDGGTALSPEEVNELVRQRPDAVFFDGRNAIEAEIGRFAGAVVTPAKTTRD
    FVGLLDSGEYDHLKGRPVITY
    CTGGVRCEVLSALMRNRGFGEVYQLDGGIARYGERFGDGGLWEGAMYVFDRRMSVSFSD
    RSKRIGRCAQCGTPTSNVANLPEPRDRELAVLCEDCAS

    >gi|296140690|ref|YP_003647933.1| alkyl hydroperoxide reductase, F subunit [Tsukamurella paurometabola DSM 20162]
    MLEASLATQLKSLLANVTMPVELVSTLDDGPKSAELAELLDEIAGMSEHITHDRTGDDPRTPSFLIRRAGTDIAVQFAGI
    PLGHEFSSLVLALLQVGGHPSKEAAELLEQVRELDGDYHFETYFSLS
    CQNCPDVVQALNLMSVLNPRITHTAIDGSLFQD
    EVDSRQVMAVPTVFVNGEPFDSGRMTLEQIVGKLDDGAAERTAASLAEKDPFDVLVVGGGPSGATASVYAARKGIRTGIV
    AERFGGQVLDTMAIENFTSVSYTEGPKFAAELENQVRQYDVEIMNTQRGAHLRRDEATGMISVELTSGAALQSRTVVIST
    GARWRSMDVPGEAEYRNKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVSHVTLIEFDSELRADQVLQRKLRS
    LPNVDVLVSAMTTEVLGDGGKVTGLTYTSRTSDESHTLELDGVFVQIGLLPNTEWLEGTLELSARGEIVVDEAGRTSVPG
    VFAAGDCTTVPFKQIVVAAGAGATAALSAFDHIIRTDVPADVVAG

    >gi|296140691|ref|YP_003647934.1| peroxiredoxin [Tsukamurella paurometabola DSM 20162]
    MSLINKQIKPFTAEAFKDGNFVTVSDEDIKGKWAVFYFYPADFTFVCPTELGDLADHYEELQSLGVEVFSVSTDTHFTHK
    AWHASSDTIAKIKYAMIGDPSLQISTDFEVLREGQGLADRGTFLVDPDGVVQFTEVTAEGIGRNAAELVRKVKAAQYVRS
    HPGEVCPAKWEEGADALAPSLELVGKI

    >gi|296140693|ref|YP_003647936.1| hypothetical protein Tpau_3002 [Tsukamurella paurometabola DSM 20162]
    MGVSKGKNAKYVPVKQSNTMTYVLGGIAVLVVIVVVIGGVLLLSKKEGTPADKVTAAINGATPVFVLGKDDAKTKLTFFE
    DPY
    CPACGNMERNYGEQITKGIEDGSLQIKFFMLSFLNQQSPSRDYSDRAGGGLLAIAKSSLPDDQKQKAWLGAHSAMYA
    QQPQEGSGDRDNAGLATVMADGAKSKGVELPADVIAAIRDGKYTAESATNAAAGSKLMQEIGSTGTPTVVKDGELLKVQG
    DWLTQAMA

    >gi|296140737|ref|YP_003647980.1| glutaredoxin-like protein [Tsukamurella paurometabola DSM 20162]
    MSQLTMYTTSWCGYCNRLKTGLKANGIEWTEINIEEDPSAAEFVQGVNGGNQTVPTVKYSDGSTATNPSLADVKRKLGV

    >gi|296140740|ref|YP_003647983.1| Rhodanese domain protein [Tsukamurella paurometabola DSM 20162]
    MIEPIVDADWVRNHRDRVILADARCYLDGRSTRAAYDSGHLPGAVYVDLDAYLAAPPSPADGRHPLPTPETFAEGLSAAG
    IGDGATVVAYDDEGGVMAARLVWLLRALGEDAALLDGPPEAVAPLTTEAPPARFAAFTPRPWPEAKLASIDETAAAAESG
    AAPVIDARPAERFRGDLEPIDPRPGHIPGARNVPCRENLDNGRLLRVDALRARFTDAGLTPDGEYIAY
    CGSGVTACHNLV
    VAEHAGFTGGKLYPGSWSQYSADGSRPAATEE

    >gi|296140780|ref|YP_003648023.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Tsukamurella paurometabola DSM 20162]
    MKPGDKAPEFELSDQLGHPRKLSDLLADGPVALFFYPAAFTPGCTKEACHFRNLAAEFAEAGVQRIGISRDAVAKQQEWA
    AKHELGYPLLSDADGAVASAYGVRRDGLLKLAGMPTKRTTFAIRADGTVADVIASEVNMQVHADRALAALRN

    >gi|296140793|ref|YP_003648036.1| methylated-DNA/protein-cysteinemethyltransferase [Tsukamurella paurometabola DSM 20162]
    MTAYSSTLDTPAGPFTAIVDADGAVLASGWTADLGTLLPVIHTGLRPAAVTQRADLGAVTRAVAAFHAGEVTAIDGIPVR
    QRSGVFVEHAWEVLRTVEPGQPVTYTEYAGLAGRPAAVRAAAMACARNAAALFVP
    CHRVLRTDGTLGGFRWGLAVKEWLL
    RHEALTIAT

    >gi|296140825|ref|YP_003648068.1| protein of unknown function DUF255 [Tsukamurella paurometabola DSM 20162]
    MSNRLGASTSPYLRQHADNPVHWQEWSDAALAEAAERDVPILLSIGYAACHWCHVMAHESFENEAIAAQMNEGFVCIKVD
    REERPDLDSIYMNATVAMTGQGGWPMTCFLTPGGAPFYCGTYYPPEPRNGQASFPQLLDAITDTWRERRGDVDRVSDQVA
    GHLRQASSGLPDGAPPSPGDLATAVATLVADEDPSGGFGRAPKFPPSATVEALLRHHERTGDAAAYAVAVRCAEAMARGG
    IYDQLGGGFARYAVDADWVVPHFEKMLYDNALLLRFYAHLGRRTGSPLALRVADETADFLVRDLGVHGAFASSLDADTEI
    DGHGVEGATYVWTPSQLAEVLGDDDGAWAAEVFAVTDGGTFEHGTSTLQLRGDPDPARLADVRRKLFHARQSRPQPARDD
    KVVTVWNGLAITALAEAGRVPDAAACARYLLEKHWNGATLRRSSLDGVAGEAQGMLEDYAALVTGLLALRQRTGDTAWSD
    DAAVILDAAIDKFADPDASGGWYDAPSDGEALLTRPRDPADGATPSGASLIAEALTYAEVLLGERYAGLAAATRARSGEL
    LRRVPRGAGHHLAVAEQATAGLQIAVADGAGAAALTAEARRLAPGGAIVVAGAKDSQVLLEGRGPVDGRAAAYVCRGTVC
    SLPVTDGETLAIELAP

    >gi|296140879|ref|YP_003648122.1| arsenate reductase [Tsukamurella paurometabola DSM 20162]
    MDATIYHNPRCTKSRQALARLEEAGATVTVVKYLDQVPSKAQLRTLIEDAGLTVRQAVRTREAEYKDLGLADATDDQLLD
    AMIAHPKLIERPFVVTGKGTRMARPTEAIDEIL

    >gi|296141093|ref|YP_003648336.1| OsmC family protein [Tsukamurella paurometabola DSM 20162]
    MTASTTGALTAIIDVTRDAVTRNTANAHVVFSASAVPKGTVGSVSTARQHTLAVDEPPTLGGEDTAINPVEAYLGALLAC
    QVVTYRFYADKLGVTIDELALSAEGDLDVRGFFGLEDGVRPGFTAVRVTVNISGPDSADRYRELTDTVDAHCPVLDLTQN
    PTPVTTTLVVG

    >gi|296141222|ref|YP_003648465.1| Thiosulfate sulfurtransferase [Tsukamurella paurometabola DSM 20162]
    MARSDVLVSADWAEQNLDTPGVVFVEVDEDTSAYDGGHIAGAVKLDWKKDLQDQVRRDFVNAEQFGALLSERGIGNDDTV
    VLYGGNNNWFAAYAYWYFKLYGHQDVKLLDGGRKKWELDGRALTADAVSRPATTYTAQAPNNAIRAFRDEVVEAIDVKNL
    VDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSKAANEDGTFKSDEDLAALYAEAGLDGQKETIAY
    CRIGERSS
    HTWFVLQELLGHKNVKNYEGSWTEYGSLVGVPVELGA

    >gi|296141225|ref|YP_003648468.1| methylated-DNA/protein-cysteinemethyltransferase [Tsukamurella paurometabola DSM 20162]
    MSEKSTELLSAPADSSTLSRLSGSVPRILPAPHRLDRAARELDEYFEHPRKAFDLDRDLSLSQSFRQPVQRHLPEIGYGE
    PRSHREIAELVGNPGAVLAVGSACATNPLPVVVP
    CHRVVKSGGGVGQYVGCVEAKATALELDAA

    >gi|296141291|ref|YP_003648534.1| Peroxiredoxin [Tsukamurella paurometabola DSM 20162]
    MTALDSIALTSLDGSATSLAEYAGRAVLVVNVASKCGLTPQYAGLEALATRYADRGLTVLGVPCNQFAGQEPGSAEEIAT
    FCSTTYGVTFPLLEKTDVNGDARHPLYVELATTPDAEGEAGDITWNFEKFLIAPDHVTVQRFRPRTEPESDEVVGAIEAV
    LPS

    >gi|296141340|ref|YP_003648583.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Tsukamurella paurometabola DSM 20162]
    MNETQILDTVIVGGGAAGLTAAQVLGRARRAVTVVDAGAPRNAPAEHMHGYLGHDGLDPAELLAIGRREAQAYGVRILSG
    VATAVRRDGDLIEVIVGDEVLRARTLLVATGLTDVLPDIPGVAERFGRDAIH
    CPFCHGYEVRDRPLAVLGGENAAMSVHQ
    ALMIPQWSRDLIFFTNGLDITADDREKIEARGVRIVDGTVHDVIADDRLRAVRLADGTQIEREAVFVAPRFVPQDGLLLQ
    LGAERGENGFVPVDPMGRVLPGTWAAGNVVNPMAQVIVAAGAGSVAAAAISAHLLERDIEAELARARR

    >gi|296141348|ref|YP_003648591.1| dihydrolipoamide dehydrogenase [Tsukamurella paurometabola DSM 20162]
    MADHFDTVVLGAGPGGYVAAIRAAQLGQKVAVIEEKYWGGVCLNVGCIPSKALLKNAELAHTFTHKAQLFGISGDVSFDF
    GAAFDRSRKVSEGIVKGVHFLMKKNKITEINGYGTFVDAKTIQVGDQTVTGDNIIIDTGSTVRLLPGVTLSDNVVTYEEQ
    ILTRDLPESIAIVGAGAIGMEFAYVLKNYGVDVTIIEFLDRALPNEDADVSKEIAKQYKKLGVNILTSTKVESVDDQGSQ
    VVVKYTGPKGPGEITVSKVLMSIGFAPRVEGFGLEKTGVALTERGAIAIDDYMRTNVPGVYAIGDVTAKLQLAHVAEAQG
    VVAAETIAGAETQTLGDYRMMPRATFCQPQVASFGLTEQQAKDEGYDVKTATFPYSANGKAQGLGDAVGFVKLVSDAKYG
    ELLGGHLIGPDVSELLPELTLAQKWDLTVNELARNVHTHPTLSEALQESIHGLAGHMINL

    >gi|296141597|ref|YP_003648840.1| Redoxin domain protein [Tsukamurella paurometabola DSM 20162]
    MTDREPAPLLPGEKPSRVSGTTRWVIVCAVIVVALVVAIWPRSGGSGPAPEPTGAPSASVSPGELRAARDRAALAPCPTG
    GVPRGPLAGLRLDCLADGRTLDAGAFPDGLPVLVNVWAWW
    CAPCRVELPALAEVARRGADKLTVLTVHADPNAAAALDLL
    TELKLTLPTVEDPQSKVATMLGAPRVYPATILLRADGSVAKVHARPFTSVDDVTAAVRDDLGVVL

    >gi|296141631|ref|YP_003648874.1| peroxiredoxin, Ohr subfamily [Tsukamurella paurometabola DSM 20162]
    MSLKLLFSTSSTATGGGRDGHVKSDSGRLDLDTRPPAELGGNGEGTNPEELFSAGYAACFLGAVHAVARAEHVSVPDDAS
    VSVKVGFGKTEHGFGINAAITASLPGLDQSAAEDLVAKAHKL
    CPYSNATRGNIDVDLTTQV

    >gi|296141671|ref|YP_003648914.1| methylated-DNA/protein-cysteinemethyltransferase [Tsukamurella paurometabola DSM 20162]
    MAAGFALFDTAIGRCGIGWSADGVVNAVRLPEESDEQTGAFIAHGAAESVPPETIQRVIDAVVALTDGTNLQDDLTWVVL
    DMNGLTDFQRAVYEVARRIPPGHTRTYGEVAHEIGLPGSARAVGRALGENPFPPVVP
    CHRVTAANGRTGGFSATGGVQTK
    MRLLAIEQAVLGLW

    >gi|296141896|ref|YP_003649139.1| thioredoxin reductase [Tsukamurella paurometabola DSM 20162]
    MTAAGTDIADVIIIGSGPAGYTAGVYAGRAELKTILFEGTNFGGALMTTTEVENYPGFKSGIMGTELMDEMREQAIRFGA
    DLRMEDVESARLDGEIKEVVTSEGSYRARAVILAMGAAARYLGIPGEEALLGRGVSA
    CATCDGFFFRDQDIAVVGGGDSA
    MEEALFLTKFAKSVTLIHRSENFRASKIMLDRARDNEKIRFLTDTKVTAVQGEKSVESLAIENTVTGASATLEVTGLFVA
    IGHDPRSALVADQVTVDEEGYVQVEGRSTATGVPGVFAAGDLVDHTYRQAITAAGSGCSAAIDAERWLAHHREAAVAQ

    >gi|296141897|ref|YP_003649140.1| thioredoxin [Tsukamurella paurometabola DSM 20162]
    MADTTTATVTVTDADFKATVLESSKPVLVDFWATWCGPCKMVAPVLEQIAADHADSLVVAKVDVDANPAAPRDYQVLSIP
    TLILFKDGEPVAKLVGAKSKSAILKELEAVL

    >gi|296141937|ref|YP_003649179.1| glutaredoxin-like protein NrdH [Tsukamurella paurometabola DSM 20162]
    MTAGARATEITSTTTTFTVYTKPACQQCTATFRALDKAGVTYRTVDVSEDTDARDYVMSLGYLQAPVVVVETATTDHWSG
    FRPDKLREHLAA