Truepera radiovictrix DSM 17093 uid49533

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|297622269|ref|YP_003703703.1| hypothetical protein Trad_0017 [Truepera radiovictrix DSM 17093]
    MGRLSSGARFLRPGYGRGASGALALGMNRLSRETSPYLLQHAENPVDWFPWGEEAFAKARAEDKPILLSVGYAACHWCHV
    MAHESFENPEIADLMNAHFVNVKVDREERPDVDAVYMSAVQAMTGSGGWPMTVALTPDGKPFFGGTYYPPEDRLGHPGFK
    RVLLSLAEAWRSRRDEVLRAAETLTNHLADLNKLPAAGEPSPGALGEEVLAEAVRALQRTFDPQHGGFGGAPKFPPHGAL
    AFLLRRPEPEAREMAYVTLDKMAAGGIFDQLGGGFARYSVDARWLVPHFEKMLYDNAQLVGVYAEAYAQTRRARYREVVE
    ATLAFVQRELTSPEGCFYSALDADSEGEEGKFYVWRADEFDVLGEDAALAKVYFGVSAAGNFEGRNVLFVPHPPAAVAER
    FGLSEAALAARLARVKRALFEIRSRRTRPGLDDKVLASWNGLMIGAFARAGRVLAEDAYLEAARRAARGVRSALLREGRL
    WHTFRGGEAKVEGLLEDYALLGLGLLELYRATLEGPWLLWALELAEVIAARFTDPEGGFFSTAADAEALVVRPKELFDAA
    LPASSAAAALLLASLARYTDRRAWETLAARALTPLREALVRHPNGFGTSLQVLAQLLAPPQEVALVGPLEHPEMRAMEAL
    LSTLPPEVAVARVAAEGDPLAAHLPFVRGRRALQGEPTAYVCQRGACQLPVTSAAALAAQLGVA

    >gi|297622386|ref|YP_003703820.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Truepera radiovictrix DSM 17093]
    MRPQRLVVVGGVAGGMSAAAKAKRQNPALEVTVFERNAYISYGACGLPYATSGVVPNLQRLIARTPAAMRARGVDVRVRH
    EVTEVDGERRCVKGRNLETGEAFCAPYDALVLATGALPVCPQVPGRALPGVHVMRRLEDAAALREAIAAGATRAVVVGGG
    YIGLEMVEALVTAGLDVRVLERQAGLLLPFGPKPAELALEEVTARAEVVLAAELLGFEGRGRLERVVTSAGTFPADVALV
    AVGVRPNNALARALGLRLGPAEAVLTDAQLRTDRDGVFAVGDLTAAHHRVTGRPAWIPLGDTANRQGRVAGTVIGGGDAR
    FRGIVGTAITKVFERAFATTGLTLAEAQRHGLSARETQITTTDHASYYPGHRPLHVTLVWEEGTGRLLGGQLVGYGDAVK
    RIDVLAALLFRQGTLQDLADLDFAYAPPFSNVWDPLAVAANAALG

    >gi|297622401|ref|YP_003703835.1| thioredoxin [Truepera radiovictrix DSM 17093]
    MAETVEFTDSNFRDETQTGLVLVDFWAPWCGPCRMVGPVIEELASDYAGKVKVGKLNVDDNQQTAMQFRVMSIPTVILFK
    DGEPVETMIGAQPKSAYQARLEKHVTSLVS

    >gi|297622425|ref|YP_003703859.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Truepera radiovictrix DSM 17093]
    MAAPQRLRVGDDAPPFALPSNRGEQRLSDYAGQWTVLYFYPKDNTPGCTQEACDFRDALPGMGAAVLGVSADDVSSHEGF
    AAAHNLPFPLLSDPDGAVAKRYGAYGTKQLYGKTYEGVLRSTFIISPEGKIAEAMYNVKATGHAERVAKRLEALRSA

    >gi|297622434|ref|YP_003703868.1| Peroxiredoxin [Truepera radiovictrix DSM 17093]
    MKPPARLQPGDRAPDFALRDASGRTVALRDLLGKGPVVVYFYPKDNTKGCTAQACAFRDHYLVFKEAGAEVVGISTDSEA
    SHRAFAEQHDLPFILLSDPKGEVARAYGATALLGLMTGRVSFVLDERGTVRHVFNDLFHATRHVDEALKVVRALSAAGQT
    PAAAPPHP

    >gi|297622535|ref|YP_003703969.1| electron transport protein SCO1/SenC [Truepera radiovictrix DSM 17093]
    MKHPSQKRFWWLAALGVVAALVAAFSWGQLRADAAPTLHGTALDNPPLVAPFELTNARGERVTLEAWRGELLLVFFGFTS
    CPDVCPLTLGRLAKIYEDLGEPEDVQVVMITVDPEHDTPEVTQRYAEAFHPDFVGLSGSTADIAEAAKRFYVGYRELGER
    SFLHTDTVALLDREGRLRLVYGQDKVARIGSDLKTILAQRRW

    >gi|297622639|ref|YP_003704073.1| methionine-R-sulfoxide reductase [Truepera radiovictrix DSM 17093]
    MDSQKRDENAPQQNPNLTPEQIYVLRHEGTERPGSSPLNYEKRPGTYYCAGCGAPLFTSATKYDSGSGWPSFYAPIEGSI
    ETKVDYKLLVPRTEYHCARCGGHQGHVFGDGPEPTGLRY
    CNNGVALTFVPDDPEDTAAER

    >gi|297622660|ref|YP_003704094.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Truepera radiovictrix DSM 17093]
    MSAPAKERPAGGARRLAWVLLGVAALAALLTFGLFRDPTRRDDIPSALIESPAPAFTMPLFARYTDPYGPTFDLADYRGT
    PIVLNFWASW
    CGPCRVEMPILEASWQEYGDEVLFVGVNTQERSQRGAQELLDEFSISYPNGLDADNRINIDYGLFGLPET
    FFIRADGTLSYRHAGEISRETLDAQIRALLE

    >gi|297622745|ref|YP_003704179.1| glutaredoxin [Truepera radiovictrix DSM 17093]
    MNAPESAPPVRLYGLAGCGPCEVAKRFLSSRGVPFTFVDVAREPERRNLLEARLGSPARGVILEDGDTLEVMQGVSVAVL
    SRWLSAYRERHGFTPWPRRGTPSRRQRS

    >gi|297622777|ref|YP_003704211.1| DSBA oxidoreductase [Truepera radiovictrix DSM 17093]
    MAKPRTSAPAQRLTLVTLGVLALVVLGIVLYARLAPRAAGAAAGELSFDGRPMLGDPAAPVEIAVFEDFKCPACAYFDES
    ILPRVERELIETGQARMYFIHYPFLGPDSTTAAIASECAYRQNEAAFWDFKTYVFRSQGNETQEWATPARLADIARNNVP
    ALDADELRACTEEERYAEVIRADRELGNRAGVRGTPTVLVDGVALDSFSFEAIQAAVQNAQSN

    >gi|297622778|ref|YP_003704212.1| Heavy metal transport/detoxification protein [Truepera radiovictrix DSM 17093]
    MATYKTELNIEGMTCEHCVKAVKGALERVPGVERAEVDLEAQRASVEGAADVQVLLRAVEEEGYRASLDTQTAL

    >gi|297623041|ref|YP_003704475.1| Redoxin domain-containing protein [Truepera radiovictrix DSM 17093]
    MYELQLGPFVLSAARFSAGVGLATFVALAELWGRRRPRLASWAWQSAWILLLSARLGFVLEHGGTYLQEPLSVLYLWQGG
    FSPLWGLAAAALYTLRVRERAAPLVAAAGLAAWGLSAALTAPSATETTLPPLTLTNLAGEPVALGAFAGKPLVLNLWATW
    CPPCRRELPLFAETAERFPEVTFALVSQGESGAQVAGFVAEQGLSLPNVLLDPGAELGRQWRAAGLPNTFFFAADGTLVY
    RHVGELSRARLEALVRQLGEAPEARP

    >gi|297623045|ref|YP_003704479.1| hypothetical protein Trad_0802 [Truepera radiovictrix DSM 17093]
    MGILEILRQPWPWYVAGPLIGLTVPLLLLLGNKAFGISSNLRHACAMLPGSSRIGLFNYDWRKEAWNLVFVLGVLLGGFV
    GGVLLANPEPLQVAASTQRELAALGVETDGALVPRGLFSWANLLTLPGLVLMVGGGFLVGFGARYAGG
    CTSGHAISGLSN
    LQLPSLVAVIGFFIGGLISTHVLLPLILGG

    >gi|297623142|ref|YP_003704576.1| dihydrolipoamide dehydrogenase [Truepera radiovictrix DSM 17093]
    MAQHDLIVIGAGPGGYVAAIRAAQLGFDVACVEKEADLGGTCLRVGCIPSKALLESSEKFLETQGALKEHGIEVAEASLN
    LAAMHARKDKVVKSLTSGIAGLFKKNKVTRYEGAARFEGPNKLVVAGKNGEETLGAERIIIATGSKSVVLPGIELDGERV
    GTSTDALAYPEVPEHLVVIGAGYIGLELGSVWKRLGAKVTVVEYLDRILPGMDGEIAKEALKVFKKQGLEFRLGARVTSA
    RAQGEGAVVEIDGQEPLHAERVLVAVGRQPNTDGLNVEAIGLELDARGFIPVDAHYRTKIPGIYAIGDVIGGAMLAHKAE
    EEGVACVEGIATGVGHVNYGAIPGVAYTEPEIASVGKTEEQLKEEGIKYKKGVFPFLANGRARALGHTEGKVKILADAET
    DRVLGVHIIGSRAGDLIAEAVAALEFGASAEDLARTSHAHPTLAEALKEAALAVDGRALHI

    >gi|297623153|ref|YP_003704587.1| peptide methionine sulfoxide reductase [Truepera radiovictrix DSM 17093]
    MTHVPHRDTATLAGGCFWCLEAVYQLLPGVERVVSGYMGGHTENPSYEEVCTGRTGHAEVVQLTFDPQRVSYEDLLGVFF
    SIHDPTTLNRQGADVGTQYRSAIFYHSQAQREAAEKLIAELEREGVWRGIVTEVVPAGTFYEAEPYHQNYYRNHPYQPYC
    VAVVAPKVAKFRKSYLSKLQNAS

    >gi|297623223|ref|YP_003704657.1| hypothetical protein Trad_0985 [Truepera radiovictrix DSM 17093]
    MHPRVEILFCMQCRWFLRAGWYAQELLSTFGGDLGEVALVPGTGGVFQVRVDGTLVWDRKAQGGFPEAKELKQLVRDRID
    PERDLGHADRP

    >gi|297623313|ref|YP_003704747.1| iron-sulfur cluster assembly accessory protein [Truepera radiovictrix DSM 17093]
    MQEETLTPTPARGMTMTAAAAKKASELLLANNKENAAIRVFVKSGGCSGYSYGMAIDDRTLEGDSLFEDRGVKIVVDKMS
    LPLLAGSEIDYIENMMGGGFSVNNPNATSACGCGHSFRTDGKAAPDGQGASCH

    >gi|297623326|ref|YP_003704760.1| Thiosulfate sulfurtransferase [Truepera radiovictrix DSM 17093]
    MAYAHPEVLVSTDWVMEHKDDPKVRLLEVNEDVLLYDTGHIPGALKIDWLLDLWDDTIREFIQPEELAQLFERLGISNDT
    TIVLYGDKNNWWAAYAFWFFTYSGHEHLKLMNGGRAKWVAEGKPMTTEVPQVARASYTPGKRNPELRAFKEDVLKHLEKV
    RAGQGALVDVRSPAEFRGEVTHMPDYPQEGVLRGGHIPGAQSIPWAQAANADGTFKSVEELRALYEPKGVTKDKEIIAY
    C
    RIAERSSHSWFVLKYLLGYPNVKNYDGSWTEWGNSVGVPIEKGDAQPAQ

    >gi|297623344|ref|YP_003704778.1| thioredoxin reductase [Truepera radiovictrix DSM 17093]
    MTDGQRDAQPTQITRADVIIVGGGPAGLTAGIYAGRAQLSTLILEKGLPGGQIAQTQEVENYPGFDEVISGAELSQRMVR
    QAEKFGAKILMEEVQRVEPQDGGFLVTGYDAQYHARAVIIATGANPRRLGVPGEDTFYGRGVST
    CATCDGFFYRGKHVVV
    VGGGDAAVEEGMFLTKFAERVSVVHRRDELRANKEAQRRAFANPKMHWVWNSVVEEILGGEQVEGVRLHNLKTGERSVLA
    ADGVFVYIGHVPNTAYLEGLVKLRESGYIDVRDEIYTNVEGLFAAGDVADEIYRQLGTSVGAGTRAAMAAERYLAEREAH
    AHVSRSEADILHPEAVS

    >gi|297623438|ref|YP_003704872.1| glutaredoxin [Truepera radiovictrix DSM 17093]
    MSDTPQKLDEEGREAPISPITMYTTSWCGDCVVTKSYLQKFAIPFREINIEADPEAAEFVMKVNGGRRSVPTLVYNGDAA
    SLSGFSRAKLDAFLARHQLRPQRPQSV

    >gi|297623471|ref|YP_003704905.1| rhodanese domain-containing protein [Truepera radiovictrix DSM 17093]
    MKRLFILLAIPLIAASLGLSQRGANFETRDVAALAAQLGDAPDTFVLDVREPWEVAEGRVAQATPIPLGELAERLDELPE
    GETIWVI
    CRSGNRSAQASALLSGAGFRAINVAGGMIAWERAGLPTVR

    >gi|297623474|ref|YP_003704908.1| rhodanese domain-containing protein [Truepera radiovictrix DSM 17093]
    MLFKRIYDEDLAQASYFIGCQRTGEAIVVDPRRDVQVYLDEAKAQGMTIRAVTETHIHADYLSGSRELAAATGATLYLSD
    EGGEEWQYRFPHEGLKHGDTIGVGNLTLEARHTPGHTPEHLSFLLTDGAATDAPGFFLTGDFVFVGDLGRPDLLDESGIG
    KDTREPMARELFRSLREEFWSLPDFVQVWPGHGAGSACGKALGAVASSTVGYEKLVSWWAPFVEKGDEEAFVRALLEGQP
    DAPVYFSRMKRMNRAGPPLLGERGTPKELDPDTLTGIGDTLILIDTRPKEAFDKDAVKGALHIPISKSFVTYASYVIDPE
    RDERDIVLLAEDAAQAAALRDRLSYVGIDNVVGFVTHFGRLERQPVTSVAPEALDELDNPFILDIRTKSEFDAGHLPGAH
    RIHGGRVMWHLDELPKDRPLVTH
    CQSGARNTVVSSALRAAGFSNVVELEGSYAAWKKAQERRVSA

    >gi|297623690|ref|YP_003705124.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Truepera radiovictrix DSM 17093]
    MADVDFDVIIIGAGQASVPLARALAEAGREVALAERKHLGGSCVNFGCTPTKAVISSAKVAHLARRAADYGVHVGAVEVD
    LEAVLARAESILQSSRQSLRSTLDEAGVRLIEGSARLAGRHGEAFGVQVGGETLRAGAVVLNTGTRTAIPPIEGLEALVE
    GGRVLTAETWLAQRTVPKHLAVLGGSYIGLELGQFYRRMGSEVTIFETAERIAAREDEDVSRALQALLEGEGVRFHLGAQ
    VERVSAQSEGLELHLEGGERVAASHLLIAAGRQPNTDALDLSSVGLEPDDGGFLEVDERLASKVAGIWVAGDIRGGPMFT
    HTAYDDFEVLASQLLGEGERTAERLVPYAMFTDPQLGRVGMSEREAREAGFEVRVATYDMKANGRARALGEEDGFVKVVV
    DARTQKLLGAAVLAAEGAELVHVFVALMNAGAPYTVLDRALHIHPTLSEATKSVVKGLGA

    >gi|297623731|ref|YP_003705165.1| rhodanese domain-containing protein [Truepera radiovictrix DSM 17093]
    MRAVTLEALLAAAEAGAAVFDLRPAPSHLAGAVPLSLEALQRGALPDLPPETPVYLVCARGQVSELAGLYLEAAGFTNVH
    HLVGGLRAWVGRD

    >gi|297624249|ref|YP_003705683.1| DSBA oxidoreductase [Truepera radiovictrix DSM 17093]
    MLRLTSDTVKAGFNTLMSNEVVTVFFDYVCPYAWRGAELVELVREPLGLTFEWQHFSLYQSNHEAQRAARAGSGAWQLWN
    ERLTEGDEGGNRGLLPFLASCAARRQGRELHDRFRLELMRARHRDHRPFSRDTLHSVAAAVGLDLCRFQSDMANPECRTV
    LAQEHYRAASLDVFGTPTFRFPGGHAAYLRLKALPGSAEEALELFCSYRRLLERFPYLETIKRPRPKGN

    >gi|297624306|ref|YP_003705740.1| heavy metal translocating P-type ATPase [Truepera radiovictrix DSM 17093]
    MRQPETTDLRRLSVGVQGMTCASCVGRVERALKNVEGVEEASVNLATEKANVTFDPQRVGVPALLTAVKERGYTPVTAQA
    SLSVEGMT
    CASCVGRVERALTKTVGVLDATVNLATEKASVTYLPDAVDLGQLKATVRKAGYEVREEAAGADRADTEREAR
    EKEGRELRLELTLAAALTLPIFLLDMVPMMIPPLGAWFHGLVPMATLYYLFFILATAVQFGPGLRFYQKGWPALRRGAPD
    MNSLVMLGTTAAYGYSVVATFLPGLLPAGTVYVYYEAAAMIITLILVGRYLEALAKGRTSEAIKKLLGLQAKTARVERGG
    QMLELPIDEVVPGDTVFVRPGEKIPVDGRVVSGSSFVDESMITGEPIPVQKGEGDEVVGGTINKTGAFRFEATKVGAETL
    LAQIIKMVEDAQGSKVPIQALVDRVVNYFVPVVLLIAALTFGVWMLFGPQPALTFALVNAVAVLIIACPCAMGLATPTSI
    MVGTGKAAEMGILFRNGAALQTLQEAKVIALDKTGTLTKGKPELTDFSVQGGFEPKEVLSLVASAEAHSEHPIAEAIVAS
    AKAQGARLLEVQDFSATPGFGVEARVNGQLVQVGADRYMTQLGLNVALFAEEAGRLADEGKTPLYAAVGGRLAAVIAVAD
    PIKDSTPEAVHALHKLGLRVAMITGDNRRTAVAIASALGIDEVLAEVLPGGKVDAVKDLQGEGRKVAFVGDGINDAPALA
    QADVGLAIGTGTDIAIEAADVVLMSGDLRGIPNALGISQATIRNIKQNLFWAFFYNTSLIPVAAGVLYPFFGVLLNPVLA
    AGAMAVSSVFVLSNALRLRGFRPPMRADTGTPRRAEPQVAAA

    >gi|297624340|ref|YP_003705774.1| dihydrolipoamide dehydrogenase [Truepera radiovictrix DSM 17093]
    MDYEVLVIGSGPGGYHAAIRAAQLGKKTACVEQEYVGGVCLNVGCIPTKALLHVAEDLREAKHAKSYGIDFGEPKVDLKK
    LEAWKSGVVQKLTGGVRSLLKGNKVDLIEGRATLKDPHTVQVGDRSVTAEKIIVATGSEPIEIPGFETDGERIVNSTGAL
    LVSEVPKRFLAIGGSAIGLEFSDIYHALGSDVTVVELMDEIVPTADRDAAKELRKSFEKRGIKILTSTKALNQKKTADGI
    EVTLERGGERETLVVDKILVAVGRKPRGTGLGLEEVGVTVERGFVPTNAHMQTNVPHIYAIGDVTKPPLLAHKAMKEGIV
    AAEHAAGKPAAYDTIVPAVVYTSPELASVGMTEQEAKDAGHKVRVGVFPLAASGRAMTLGVSEGLVKVIGDEETDLLLGF
    HMVGPAAGDMVAEAALAIEMGATLEDISLTQHAHPTIAESFMEAAEAAHGMAIHVANKRRR

    >gi|297624392|ref|YP_003705826.1| rhodanese domain-containing protein [Truepera radiovictrix DSM 17093]
    MSASTRYSHLVQAAELRALLQTDAQVRLVDVRFSLTDPLLGRRRYEAGHLPGAVYLSLDDDLSGPVREHGGRHPLPDTAR
    FAQTLGACGIGNDTHVVAYDDAAGGGMFAARLWWLLRYVGHDQVQVLDGGLDAWTAAGLELTRDVPTYPPATFTPAVRPE
    MVADMQEVRSKLRRPGVLLLDARAPERYRGEVEPLDKRAGHIPGARNRPFMGNLEGGRFKPAEALRARFADVEAADETIL
    Y
    CGSGVSAAHNALALEEAGLRGAKLYVGSWSDWSSFEENPVATGEEA

    >gi|297624452|ref|YP_003705886.1| hypothetical protein Trad_2232 [Truepera radiovictrix DSM 17093]
    MRIVSLLPSASEIVCALGLGEQLVAVSHECDFPPEVQRLPRITSSILPHDLDARAIDEAVCRAVQEGRALYKVDGDLLAR
    LKPDLIVTQGVCDV
    CAVSVGTVQETLQFLPDVLPAGTQTLSLSGTSVAGVWRDIGRVGAAAGVPERAAALVGELKARWER
    LARLPKPAPRPRVLMLEWPDPPFYGGHWVPEQVAAAGGEDALGRPGEVSARVTWERLLEADPDVIVMVACGYDLAANRAF
    AAALYEHPEARTLRAVRRGAVWAADANSFFSRPAPRLVAGAEALAQVLAARDVPGVAERVQVAYSARSR

    >gi|297624453|ref|YP_003705887.1| periplasmic binding protein [Truepera radiovictrix DSM 17093]
    MSPRVVSLACSNTEIVCALGCADLLVGVDSHSDRPAEALAGLPRVGPDLQIDIAAVCALQPDLVLASLTVPGHERVVAGL
    EAAGLRYLAPQPVSLEDVYASIREIAHALGVAERGEALIHKMRAELVDCSAEAAPSVLVQWWNRPTIAPGRRSWVHDLLV
    LAGARNPLGEEEVRSRPLSDEEVAALDPDAIVVSWCGVDPRKYRPEVVRRNPAWQGVRAVQRGAVFCVPEAYLGRPGPGL
    VAGYRALREIVEVVRADRQPVT

    >gi|297624756|ref|YP_003706190.1| peroxiredoxin, OsmC subfamily [Truepera radiovictrix DSM 17093]
    MALVRSANAVWQGDLKGGQGTLTLPKGGYEGRYSYTSRFEEGTGTNPEELIAAAHAGCFSMALANMLAEAGHTPESIATT
    AKVEMQGLKITKITLHTEGRVPGLDEARFLEHAENAKQH
    CPVSQALAAVEIQLEAKLA

    >gi|297624847|ref|YP_003706281.1| Redoxin domain-containing protein [Truepera radiovictrix DSM 17093]
    MSFTLQLGEAAKDFSLPATDGQTYSLASFEGAEALVVFFTCNHCPYVLGSDELTRKTAERFMPKGVAFVGINANSATTKP
    EDSFEHMVARMSEHRFPWVYLRDETQEVAYAYGALRTPHFFVFDRERKLVYTGRGVDNPKDAGRVTVSDLENALEDLLAG
    RPVRVPVTNPIGCNIKWEGRDAHWMPPEACDLVL

    >gi|297624894|ref|YP_003706328.1| carboxypeptidase Taq [Truepera radiovictrix DSM 17093]
    MTFQGDLNGEQEAAFAALREAFGVISDLSQAQSLLSWDESVNLPPKAAATRGQQLATLGQVIHERLTDPRLKELLRALEG
    VDPESEVGAFVREARRDVERAQKVPSDFVAEVSRARSAALAAWTEARAEADFARFAPHLEKTLELSRRYADFLGFEGHPY
    NALHDLYEPGSDVETLKRVFAELRDATVTLLREIAASGRVLSDAPVRRPFAEADQEAFGRFVVRALGYDFEGGRLDRTVH
    PFATRIGQGDVRITTRYEPTFLNPALFGTIHEAGHAMYEQGIAARYARSPLEHAVSLGVHESQSRLWENLVGRSLPFWRW
    AYPKLQEIFPEALAGVALEDFYAAVNRVEPSLIRVEADEVTYNLHVMVRFELELALLEGSLTVRELPEAWNARYEAYLGV
    VPPDDAVGCLQDTGDDRLLSDLHARQPHERAALRGRQGGAPGARGGDRSRALRHAPRVVARTGASTRLALRTRRTPAARD
    RLGAQRSALCGLPQPQVPRALRVGCVRAPFGGALLGVLLGAVLSVAAAQIGEPPEALVERLELREAGERYALGGLTLELT
    PRGGALYRVSGRGVLDEVGRRDLAQLVGAATGYGEGIAAPLAEFLAARTEELTGQGEVGLNVEEFALRLTVTPDPVRVGG
    APHVRFELELAAVPEDRFPAVRHTLGPADAAVVVRAFSDLQ
    CPFCARYGLEVLPELKATLLARGDVRFEFHHLPLLSIHA
    NAAPAAEAAECVTDANAGDPEAFWTFHDALLERQGAWRDLGDPAPYFVRLAREVGLSAEGVAACLTEGHYTETVREAYAL
    ATQTLGLSATPTVFVGPYRLPTAAAGTAAGYERAIARLETFGELPASP

    >gi|297625049|ref|YP_003706483.1| UBA/THIF-type NAD/FAD binding protein [Truepera radiovictrix DSM 17093]
    MKGVTGYAGGVTFSREQLDRYSRQLLLPGVGAAGQRKLLEAKVLVVGAGGLGSPALLYLAAAGVGTLGIVDDDAVALSNL
    QRQVLYTTRDLGEPKVSAAARRLRELNSDVRLEPHPVRLTEGNAGALVAPYDLVLDGSDNLETRYRLSDACVGLGKPLLY
    GALSQFEGQLSLLHAPTPAGPGPCYRCLYPEAPPGGAPS
    CAAAGVFGALPGTIGSLMAVEAIKYLVGLGASLAGTLLHYD
    ALDSSFRRVRLARDPHCASCGDGRR

    >gi|297625172|ref|YP_003706606.1| thioredoxin [Truepera radiovictrix DSM 17093]
    MDLAVCPSCGAKNRLRTPPKGQLPVCGKCGATLPWLLSATDSSFAAELEAPVPVLVDFWAPWCGPCRMVAPVVEELAREQ
    AGKLKVVKLNVDENPQTAGRYRVQSIPMLTLFRDGQALTTVVGALPKGALLQRLAPYLG

    >gi|297625176|ref|YP_003706610.1| rhodanese domain-containing protein [Truepera radiovictrix DSM 17093]
    MAEDTTPEISVHEAQRRIQEGALLLDVREQNEFDELRIPGAQLLPLSELTARVDDLPKDRPIVAQCRSGKRSAKATDFLR
    EQGFDAVNMEGGILAWRDEGLPVEEG