Tropheryma whipplei Twist uid57705

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|28493177|ref|NP_787338.1| putative thioredoxin reductase [Tropheryma whipplei str. Twist]
    MCVGVIDVAIIGGGPAGLTAGISLARMGWKVCVFDSNRPRNAATIAVHGVIAREGISPHALRSDGGKALISFGGKILPSE
    VVSVVWTGDQSSVGLSPISLSIDGSVAEPESCCAASAISDMKSNSSSEGAGTEGAGTRKENQWYEVDALLHPARNREKFL
    AKTVLISSGVREVFPQIKNLRAVYGTNIHS
    CLSCDMWEKRFDSVGLIGYGPDAVDILQRAIYLSFRVSSIVVFYNQFNQA
    QKGILENLGVKIVETQLTEVLLEEGAFTGFMDAAGKSHTVSSAFLRPIWKPNVDFIKNPSLNSQGFIITGNDGRLNRGNM
    WAAGDVTGIGQVSIAAGQGASVALDIGRYLFTLHGNKTHGNDALGHISSRSLI

    >gi|28493209|ref|NP_787370.1| hypothetical protein TWT242 [Tropheryma whipplei str. Twist]
    MAVSDLTNGSLTDTPPSHGVHLTDVAVNKVKQFLEQEQRDDLRLRIAVQPGGCSGLRYQLYFDERLLEGDCVKDFDGVAL
    VVDDMSVPYLDGATIDFHDTISKQGFTIDNPNAKGMCACGDSFN

    >gi|28493223|ref|NP_787384.1| thiol-specific antioxidant protein [Tropheryma whipplei str. Twist]
    MGGIVSNQVLPKGSFAPDFELVDQNGATVVLSEVAAKKDVVLFFFPLAFSGICTDELIQVRDSLDSFKSFEVFALSVDSK
    FTLRAYSESQGFSFALLSDFWPHGGVAKQFGAFLEDVGVASRSTFIVGKDLKIKASFFSGIHEPRDFSEIRAALAS

    >gi|28493357|ref|NP_787518.1| thiosulfate sulfurtransferase [Tropheryma whipplei str. Twist]
    MTRCLSWTGGFVKEFLSDAEKISSYADPNRLVTTDWLAKNLDRVTVIESDEDVLLYESGHIPGSIKVDWHTDLNDTVLRD
    YLSPEKFRDMCVSKGISDNDIIVFYGDKSNWWAAYAAWVFCLYGNDNWKLLDGGRDKWISEGRPMTKEVANRPRGTYALP
    VRNDDEIRAYRDDVAKHIGKQMIDVRSTREYTGELTHMPEYPQEGALRGGHVPSAVSIPWSSAVGSDGTFLPREKLEEIY
    FGQTGHSADKDTIVY
    CRIGERSSHTWFVMKYLLGVKHIRNYDGSWTEWGNLVRAPIVTGPNP

    >gi|28493365|ref|NP_787526.1| hypothetical protein TWT398 [Tropheryma whipplei str. Twist]
    MLVCVSSSSVRVWLDPFCPWAWLVANWLEEVSLHRKIDVDQRTMSLALLPGNSARRNEPFMEASLEATLVLTAVAQELGS
    GASKRLYMSLGKKIHKEEFNLGNTATLIADSLSDTGLPEDFSRRSSEYYNQLQESTSTALSLVGDQCGTPVVSVGDVAFF
    GPVISRVPRGEDAVRFFDSIVSVCSWSGFYELKRTRSEGPQID

    >gi|28493432|ref|NP_787593.1| methylated-DNA--protein-cysteine methyltransferase [Tropheryma whipplei str. Twist]
    MSSVEFAVRMRACAFRVKVYSSQTHIIRVKIFRYASVIDDAHKNTRYKTRSLSEGSCDCHASNKNSSLTTDLTAEARREI
    LAYFSGTLKTFSVPISLEKASAKQADVLNMLLKIPYGGCVSYGEIASKVNSSPRAVGAYCAKNPLPFFVP
    CHRVIRSNGE
    VGGYCGSSNNLIKHSLIEIEQKNS

    >gi|28493469|ref|NP_787630.1| dihydrolipoamide dehydrogenase [Tropheryma whipplei str. Twist]
    MDYDLIVLGAGSAGYATAIRATQLGMKVALAEGDKVGGTCLHRGCIPTKSLVQCAKAAHIAKNASKFGVINSFSGVDINA
    VNVFKNGIVESKYRGLQSLLRSYGIHVYPNFATLSSQNSVRIGTEDITGKNIVIATGSRPKGIPGLSGG
    CIFDSDSILEI
    DHLPSSLAIIGGGVIGVEFASIFNYLGVDVSILEAQETLIPSEERGVSKQLERVFRRRGIKLYLGHKIMDVSQTDGVVVS
    LDSNEKVNADLLLVAIGRAPATDAIGKVGIEIDGGAISVDEKLRTSVPNVFAAGDVVGGLQLAHRGYQQGIYLAEQIAGL
    DPSAVADINIPRVIYTSPEVASVGYTEAGAAEIYGVNEIVTYEYNLAGNAKSSIMGAAGSIKVVQHKNKDVLGVHMVGDG
    VSELVSEAQLIVNWEANPSDVASLIHPHPTQAEAIGEAMLALAGKPLHGI

    >gi|28493596|ref|NP_787757.1| mycothione/glutathione reductase [Tropheryma whipplei str. Twist]
    MEEYDLIVVGAGSGNSILDQRFDSLKIALLDDGAHFGGTCLNYGCIPTKMLLRPATLAYQAKHASKLGVHFSDPRIDWQK
    IRSRTFSTTDDISAAGLEYRLGCSNIDVYRESYFFIDQRTLQSSSGHRISGEKIVIAAGSRPRLFGIEPDNRLIYTSAEI
    MRIEQLPESLVILGGGVVAVEMATFFSGYGVDTTTVNRSEFLLSSFDTEVAKSLTAQVPWKHIGQERVQNVSKKDSSVEI
    ELSSGTRLLAQALLLAQGRVSNADKLRCRDVGFDIHSDGRLKTDKYQRVLADNRPLDNVFALGDVSDPNQLKHIANHQAR
    IVGHNLLNGDMLASDLVPPAAAVFSEPQVAWVGTFPNNSIVVRGNYSDTAYGWAFGLRPDDAFVKLFIDKSGVLNGAFVI
    GPEASIIIQPLIQAVSLNLKVQGLARSQYWPHPAGTEVVENALLKAEEFLRA

    >gi|28493723|ref|NP_787884.1| thiol:disulfide interchange protein [Tropheryma whipplei str. Twist]
    MRRINSRRNEYRPRHPASLCLSGNPRNCVLFSVSLLLVLSSVILSGCFYSDTQTQTDSGEYLAGVVKVVAPENRVTRVKF
    SEKAIDPDGQESTYNSVSYAGKVQVVNFWYAA
    CPPCREEAPILEEVWSEFKTQNVQFIGVNIRDNADVIKAFARKFKITF
    PSIIDVQNASVRLAFAGQIPPNGVPVTYVLDKKGFIAVRILGRITSKSILTTLIRDVSAETDKKTYGT

    >gi|28493770|ref|NP_787931.1| cation-transporting ATPase [Tropheryma whipplei str. Twist]
    MAEPSIIRLYISGMTCASCAREIEKKLKNRGISASVDFATGSALLTAPRGFNLQKAIDVVRGAGYTATPRRVYSQAVRLR
    NLLVSIALAVPVIVISMPMSIFVLLSIFPSILFWRFLVFVLATPVVIFSAWPFYRSCLRRLSRFGVTMDTLISLGVCVTY
    VWSVWVLFSSIGHPNDYDEQSLYFEASVSIVVFASVGRYLEAKVKAKQGLALESLVKLAPKTATLAGTLEKVLTENLRAG
    DRVVIYPGERVPADARIVEGGSDVDLSFLTGCSIPSRVSIGDTLASGAMNLTGNLTAEVVRVGSDTELSRLISLVQRAQK
    PKLVRVADRVSGVFVPVVLILSLVTLFAHWAVTDSLAGSLSAAVAVLVIACPCALGLATPMAILSGMLRGLQLGILIRST
    SALESRLSVVVLDKTGTLTENRVSLSKLIPAPGQDVNDLLRLSASLEAGSEHPLARAVVMAAKDKGLVLESFSDFENHPG
    FGVTGKVAGRDILVGRLGWAGKTPNKMPDWMSGRDISHGTVIVWGGKVRGVFVFDSPLRATSPRGVALLSGMGLKVILAT
    GDGGFAATNAAESCGIKTVVAGAKPADKLELVRSLQARKDRVAMVGDGINDAAALAAADVGIAMASGTDLAFDRSDIAVM
    SSDLIGVVDGIRLSRKTRRVVKQNLFWAFAYNTAGIPVASVGLLSPMIASLAMALSSLFVVGNSLRIRKFQPTTPL

    >gi|28493761|ref|NP_787922.1| phosphoribosylformylglycinamidine synthase II [Tropheryma whipplei str. Twist]
    MLSFTPRIGSRDYSCEAGYSVNMSLPADRDTAKKPSAQKPSAHAQNATAAVDVTALGLTESEYTQICSLLKRSPTKSELA
    IYSVLWSEH
    CSYKSSRRHLRQLADLTEVTKKHLLVGIGQNAGVVDIGGGWAAAFKIESHNHPSFIEPFQGAATGIGGIVR
    DIIAMGAKPVALMDSLRFGAASDPDTQRVADGVVSGISFYGNCLGVPNIGGETAFDPVYQGNPLVNVLCVGVMRRENIRL
    ANASGPGNLVVLFGAPTGRDGIGGASVLASDSFTSDAKANRPAVQIGDPFVEKLLTECCLELYAADLVVAIQDLGAAGIS
    CAASELAHNGRVGIRLDLSAVPLRDTTLAPDEILVSESQERMMAIVHPDNLEAFFEITNRWGISGAVIGEVDNSQYLTVV
    HEGKTLVRLNPKTLTGPSYNRPVKKPAYLIRRSAANRLPVTNDPHLLREDILQVISCPNLSDKSVITNQYDRYVQGNTAL
    CHPDDAGVIRMYKNTGVALSCDGNSRYSYLDPHAGAQLAVAEAYRNVSVVGATPLAVTNCLNFGNPENPEVMWQFRETCR
    GLSDACKRLEIPITGGNVSFYNQTDGKDIFPTPVVGILGIVDNLTQTLTSGWNAPDLFIYLLGVTRPEFGGSVWADTMYG
    HIGGVPPKLDLARESRLSNLLVAGAKKRVFESAHDLSEGGLIQAIVESCLRHGFGADIALDTIRATSLTEALFSESASRV
    LVSCRSQEDLRDLCRRNSYEYTLIGTTRHTGELTISEIGKFTLNELSDARQKVTRVLFRG