Tropheryma whipplei TW08 27 uid57961

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|28572419|ref|NP_789199.1| dihydrolipoamide dehydrogenase [Tropheryma whipplei TW08/27]
    MDYDLIVLGAGSAGYATAIRATQLGMKVALAEGDKVGGTCLHRGCIPTKSLVQCAKAAHIAKNASKFGVINSFSGVDINA
    VNVFKNGIVESKYRGLQSLLRSYGIHVYPNFATLSSQNSVRIGTEDITGKNIVIATGSRPKGIPGLSGG
    CIFDSDSILEI
    DHLPSSLAIIGGGVIGVEFASIFNYLGVDVSILEAQETLIPSEERGVSKQLERVFRRRGIKLYLGHKIMDVSQTDGVVVS
    LDSNEKVNADLLLVAIGRAPATDAIGKVGIEIDGGAISVDEKLRTTVPNVFAAGDVVGGLQLAHRGYQQGIYLAEQIAGL
    DPSAVADINIPRVIYTSPEVASVGYTEAGAAEIYGVNEIVTYEYNLAGNAKSSIMGAAGSIKVVQHKNKDVLGVHMVGDG
    VSELVSEAQLIVNWEANPSDVASLIHPHPTQAEAIGEAMLALAGKPLHGI

    >gi|28572456|ref|NP_789236.1| DNA-binding/repair enzyme [Tropheryma whipplei TW08/27]
    MSSVEFAVRMRACAFRVKVYSSQTHIIRVKIFRYASVIDDAHKNTRYKTRSLSEGSCDCHASNKNSSLTTDLTAEARREI
    LAYFSGTLKTFSVPISLEKASAKQADVLNMLLKIPYGGCVSYGEIASKVNSSPRAVGAYCAKNPLPFFVP
    CHRVIRSNGE
    VGGYCGSSNNLIKHSLIEIEQKNS

    >gi|28572525|ref|NP_789305.1| hypothetical protein TW372 [Tropheryma whipplei TW08/27]
    MLVCVSSSPVRVWLDPFCPWAWLVANWLEEVSLHRKIDVDQRTMSLALLPGNSARRNEPFMEASLEATLVLTAVAQELGS
    GASKRLYMSLGKKIHKEEFNLGNTATLITDSLSDTGLPEDFSRRSSEYYNQLQESTSAALSLVGDQCGTPVVSVGDVAFF
    GPVISRVPRGEDAVRFFDSIVSVCSWSGFYELKRTRSEGPQID

    >gi|28572533|ref|NP_789313.1| thiosulfate sulfurtransferase [Tropheryma whipplei TW08/27]
    MTRCLSWTGGFVKEFLSDAEKISSYADPNRLVTTDWLAKNLDRVTVIESDEDVLLYESGHIPGSIKVDWHTDLNDTVLRD
    YLSPEKFRDMCVSKGISDNDIIVFYGDKSNWWAAYAAWVFCLYGNDNWKLLDGGRDKWISEGRPMTKEVANRPRGTYALP
    VRNDDEIRAYRDDVAKHIGKQMIDVRSTREYTGELTHMPEYPQEGALRGGHVPSAVSIPWSSAVGSDGTFLPREKLEEIY
    FGQTGHSADKDTIVY
    CRIGERSSHTWFVMKYLLGVKHIRNYDGSWTEWGNLVRAPIVTGPNP

    >gi|28572663|ref|NP_789443.1| hypothetical protein TW514 [Tropheryma whipplei TW08/27]
    MSNQVLPKGSFAPDFELVDQNGATVVLSEVAAKKDVVLFFFPLAFSGICTDELIQVRDSLDSFKSFEVFALSVDSKFTLR
    AYSESQGFSFALLSDFWPHGGVAKQFGAFLEDVGVASRSTFIVGRDLKIKASFFSGIHEPRDFSEIRAALAS

    >gi|28572677|ref|NP_789457.1| hypothetical protein TW528 [Tropheryma whipplei TW08/27]
    MTDTPPSHGVHLTDVAVNKVKQFLEQEQRDDLRLRIAVQPGGCSGLRYQLYFDERLLEGDCVKDFDGVALVVDDMSVPYL
    DGATIDFHDTISKQGFTIDNPNAKGMCACGDSFN

    >gi|28572710|ref|NP_789490.1| oxidoreductase [Tropheryma whipplei TW08/27]
    MCVGVIDVAIIGGGPAGLTAGISLARMGWKVCVFDSNRPRNAATIAVHGVIAREGISPHALRSDGGKALISFGGKILPSE
    VVSVVWTGDQSSPGLSPISLSIDGSVAEPESCCAASAISDMKSNSSSEGAGTEGAGTRKENQWYEVDALLHPARNREKFL
    AKTVLISSGVREVFPQIKNLRAVYGTNIHS
    CLSCDMWEKRFDSVGLIGYGPDAVDILQRAIYLSFRVSSIVVFYNQFNQA
    QKGILENLGVKIVETQLTEVLLEEGTFTGFMDAAGKSHTVSSAFLRPIWKPNVDFIKDPSLNSQGFIITGNDGRLNGGNM
    WAAGDVTGIGQVSIAAGQGASVALDIGRYLFTLHGNKTHGNDALGHISSRSLI

    >gi|28572791|ref|NP_789571.1| mycothione/glutathione reductase [Tropheryma whipplei TW08/27]
    MEEYDLIVVGAGSGNSILDQRFDSLKIALLDDGAHFGGTCLNYGCIPTKMLLRPATLAYQAKHASKLGVHFSDPRIDWQK
    IRSRTFSTTDDISAAGLEYRLGCSNIDVYRESYFFIDQRTLQSSSGHRISGEKIVIAAGSRPRLFGIEPDNRLIYTSAEI
    MRIEQLPESLVILGGGVVAVEMATFFSGYGVDTTTVNRSEFLLSSFDTEVAKSLTAQVPWKHIGQERVQNVSKKDSSVEI
    ELSSGTRLLAQALLLAQGRVSNADKLRCRDVGFDIHSDGRLKTDKYQRVLADNRPLDNVFALGDVSDPNQLKHIANHQAR
    IVGHNLLNGDMLASDLVPPAAAVFSEPQVAWVGTFPNNSIVVRGNYSDTAYGWAFGLRPDDAFVKLFIDKSGVLNGAFVI
    GPEASIIIQPLIQAVSLNLKVQGLARSQYWPHPAGTEVVENALLKAEEFLRA

    >gi|28572909|ref|NP_789689.1| lipoprotein [Tropheryma whipplei TW08/27]
    MCLSGNPRNCVLFSVSLLLVLSSVILSGCFYSDTQTQTDSGEYLAGVVKVVAPENRVTRVKFSEKAIDPDGQESTYNSVS
    YAGKVQVVNFWYAA
    CPPCREEAPILEEVWSEFKTQNVQFIGVNIRDNADVIKAFARKFKITFPSIIDVQNASVRLAFAGQ
    IPPNGVPVTYVLDKKGFIAVRILGRITSKSILTTLIRDVSAETDKKTYGT

    >gi|28572954|ref|NP_789734.1| metal cation-transporting ATPase [Tropheryma whipplei TW08/27]
    MAEPSIIRLYISGMTCASCAREIEKKLKNRGISASVDFATGSALLTAPRGFNLQKAIEVVRGAGYTATPRRVYSQAVRLR
    NLLVSIALAVPVIVISMLMSTSVLLSIFPSILFWRFLVFVLATPVVIFSAWPFYRSCLRRLSRFGVTMDTLISLGVCVTY
    VWSVWVLFSSIGHPNDYDEQSLYFEASVSIVVFASVGRYLEAKVKAKQGLALESLVKLAPKTATLAGTLEKVLTENLRAG
    DRVVIYPGERVPADARIVEGGSDVDLSFLTGCSIPSRVSIGDTLASGAMNLTGNLTAEVVRVGSDTELSRLISLVQRAQK
    PKLVRVADRVSGVFVPVVLILSLVTLFAHWVVTDSLAGSLSAAVAVLVIACPCALGLATPMAILSGMLRGLQLGILIRST
    SALESRLSVVVLDKTGTLTENRVSLSKLIPAPGQDVNDLLRLSASLEAGSEHPLARAVVMAAKDKGLVLESFSDFENHPG
    FGVTGKVAGRDILVGRLGWAGKTPNKMPDWMSGRDISHGTVIVWGGKVRGVFVFDSPLRPTSPRGVALLSGMGLKVILAT
    GDGGFAATNAAESCGIKTVVADAKPADKLELVRSLQARKDRVAMVGDGINDAAALAAADVGIAMASGTDLAFDRSDIAVM
    SSDLIGVVDGIRLSRKTRRVVKQNLFWAFAYNTAGIPVASVGLLSPMIASLAMALSSLFVVGNSLRIRKFQPTTPL

    >gi|28572944|ref|NP_789724.1| phosphoribosylformylglycinamidine synthase II [Tropheryma whipplei TW08/27]
    MNMSLPADRDTAKKPSAQKPSAHAQNATAAVDVTALGLTESEYTQICSLLKRSPTKSELAIYSVLWSEHCSYKSSRRHLR
    QLADLTEVTKKHLLVGIGQNAGVVDIGGGWAAAFKIESHNHPSFIEPFQGAATGIGGIVRDIIAMGAKPVALMDSLRFGA
    ASDPDTQRVADGVVSGISFYGNCLGVPNIGGETAFDPVYQGNPLVNVLCVGVMRRENIRLANASGPGNLVVLFGAPTGRD
    GIGGASVLASDSFTSDAKANRPAVQIGDPFVEKLLTECCLELYAADLVVAIQDLGAAGISCAASELAHNGRVGIRLDLSA
    VPLRDTTLAPDEILVSESQERMMAIVHPDNLEAFFEITNRWGISGAVIGEVDNSQYLTVVHEGKTLVRLNPKTLTGPSYN
    RPVKKPAYLIRRSAANRLPVTNDPHLLREDILQVISCPNLSDKSVITNQYDRYVQGNTALCHPDDAGVIRMYKNTGVALS
    CDGNSRYSYLDPHAGAQLAVAEAYRNVSVVGATPLAVTNCLNFGNPENPEVMWQFRETCRGLSDACKRLEIPITGGNVSF
    YNQTDGKDIFPTPVVGILGIVDNLTQTLTSGWNAPDLFIYLLGVTRPEFGGSVWADTMYGHIGGVPPKLDLARESRLSNL
    LVAGAKKRVFESAHDLSEGGLIQAIVESCLRHGFGADIALDTIRATSLTEALFSESASRVLVSCRSQEDLRDLCRRNSYE
    YTLIGTTRHTGELTISEIGKFTLNELSDARQKVTRVLFRG