Trichodesmium erythraeum IMS101 uid57925

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|113474068|ref|YP_720129.1| redoxin [Trichodesmium erythraeum IMS101]
    MVIDKVPDVVFKTRVRDESVDGPNPFRWQDKTTQEIFGGKRVVLFALPGAFTPTCSSTHLPRYEELYNEFKGQGIDEIIC
    LSVNDAFVMFQWGKQQGSKNVFLLPDGNGEFSRKMGMLVEKSNLGFGMRSWRYAMVVNDCTIEKMFVEEGFADNYGDDPF
    EVSDADTVLAFLKGQEAPKDKPARLDFVG

    >gi|113474134|ref|YP_720195.1| redoxin [Trichodesmium erythraeum IMS101]
    MLTSYDFRGLLNQRFFQNLLPIPAINDLDNGKRTPDFELPDITNGKLVRLSNYWGVTPVIVALTRIFTEKQYCPFCFPHI
    LALNKNYERFLERGVEVLMITSTDEKQSKIVVNDLSLKMPLLSDSSCQVFKNYKVGQALGAPLSGQFVLDKQGRLCYKHL
    FSFLDHNASIEDLLGILDNYIFE

    >gi|113474135|ref|YP_720196.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Trichodesmium erythraeum IMS101]
    MTDECLRVGQKAPDFTATAVVDQEFETIKLSDYRGKYVVLFFYPLDFTFVCPTEITAFSDRYKEFELLNTEILGVSVDSE
    FSHLAWIQTDRKSGGIGDLNYPLLSDIKKEISTAYNVLDLEAGIALRGLFIIDREGIIQHATVNNFAFGRNVDEAIRTLQ
    AIQYVQIHPNEVCPVGWKPGDKTMNSDPIKSKEFFAAVS

    >gi|113474237|ref|YP_720298.1| glutaredoxin [Trichodesmium erythraeum IMS101]
    MVTDIFQNKPLPNWEELLQVAQQNTTAKWILRTDKSPSTATISSYIARLNPEEKPSVLLYRDNNAWCPFCERVWFALEEK
    QIPFEVELINLADKPQWYKDMVPTGLVPAVKIEGELVYESKNILLALENKFDRLPLLPKEPQERSVALNMIEAFDSNGLV
    KSGYEFLFNSVKSKEITPEEKEAQLLNLQTIFETRLDQLEETLSQYPGAYFLHEFSLVDIIYTPGITRLAANLPVFRGYS
    IYNNDRFARINQWLTAINQRPAYQHIKPNSQTNNLIIQKIFHLPAIYNSKSEPQAKFESQEQDYRMEAAGRLSSNYKTVV
    ADILKNSGIQTWVSQESLPKIELVIDFYLRRLVYSLIEGGVPSFFTHSIDAKTEQHNEVKEINSADAALGAIALAFLRNR
    VCVPRDMSANAAVAFQTAIDTMLSCLY

    >gi|113474274|ref|YP_720335.1| peptide methionine sulfoxide reductase [Trichodesmium erythraeum IMS101]
    MLDTIVLGGGCFWCVESVFLSVVGVKEVESGYAGGNTKNPDYRSICSGKTGHAEVVKVSFDTEKISLSQILEIFFATHDP
    TTPNRQGNDVGTQYRSVVMCHSQEQKDIAQEVISTLGNNGTFENPIVTEVVDLKDYYRAEEYHQNYFNKNPYQPYCVFSI
    PPKLQKLKKYFPDQVSA

    >gi|113474340|ref|YP_720401.1| iron-sulfur cluster assembly accessory protein [Trichodesmium erythraeum IMS101]
    MINLSATAVQEIIRLQSKQNQPNILFRLRVKPGGCCSLCYTMQFDTQQDSNDRVYDYGQVKVVVDSLQLNYLNGLILDYS
    EDLMGGGFRFNNPNAKVACGCGNSFSV

    >gi|113474416|ref|YP_720477.1| 3-mercaptopyruvate sulfurtransferase [Trichodesmium erythraeum IMS101]
    MNITSTNLLIDPEWLANHLSDPNLIIIDCRFSLADPELGNKQYQESHIPGAFYLDLNQDLSSPVQKHGGRHPLPDPNQLA
    QKLATIGVKYQETLIVAYDDSRFAFASRLWWLLTYMGHEKVGLLDGGFSGWQKEYSVTNKIPTQNHGFFQPQIQQKMVVD
    IETVKAKKDLSGVVLVDSRDSDRYLGKHEPIDPIAGHIPGAINYPWKQVTGDNSKAKVSEQVSRWKEVKNAEDIVVY
    CGS
    GVTACVNLWSLKIAGINTGKLYAGSWSDWCSYLLDN

    >gi|113474526|ref|YP_720587.1| glutaredoxin-like protein [Trichodesmium erythraeum IMS101]
    MTLTPELKAKIDDLVTKNKIMVFMKGNKLMPQCGFSNNVVQILNILGVTYETCDVLENQDIRTGIKEYSNWPTIPQVYVD
    GEFLGGSDVMIEMYNNKKEELEQKLAVASAS

    >gi|113474558|ref|YP_720619.1| rhodanese-like protein [Trichodesmium erythraeum IMS101]
    MSQQSSKQPILEITVQELASRLINGIPENLQLVDVRERQEIEVAFIKGFKVLPLSEFHEWSEKIHLHLDSSQETLVLCHH
    GIRSAQMCQWLKNQDFTNVKNIIGGIDAYSSVVDQSIPRY

    >gi|113474681|ref|YP_720742.1| hypothetical protein Tery_0863 [Trichodesmium erythraeum IMS101]
    MTNRLAKSQSLYLRKHAENPVDWWPWSEEALETAKQQDKPIFLSIGYSSCHWCTVMEGEAFSDEKIAQYLNEKFLPIKVD
    REERPDVDSIYMQALQMLTGQGGWPLNIFLTPDDLIPFVGGTYFPIEPRYGRPGFLEVLQKIRSFYDLEKNKLDTLKVEM
    LEGLRKSVLLPEAEDLKEEILQQGLEVITKIIGDRYSQQSFPMIPYAQAALQGKKLNFKSQNNSNKVCLERGLNLALGGI
    YDHVAGGFHRYTVDPNWTVPHFEKMLYDNGQIVEYLANLWSAGYHKPAFKRGIIGTVNWLKREMTAPTGFFYAAQDADSF
    TTPDEVEPEEGAFYIWSYKELENLLTKEELSELSKQFFIEPNGNFEGKIVLQRKQAEELSKTVENSLSKLFKLRYGVQPF
    NIETFPPATNNKEAKNNNWPGKIPAVTDTKMIVAWNSLMISGLARTATVFNSLEYLELAMNAAHFIITNQQIDGRFHRLN
    YEGKPAVTAQSEDYALFIKALLDLQQASISLETLSKLNTNTNFWLETAIKLQDEFDEFLWSQETAGYYNTSYEVTGELIL
    RERNYIDNATPAANGIAIANLVRLSLLTEELYYLDRAESALTAFSSIMKKSPQACPSLFVALDWYRNQTLVRTTDAEINN
    LITQYFPTVIYKKETDLPENSVGLVCQGLICQKPSLSRQELLEHLEQSQNRWI

    >gi|113474750|ref|YP_720811.1| thioredoxin domain-containing protein [Trichodesmium erythraeum IMS101]
    MSSNVVVITDSEFEGEVLQSEKLVLAYFWASWCGPCKLVSPSVEKVATTYSDRLKVVKMEVDPNPETVKSYKVEGVPALR
    LFGNKKLLLSHEGSITLNKLVERLEAHLA

    >gi|113474884|ref|YP_720945.1| hypothetical protein Tery_1108 [Trichodesmium erythraeum IMS101]
    MLNPNLEQIQLNTEEYQRYSRHLILPEVGLDGQKRLKAASVLCIGTGGLGSPLLLYLAAAGIGNIGIVDFDIVDSSNLQR
    QVIHGTSWVGKPKIESAKNRIHEINPYCQVDLYETRLSAENALDILKSYDVIVDGTDNFPTRYLVNDACVLLNKPNVYGS
    IFRFEGQATVFNYEGGPNYRDLYPEPPPPGMVPS
    CAEGGVLGILPGIIGVIQATETIKVVLGKGKTLSGRLLLYNSLDMT
    FRELKLRPNPIRPIIEELIDYEQFCGIPQAKAQEAETKMAIPEMTVQDLKQLFDSGKKDDFVLVDVRNPNEYDIAKIPGS
    VLVPLPDIEQGPGVTKVKELMNNRSLIAH
    CKMGGRSAKALGILKEHGIEGTNLKGGITAWSKEIDSSVPQY

    >gi|113475045|ref|YP_721106.1| copper-translocating P-type ATPase [Trichodesmium erythraeum IMS101]
    MEIRYLELKGMSCAGCANKIQKAIENVTGVAECQVNFAIGQATVKFNSQKTNLHKIQESVTNIGFEAQLLQETINLLDKD
    RENHQIERKMINKVIFGGTISVILIIGSLPMMTGLNLSWIPSWLGNPLIQLILTTLVMIWCGKSFFFAAIKGLKNRYVDM
    NTLVAIGTGAAYLYSLFPTFSPIFFTRQGLNPDVYYEAAATIITLILLGKLLEHRARKQTSAAIQKLMGLQAKTARVIRD
    GKEIDIMIEKVKIGDLIVVRPGEKIPVDGKIKEGFSTVDESMVTGESVPVEKKPGDEVIGVTINQTGSFKFEAARVGKDT
    VLAQIIKLVQQAQASKAPIQKLADMVISWFVPVVMGVAIATFLIWINLTGNLTMSLITTVSVLIIACPCALGLATPTSVM
    VGTGKGAENGILIKGANSLEVTHKIETIILDKTGTLTKGRPTVTDYITTQGTTNENEIKLLKIAAAVERKSEHPLATAIV
    EYAKGQGIKFPLPEPERFEAISGMGVQGIVFDRLVQIGTDRWMNELGIEITNFLNYQDKLEADRKTTAWIAIDGEIEGIF
    AIADTLKPSSKNVVQTLQKMGIEVVMLTGDNRRTAEAIGAEVGISKIFAEVRPDQKAETVKNLQLEKKKRRNDHQIVAMV
    GDGINDAPALAQADVGIAIGTGTDVAIASSDITLISGDLTGIITAIKLSRATIKNIRQNLFFAFIYNTLGIPIAAGILYP
    LTGWLLNPIIAGGAMAFSSVSVVTNALRLRNFKPKAKV

    >gi|113475202|ref|YP_721263.1| thioredoxin domain-containing protein [Trichodesmium erythraeum IMS101]
    MNANQSNSTNISSLVTRLRNFMIVSVAIALSVSIFMALRTDKLSVSLNEMAQAATPLDVALSNNKPTLVEFYANWCTTCQ
    AMAPELEEIRQKYTQNTNFVMLNVDNSRWLPELVEYRVDGIPHFVFLDREGTEVGQTIGEVPKSIMAANIEALVAGSYLP
    YNSTVGQGSHFNAPVEPTKASQADPRVHGSQVK

    >gi|113475254|ref|YP_721315.1| heavy metal translocating P-type ATPase [Trichodesmium erythraeum IMS101]
    MQVTPKRETTIHNSLPETITLDVSGMKCAGCVKAVERQLNQQIGVISARVNLATEVATVECEKDQIDPNILAQKLTDNGF
    PTQPRLDNSKNYAAQKQTERHRQEIKQQIWRIAIASLLLILSSIGHLGHFIGSEIPILGNIWFHAVLASLALLVPGREII
    IDGARSLSRNAPNMNTLVGLGAVTAYTTSIVALLVPELGWECFFDEPVMILGFILLGKTLEQQARYRAASTLHSLIALQP
    ATARLVSAPKCNNNSSEPLEIPASQVKVGEYLQVLPGEKFPVDGKICDGKTTVDESMLTGESIPVVKEFGSNVAAGTINK
    SSTIVMQTTHTGSETTLAQIIKLVETAQTRKAPIQNLADTVAGYFTYGVMTIAAITFLFWYFVGTNIWSEVLQTSSHQGI
    MTYSTSPLLLSLKLAIAVLVIACPCALGLATPTAILVGSSVGAQRGLLIKGGDVLEKVHELDTIVFDKTGTLTTGHPTVT
    NIVGNNPELLLRVAATVESGTSHPLAEAILQKAQEENVELLSATDFYTEPGLGASAIVDGKLALVGNLEWLKNYQIVVEP
    ENVPTLTDKTAVYVSFDRALLGLIEVSDTLRDDALVTVKSLQDVGLKVMLLTGDRACVAKVIAQQLGLTAENMLAEVPPE
    GKAEAIAALQSKGEKVGMVGDGINDAPALAQANVGIGMQTGTDVAMETADIVLMQNKLMDVVESIKLSRATFNKIRQNLF
    WAFAYNIVGIPVAMGVLLPSLGIILNPSAAGALMAFSSVSVVTNSLLLRNRNC

    >gi|113475376|ref|YP_721437.1| thioredoxin-disulfide reductase [Trichodesmium erythraeum IMS101]
    METYEFDVVIIGGGPAGCSCALYTSRADLKTVILDKNPAVGALAITHKIANYPGVAGNISGNALLDEMREQAISFGTKYQ
    RAQVFGIDVEGSLKKVYTPEGTFLGRSLVLATGAMGRKSSLRGESEFLGRGVSY
    CATCDGAFFRQKEVAVYGVNQEAVEE
    AQFLTKFVSTVHWLTNKEPQHEDAHVQVLLSQPNVKHWNFTRLTSIQGNESGVTNILMKTRGEPEVASLQVDGVFVYQSG
    SRPITDYISPDIILIDNGGVKVDEMMATNVEGVWAIGDIRNTPFQQAVVAASDGCIAAMAIDRFLNKRKGIKRDWDHS

    >gi|113475654|ref|YP_721715.1| methyltransferase type 11 [Trichodesmium erythraeum IMS101]
    MNLENFEDNLSITNTTTNEKLTDNYNIESAVLERYKEGAKNVQSSLCCPTEYEENYIDILPLEIIEKDYGCGDTTRYISS
    GETVVDLGSGAGKNCYIIAQKVGAEGQVIGVDFNDDMLALARKYQDQIAAKTGYKNTKFVKAKIQDLALDLDLIQNWLTA
    NPIKSLDALAAFEYKCNSLRKEQPLIPDNSVDVVISNCVLNLVRPQDKYKLFHEIHRVLKRGGRAVISDIVCDEDPTIKI
    MNNPELWSG
    CIAGAFREDVFLEMFEEAGFYGIEIIKREEKAWQVIDGIEFRSLTVRAFKGKEGESLERNQAVIYKGPWKQ
    VIDDDSHTLYRGKRMAV
    CDKIFQIYTDKNGPYHHHILPVKPYANIPIEVAEIFDCKDGTIRHPRETKGLDYQTTNINNNS
    NCCTPSDSDCC

    >gi|113475671|ref|YP_721732.1| thioredoxin domain-containing protein [Trichodesmium erythraeum IMS101]
    MMILSVNEKTFKKEVLESSQPVLVYFWAPWCGLCKMIVPQLVKFQSEWNCHLKLVGVNADKSLKLASTYQLQTLPTLILF
    VNGQIVNRLGYFQAREDFQRTLDAFISTLVKDPPSQPREHRNEKQSILW

    >gi|113476214|ref|YP_722275.1| DSBA oxidoreductase [Trichodesmium erythraeum IMS101]
    MRVLFLLSIVMTTCISLSGCTFSDKLTNNPIKPELEQQVLQIIRDHPEVIIESVQAYQQEQQQEKEASQQKTLQQFKNNP
    QEQIGESPTFGSTAQKIVLFEFSDFQ
    CPFCAKAQENLKEFMDKHQDRVTLVFKHLPLTNIHPQANPAAKAAWAAQQQGKF
    WEYHDALFEQQDRLGEELYLEVANNLGLNIDKFNSDRQSEAASISIETDIQLAKKIGVSGTPFFVMNGETFSGAVKLSQI
    EETFAKVSQ

    >gi|113476304|ref|YP_722365.1| redoxin [Trichodesmium erythraeum IMS101]
    MRSRRHFQTIFLVICLALITWLNFIPNAWALGGKLPELDQPAPEFTLPTNIGDREISLSDYRGQWVVLYFYPKDFTSGCT
    IEARRFQQDLPKYRERNTQILGVSADDINSHQEFCDSEGLKFPLLADTDGTVSKAYGSWLNFFSMRHTFIINPGGILQEI
    FLGVKPTIHSQEVLSSLDNLQQT

    >gi|113476449|ref|YP_722510.1| thioredoxin domain-containing protein [Trichodesmium erythraeum IMS101]
    MGVSIEVDNTNFATEVLKNSHKKPVLVDFYATWCGPCKMLKPILEKLATEYDFILAKVDVDQSPDLAQTYNIEGVPDVRV
    VTQGEVKPGFVGVLSEPKLRNFLGEFNLHSELEKNLQQLQELIKSRKLEQAKNLLDQLFHKYPNNVTIIIEAAKFLVSSN
    KLKEAKKLIETIGEHKREFYPQLQAVKALIHFKEEAENPGDSTLDKTYAKACSLTLSDNYEQALELFLELITKNHKNKKD
    DRPRKAMLAIFHILGDNHPISKEYRNKLLNLY

    >gi|113476711|ref|YP_722772.1| dihydrolipoamide dehydrogenase [Trichodesmium erythraeum IMS101]
    MTQEFDYDLIIIGAGVGGHGAALHATSCGLKTAIVEVAEMGGTCVNRGCIPSKALLAASGKVRELRNAHHLKTLGIELDN
    VSYDRQVMATHASNIVTKIRGDMSKSLKRLSVDIITGWAQVAGKQKVTVKTEKGEENFTAKDIILAPGSVPFVPPGIELD
    GKTVFTSDDALKLDWLPPWVAIIGSGYIGLEFSDIYTALGSEITMIEALDKLMPTFDPDIAKIAQRVLIQSRDIEVKVGK
    LAIKVVPGSPVIIELADAKTKEVEEIIEVDACLVATGRIPYTKDLGLDSVAVETDKYGFIPVNSKMAVLSSGEPVPNLWA
    IGDATGKMMLAHAASAQGITVVENICGRDREPDYLSIPAAAFTHPEISYVGMTEPAAKDLGQKQGFEVASVRTYFKGNSK
    AIAEDETDGIAKVIYRQDTGELLGVHIIGLHASDLIQEAANAIAKKQSVNELSFNVHTHPTLSEVLDEAFKRATVH

    >gi|113476719|ref|YP_722780.1| redoxin [Trichodesmium erythraeum IMS101]
    MKIQVGDQAPEFTLPSQEGTEVSLSDFRGKKNVVLYFYPKDDTPGCKIQACTFRDQYTIFKNVDAEIIGISGDSKQSHKQ
    FSTKYSLPFTLLCDTDNKVRQLYDVPPTLWILPGRATYVIDKEGIIRYICDSTFDFEVHSKEALKALRKLRVTV

    >gi|113476827|ref|YP_722888.1| thioredoxin [Trichodesmium erythraeum IMS101]
    MEKSTEKETKQDVPQVTDSSFDKDVLHSDIPVLVDFWAPWCGPCKMVAPVVSEIAQQFKDKVKVVKLNTDENPNTASKYG
    IRSIPTLMIFKGGQRVDMVVGAVPKTTLASTLEKHLSNEEKQTSK

    >gi|113476828|ref|YP_722889.1| thioredoxin [Trichodesmium erythraeum IMS101]
    MSNTNPVTDASFKEEVLESNIPVLVDFWAPWCGPCRMVAPVVEDISKQYEGQVKVVKLNTDENPNVASQYGIRSIPTLMI
    FKGGERVDMVVGAVPKTTLANTLDKYIEK

    >gi|113476862|ref|YP_722923.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Trichodesmium erythraeum IMS101]
    MAVKYDIVIIGGGSAGLVVASAAAQLKAKVALVERDKLGGDCLWFGCVPSKSLIHASRVAYQVKNAARFGIYTQPPEIEF
    AKVTSHVQQVIANIQPHDSPERFRGLGVEVIFGEGEFIDQKTFEVNGQKLTARAFVISTGSRPAIPSFEGLNSADFLTNE
    KVFDLKQRPNNLAIIGAGPIGCELGQAFSRLGSNVTIISSKSHILPKEEPEAALVVQKQFESEGINILKEVRAEKVEVVD
    GKKQVTAGGKNIIVDEILFAGGRLPNVESLNLEVAGVEVGKQGIIVNEKLQTTNSKIYACGDVIGGYQFTHVAGYEAVVA
    LTNALFFPISKVNYRVIPWATFTDPELARVGLTEQQAKERYGDDVCVLKQPFSGVDRAQAEAATNGFCKIITKGNGEILG
    AHLVGISAGELIHEIVLAMSNNLPVSALTGIHVYPTLSEVNSKAGLLLKKQKYAKNLSQQNLLEQFFNWRRSF

    >gi|113476942|ref|YP_723003.1| thioredoxin [Trichodesmium erythraeum IMS101]
    MAIKKKFNNFDELLAGSDLPVLVDFYATWCGPCKMMTPILEQVNQQIKDKLRIVKIDTDKYPQLASRYHIESLPTLVLFK
    NGQPVDRIEGVIQSPQLVERLNKMTSI

    >gi|113477233|ref|YP_723294.1| nitrogenase-associated protein [Trichodesmium erythraeum IMS101]
    MAKVIFYEKPGCKNNTKQKTLLKAAGHQLEAHNLLTEPWTKDNLRLFFGDRPVAEWFNKAAPKVKSGEVVPEKIDGETAL
    TMMLNDPLLIRRPLIQVGERREVGFDIEIVNNWVGLEAVDETQKVKSEELMSQDLQACPNNHHH

    >gi|113477282|ref|YP_723343.1| dimethylaniline monooxygenase (N-oxide forming) [Trichodesmium erythraeum IMS101]
    MIETKRAIVVGAGSSGLIAAKELLDTGLDLTILEKEASLGGVWHKYCWKTSTLTSSKWMTEYGCYPAPKEYADFMKPEEM
    MEYLSSFTKHYGLEDKVHFGVQVKAIARSTDGKYDVITDGETYSGYDYVVISTGLHGEPVIRDVPGIEKFTGTIMHGFKY
    KDPEAFRDKKVVCMGLGESGIGISSEISSVAAKTVVAAGNFNFAPRVYPYSNKPFDQIQFWPMGQYIKDYQELLSAQMSW
    ITRLPEPLRTAYANMHPWLRDLPKEWLPTAYVPHYWAGKYWPKPNNNFGDMSGNLTRPSTAPDDIIYLVHSGKITAKGKV
    ERFDETGVYFPDGTREEVDMVVANTGFKPGAALIEFPDNWQYRHQELYKGCLHPDMPNLAFVGFVRPTIGSIPAMAEMQS
    RFVAQVFSGGYKLPEKEKLKKLIKKEADAHARKNPKMTERWPHIYFFDQWMEEMAELLGTQPKIWQHLSSWKQLQGFLFG
    APMPIRFRQYGSGVVAGAKERYADRINQLYGTRPQSYIIPYLTISLFFPYILSLIISAVCYWGANLSPLISIGSGLLFYT
    LYMTVDLFRFVVGFLPITLPSLMALEQSLPWRNCDNDSMMFLMSFPEKDRMNYANPRVFENDGLPKSELLDREIAVKN

    >gi|113477296|ref|YP_723357.1| redoxin [Trichodesmium erythraeum IMS101]
    MVLTESTMLKLGTIAPNFELPDVVSGNIISPSTFKGKKALLVMFICRHCPFVKHIQLELAKIGKDYVPKDVGIVAISSNN
    IESHPDDAPDKLKEMASELEFNFPYCFDETQEVAKSYIAACTPDFFLFDVDYKLVYRGQLDDSRPSNEKPVTGSDLRAAL
    DTVLAGKNIEEEQKPSVGCNIKWKAGNEPSYFG

    >gi|113477384|ref|YP_723445.1| periplasmic binding protein [Trichodesmium erythraeum IMS101]
    MSINQPLKIVSLIPSATETIAALGLTKAIVGRSHECNYPPEIQNLPVCTKPKFNPDGNSREIHERATELLQSALSVYLVE
    LETLEKLQPTHIITQAQCDV
    CAVSLADVETAVKSLTKTNPQVISLEPNLLAEVWADMERVANILGVNGNEVISQLKKRVA
    ACAEKTQNLATNNIPKVACIEWSNPLMAAGNWIPELVQIAGGNSLFGELGKHSPWLKFEELLTANPDVIIFMPCGFDLER
    TRQDTLDLIKSSEWQDLPVVKSGKVYITDGNSYFNRPGPRLVDSLEILAEILHPELFNFGYQGIGWVKL

    >gi|113477391|ref|YP_723452.1| iron-sulfur cluster assembly accessory protein [Trichodesmium erythraeum IMS101]
    MTKTTQSQQKGIMMSETAVKQVLSLRDKQGKDLCLRVGVRQGGCSGMSYMMDFADPSTIREDDEVFDYDGFKVVCDRKSI
    LYLYGLMLDYSDALIGGGFQFTNPNATQTCGCGNSFSA

    >gi|113477397|ref|YP_723458.1| redoxin [Trichodesmium erythraeum IMS101]
    MALSVGTKAPEFTVKDTNGKTVSLSDFAGKTVVMYFYPKDDTPGCTKEAQSFRDNYAEYQGKDMVVLGVSMDDEASHKAF
    TEKYGLPFQLLADVDGAITKAYDVEGGGYPKRVTYIIDAEGNISHVDQNVKTGSHAQDILEVIGKK

    >gi|113477493|ref|YP_723554.1| methionine-R-sulfoxide reductase [Trichodesmium erythraeum IMS101]
    MVNKIKKSEKEWKEQLTPEQFNVTRKKGTERPFTGEYYNNKEKGIYKCVCCGIDLFSSEAKYDSGTGWPSYWKPINQENI
    KEETDWSLFMRRTEVLCNNCDAHLGHVFPDGPPPTGLRY
    CLNSAALKFSKGE

    >gi|113477499|ref|YP_723560.1| glutaredoxin 3 [Trichodesmium erythraeum IMS101]
    MLDFLNPILGRHPERMKAKVEIYTWQTCPYCIRAKLLLWWKGVNYTEYKIDGNESARNSMSERANRSRTVPQIFINNQHI
    GGCDDIYALDNKGQLEPLLIEVLPD

    >gi|113477563|ref|YP_723624.1| UBA/THIF-type NAD/FAD binding fold [Trichodesmium erythraeum IMS101]
    MISNLTPKELERYSRQMMLPGFGEEAQQRLKSTTAVVTGVGGLGGTVALYLAVAGIGKLILVRGGELRLDDMNRQILMTD
    DWVGKVRVDKAKETLSAINPDIEIEAVPEYVTAENVDPLVQSADIAIDCAHNFDERNLLNAACVRWRKPMVEAAMNSMEA
    YLTTIDPGKTPCLS
    CLFPEKPQWDRRGFGVLGIVSGTLACLAASEAIKQITGFSKPLWSQLLTMNLDSMEFAKLRPYHDP
    NCQVCGSLSRELVADSIAIKNNFTTEMITTNSL

    >gi|113477564|ref|YP_723625.1| iron-sulfur cluster assembly accessory protein [Trichodesmium erythraeum IMS101]
    MTLSLTEKAASQLTKFLQDSNQGIRISVVDGGCSGYQYSLNIANAPKTDDLLLEKDQLRIFIDPKSAPLLEGVVVDYIES
    LTEGGLKFINPNATETCSCGKSFQAGSCTPTAVPCS

    >gi|113477621|ref|YP_723682.1| glutaredoxin 3 [Trichodesmium erythraeum IMS101]
    MSVNIEIYTWSSCPFCISAKALLDKKQVNYQEYPIDGDDIEREKMACRANGRNSLPQIFIDEEHIGGCDDLYGLEAQGKL
    DRLLKK

    >gi|113477924|ref|YP_723985.1| rhodanese-like protein [Trichodesmium erythraeum IMS101]
    MLNKKVTYKTTKTTMSNSILINPAELADLIKTVPCVIIDTRRSEAYEESHIPDAVNLHNIFTYLATSTPEGIAELKGKFE
    TEFGAAGLSGKETAIIYEQSMNTGFGQSCRGYFLLQYLGYPQIKVLHGGYEAWTLAGMPTSSQAVTPEPKIFPSSEAGAS
    LMMDTADMLAAVKDKSVVKLDVRDIDEWIGESSSPYGKDFCPRKGRIPEAKWIEWYRMMKPTPTGLMLKNKEEVLAECAT
    VGITPETPVALY
    CFKGARASNTYLALKEAGVKDVKIYFGSWNEWSRDPALPIEEGLPY

    >gi|113478115|ref|YP_724176.1| glutathione reductase [Trichodesmium erythraeum IMS101]
    MAYDYDLFVIGAGSGGLASSKRAASYGAKVAIAENDLVGGTCVIRGCVPKKLMVYGSRFSHFYKDAVGYGWSEVEPSFDW
    HKLIDAVNTEVLRLNKLHISFLEKAGVEIIEEYAKFIDPHTIEVGDRKVTADKILIAVGGKPEKIDIPGIEYSITSREIF
    HLKEQPKRMAVWGGGYIGVEFAGILNGVGTEVTQIIRRDSILRGFDTDISSNIQEGMVKHGINFRENTNVEKIEKVPEGL
    KVHLSGENAEPLIVDTFLCATGRKPNLAGLNLENAGVETLRGAVAVSNNCRTTQANIYAIGDCIDKVNLTPIAIAQGRAF
    ADTEFGNIPRSISLENIPTAVFSEPEGGTVGLTEAAAREKFGDSIKCYRSKFRPMFHSFTGADEKVMVKLVVETNTDRIL
    GVHMVGKDAGEIIQGMAIAVNMGATKADFDRTIGIHPSTAEELVTLN

    >gi|113478148|ref|YP_724209.1| selenophosphate synthase [Trichodesmium erythraeum IMS101]
    MKFPIPPKTDLVLIGGGHSHAIALRKFAMNPIPGVRLTLITDVYHTPYSGMLPGYVAGLYNFDQCHIDLLPLAKFAGARI
    FLSHAIGLDLEKNQILCTSRPPVNFDLLSIDIGSTPASLTVPGAIEYAIAVKPISKFLTYWDKITTMISKSPTQKTRIAI
    VGGGAGGVELAFAVQSHLHQIYRNAKQPTDNLELHLFHRGKRLLPQRHHWVGKEVEKILKSRGVLLHLKESVEEVRGDDQ
    ELPTNVEGNKTFHSLYSTLKMICCASGLEIECDILFWVTQASASPWLQKAGLATDTRGFVLVNEKLQSISHPQVFAAGDV
    ATIINHSRPKAGVFAVRQGQPLFENLQRALKKKLLKSFIPQKKFLILIGTGDERAIASRGRIGFGPHKLLWRWKNRIDRK
    FMAQFSNLKMEDRTQKAEDRKQDSQMYCAG
    CGAKVTSRVLENVLHKIPQEIRRDDILIGMDTPDDAAVIRVPADRVMVQT
    IDYFRGLLDDPYLLGKITANHCLSDLFAMGAMAQSGLAIATIPYAAPSKQEDTLYQLLLGATEVLNQSGAVLIGGHTTEG
    EELAFGLTCNGLVSQKKLLYKGGMQPGDMLILTKALGTGTLFAADMRLKARGRWIESAIKSMLGSNQNAAQLLLEYGVTA
    CTDVTGFGLVGHLLEMLKGQRVGVELDMEAIPVLPGVAETLEQGIFSSLYPGNLQMSASIQNREQASMYPLYPLLFDPQT
    SGGLLATVPANLASACLNALQQEYFETRIIGRVLLLDTGMLPIRIHF

    >gi|113478360|ref|YP_724421.1| 1-Cys peroxiredoxin [Trichodesmium erythraeum IMS101]
    MTLRLGDKVPDFTQDSSEGQISFYDWAGDSWVVLFSHPADFTPVCTTELGAVARLKPEFDKRGVKVIALSVDDAESHKGW
    VGDINETQKTTVNYPILADVDKKVSDLYDMIHPNSLNNLTIRSVFIIDSEKKLRLTFTYPASTGRNFNEILRVIDSLQLT
    DNHQVATPVDWKDGDDCVIVPSLKDPEVLKEKFPKGYTEVKPYLRMTPQPNK

    >gi|113474017|ref|YP_720078.1| vitamin K epoxide reductase [Trichodesmium erythraeum IMS101]
    MVSKRSKPWIHRNSRFIIAGITAVGATITAYLTIEKLTGGTVVCPVTGCDKVLESPYAIVLGLPLALFGFLAYAGMGTTA
    IAPWLINPDSQKELRSKLENWSWLLIFVGSVSMTIFSSYLMYIMAFEIKSLCLYCISSAICSLSLLILALIGRNWEDIGQ
    LIFTAIIVGMITIVGTFAVYAPIHSPAAEKPGASGVTTTSTPTKVALAEHLTKVGAKMYGAYW
    CSHCQDQKQLFGKEAVS
    KLNYIECDPKGQNSQTQLCVAAGIRAYPSWDIDGQLEEGVISLENLAKLSGYQGSINFNNP