Treponema pallidum SS14 uid58977

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|189025306|ref|YP_001933078.1| hypothetical protein TPASS_0072 [Treponema pallidum subsp. pallidum SS14]
    MEKTLTLFGSNHCGQCATALEYLRSNHINFEYVDITGSGKNLKRFLKMRDSMPLFDDVKKEGRIGIPCLSVNDGEQVFLG
    VEGLDLSAFR

    >gi|189025334|ref|YP_001933106.1| possible thioredoxin [Treponema pallidum subsp. pallidum SS14]
    MSCSRTTGALRAVPLVFRSVLVLAVWGVSCVQAADVAHNADVPSRSLKALERFRFFVYPKPLDLSSDFHAKALKGEALVP
    SLFKGKVTLLNFWATW
    CPPCRAEMPSMDRMQALMRGNDFQIVAVNVGDSRKQVESFIARGKHTFPIYLDEEGSLGSVFAS
    RGLPTTYVVDKAGRIVAVVVGSVEYDQPELVALFKELARD

    >gi|189025375|ref|YP_001933147.1| methylated-DNA-protein-cysteine S-methyltransferase [Treponema pallidum subsp. pallidum SS14]
    MSVHQGGIRFPLLYLEMETPLGRMCIAERAHTIVYVWFHRVGPRGSPVSGVCAQHVCPGKTALLRETQSQIHAYFCGALR
    EFSVPVTVEGTPFMQRVWGATRNIAYGTTKSYAQLSQDIGCPRAARAVGQALHRNPLLLLIP
    CHRVISARASIGGFAYGS
    ALKHFLLQQEAAVCACE

    >gi|189025739|ref|YP_001933511.1| alkyl hydroperoxide reductase [Treponema pallidum subsp. pallidum SS14]
    MESLIGKRVIDFKLPAYVGGKFTEVSNASIKGSWAVFMFYPADFTFVCPTELADLARVYPSFVEIGCKVYSVSTDSEYVH
    KAWADATDTIKNLPYEMISDKAGKLAGFFGVLLPDTWHALRGTFVVDPEGLVKAFEVHDMGIGRDADELLRKVQSAQFVA
    KHGDQVCPARWKPGAKTLKPGIDLIGKI

    >gi|189025859|ref|YP_001933631.1| protein-methionine-S-oxide reductase [Treponema pallidum subsp. pallidum SS14]
    MLANLQHLSDIQYRVTQQSATETPFKNEFWNSYQPGFYLDVVSGELLFLSEDKFDSGCGWPSFSAPAYARAVIEKEDRTH
    NMLRTEVRSRNANSHLGHVFKDGPPERGGLRY
    CINSAALRFVAREEGTALFAAGCFWSTEAYFRRVKGVLRVRVGYTGGT
    TKSPTYRNVCTGTTGHAEAVEILFDPQVISYEDLLKHFFRMHDPTSLNKQGGDVGTQYRSAIFYLSGTQKQQAETLMGRY
    AGAGKFTRPLVTTLEEARDFYPAEEYHQDYLTKNPGGYCHVSLHLASEPLE

    >gi|189026038|ref|YP_001933810.1| thioredoxin reductase [Treponema pallidum subsp. pallidum SS14]
    METDYDVIIVGAGAAGLSAAQYACRANLRTLVIESKAHGGQALLIDSLENYPGYATPISGFEYAENMKKQAVAFGAQIAY
    EEVTTIGKRDSVFHITTGTGAYTAMSVILATGAEHRKMGIPGESEFLGRGVSY
    CATCDGPFFRNKHVVVIGGGDAACDES
    LVLSRLTDRVTMIHRRDTLRAQKAIAERTLKNPHIAVQWNTTLEAVRGETKVSSVLLKDVKTGETRELACDAVFFFIGMV
    PITGLLPDAEKDSTGYIVTDDEMRTSVEGIFAAGDVRAKSFRQVITATSDGALAAHAAASYIDTLQN

    >gi|189026142|ref|YP_001933914.1| thioredoxin [Treponema pallidum subsp. pallidum SS14]
    MALLDISSGNVRKTIETNPLVIVDFWAPWCGSCKMLGPVLEEVESEVGSGVVIGKLNVDDDQDLAVEFNVASIPTLIVFK
    DGKEVDRSIGFVDKSKILTLIQKNA

    >gi|189026144|ref|YP_001933916.1| NADH oxidase [Treponema pallidum subsp. pallidum SS14]
    MKIVIIGANHAGTACVNCLTDLTTTNEVVVFDRNNNISFLGCGMALWIGGQIRGSEGLFYANKEQLEKKGARVSMESDIT
    RIDFASKKVYGTARDGSAIAESYDKLIIATGSLPIIPKIDGMDLENVQRIKLFQDAEAVIKKLEQPSIKNIAVIGAGYIG
    VELAEAFERHQKKVTLIDAMDSSLSNYYDASFRALMDENLRSHHITLAFGQKVQKLRGSNGKVVAVVTDKGEYPADMVMV
    CIGFSPNTALGKNEVRTFANGAYAVDLKQETSVKDVYAIGDCATVFDNSLGQTSYIALATNAMRSGIVAAHNAAGFPLEG
    IGVQGSNGINIYDLKMVSTGVTQERAARMGLEVEVTDFEDSQLPAFMEVDNHPVKIRIVFDKKTRVIVGAQMASRHDMSM
    GIHLFSLAIQERVTIDKLKLLDMFFLPHFNKPYNYVTMAALRARS

    >gi|189026162|ref|YP_001933934.1| pyruvate oxidoreductase [Treponema pallidum subsp. pallidum SS14]
    MSEKNLVMMDGNTAVGHVAHALSEVIAIFPITPSSPMGEIADEYSARGRTNIWGTVPTVVELQSEAGASGAVHGALTTGA
    LSSTFTASQGLLLMIPNMYKIAGELTSAVFHVAARAVATSSLSIFGDHQDVMACRQTGWALLASNSVQEAMDTAVIAHAA
    TLEARVPFVHFFDGFRTSHEIQKIEEVSYDVMRAMIDDELVHAHRMRGLTPEKPVVRGTAQNPDVYFQVRESVNRYYAVA
    PSIVQKAMDRYAALTGRQYRLFDYYGAPDAEKVIVMIGSGSEAVEETVDVLNAQGGKCGLVKVRLYRPFSAECFVNALPK
    TVQAIAVLDRTKEPGSLGEPLYEDVRTAIGQMQSQKKCPFTHYPLVLGGRYGLGSKEFTPAMAKGVFDNLSGKKIPNFSV
    GIEDDVTFSSVDFDPNFQLDDQDVCQAVFYGLGSDGTVGANKNSIKIIGEATDNNAQAYFAYDSKKSGGFTISHLRFGKQ
    KIRKPYLITQADFVACHKFTYLETFDMLKTLKRGGTFLLNAPYSEHEVWHHIPIEVQRQIIEKEVKFYVIDAISIAQKAG
    MGTRINVVMQTAFFKIFGILPEAEAIDLIKKFIQKAYGKKGGEVVQRNITTIDMALAGVGLVEYPGVAGSLVTRRPAMSS
    DAPEFVQSVLGTIALNQGDSLGVSALPEDGTYPTGTTQYEKRCIAETIPIWDPSV
    CIQCGQCAMVCPHAVIRMKAYDGKE
    LEHAPSKFASCDYKGKEFGEAKFTIQVSPEDCTGCGLCVQQCPAKNKADPTRKAINMESFSKHRAVESENWAFFVKLPDP
    EAKKLNLSLPKGASMKRPLFEFSGACPGCGETPYIRLMTQIVGDRAIIANATGCSSIYGGNLPTTPYTTRPDGRGPAWSN
    SLFEDAAEFGFGMRVTSDKLAEYAREVGRKLQEKGVAADLFASIFSNQQADDVAVEEQRAYVNQLKKVLSESTEPLAKEM
    LSLVDHLIKRSVWIFGGDGWAYDIGYGGLDHVLASGRNITVLVMDTEVYSNTGGQMSKATPIGAVAKFAAAGKEISKKDI
    GLMAMSYGYVYVARVAMGANMSQVVKAFREAESYDGPSLIVAYSHCISHGIDMSKGMINQKEAVACGLWPLYRYDPRRIA
    EGKNPFQLDSKEPDFKLADFMYKEVRFKTLKNANPERAEMLLKRAEEKARRQWQEYKYLADRPF

    >gi|189026259|ref|YP_001934031.1| cation-transporting ATPase, P-type [Treponema pallidum subsp. pallidum SS14]
    MQVSFVVHGISCTACVRRIEEAVRHVTGAYDVYVNPTTSHLYVHTDLHPTEHTLFAQTIIDAVSHAGFKATLLDTHSTTA
    PLAATQPVHPDFVTLKRRVRTSLCLLVPLMYLSMGHMVHLPIPGFLHPLKYALSFALVQAFLTLPVLYANRSLFRAGLIA
    LYGAILRRNTATMDSLISLGSLSSFTYGLFATARIAMGVHANDTALVSHYVADLYFESAAMIVTLVTVGKYLSALSKGRT
    SRALTQLLDIKPKTARVIRQVSVPRGASPSSPTTASAASAHETHEIEIEIPAQDVLVGDTVLVKAGELVPVDGIITSGQA
    TLDESNVTGESIPVEKGRGDSVISASLVSTGFLKFRAERVGEHTTLAQIISLVEKTAASKVPVTKLVDAVSAYFVPSIVA
    LSLLSGCAWLCAGASAEFAFSIAVTVLVISCPCVLGLAVPTALMVATGKGAQMGILIKSAQVFQQMARTKVIAFDKTGTL
    TLGRPTLSHIHTLHPTYNEEDILHLAYSLEVCSGHPLAAAISVAAQRKGMTPLAITDFNSEQGLGLRARLVHTSYAKTVM
    VGNARMMVAHSIDGMDTYLSPSHNLEETPLFVAADKNLVGVLFVSDPVKVHSSAAIGALHKRGIQTLMLTGDVKHVAHTI
    AARCGVKKSKAELLPHDKEREISALKASGMMVAMVGDGVNDAPALASADVGIAIGAGSDIAVESADVVLMRNCIRDVVTL
    VDLSIATVRNMKQNLFWAFFYNTLGVPLAAGLGYPFFGLRLTPMLAAAAMSLSSVSVLCNALRLNQFQSSSP