Treponema pallidum Nichols uid57585

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15639066|ref|NP_218512.1| hypothetical protein TP0072 [Treponema pallidum subsp. pallidum str. Nichols]
    MEKTLTLFGSNHCGQCATALEYLRSNHINFEYVDITGSGKNLKRFLKMRDSMPLFDDVKKEGRIGIPCLSVNDGEQVFLG
    VEGLDLSAFR

    >gi|15639094|ref|NP_218540.1| thioredoxin, putative [Treponema pallidum subsp. pallidum str. Nichols]
    MSCSRTTGALRAVPLVFRSVLVLAVWGVSCVQAADVAHNADVPSRSLKALERFRFFVYPKPLDLSSDFHAKALKGEALVP
    SLFKGKVTLLNFWATW
    CPPCRAEMPSMDRMQALMRGNDFQIVAVNVGDSRKQVESFIARGKHTFPIYLDEEGSLGSVFAS
    RGLPTTYVVDKAGRIVAVVVGSVEYDQPELVALFKELARD

    >gi|15639135|ref|NP_218581.1| methylated-DNA-protein-cysteine S-methyltransferase (dat) [Treponema pallidum subsp. pallidum str. Nichols]
    MSVHQGGIRFPLLYLEMETPLGRMCIAERAHTIVYVWFHRVGPRGSPVSGVCAQHVCPGKTALLRETQSQIHAYFCGALR
    EFSVPVTVEGTPFMQRVWGATRNIAYGTTKSYAQLSQDIGCPRAARAVGQALHRNPLLLLIP
    CHRVISARASIGGFAYGS
    ALKHFLLQQEAAVCACE

    >gi|15639500|ref|NP_218950.1| alkyl hydroperoxide reductase (ahpC) [Treponema pallidum subsp. pallidum str. Nichols]
    MESLIGKRVIDFKLPAYVGGKFTEVSNASIKGSWAVFMFYPADFTFVCPTELADLARVYPSFVEIGCKVYSVSTDSEYVH
    KAWADATDTIKNLPYEMISDKAGKLAGFFGVLLPDTWHALRGTFVVDPEGLVKAFEVHDMGIGRDADELLRKVQSAQFVA
    KHGDQVCPARWKPGAKTLKPGIDLIGKI

    >gi|15639621|ref|NP_219071.1| bifunctional methionine sulfoxide reductase B/A protein [Treponema pallidum subsp. pallidum str. Nichols]
    MLANLQHLSDIQYRVTQQSATETPFKNEFWNSYQPGFYLDVVSGELLFLSEDKFDSGCGWPSFSAPAYARAVIEKEDRTH
    NMLRTEVRSRNANSHLGHVFKDGPPERGGLRY
    CINSAALRFVAREEGTALFAAGCFWSTEAYFRRVKGVLRVRVGYTGGT
    TKSPTYRNVCTGTTGHAEAVEILFDPQVISYEDLLKHFFRMHDPTSLNKQGGDVGTQYRSAIFYLSGTQKQQAETLMGRY
    AGAGKFTRPLVTTLEEARDFYPAEEYHQDYLTKNPGGYCHVSLHLASEPLE

    >gi|15639800|ref|NP_219250.1| thioredoxin reductase (trxB) [Treponema pallidum subsp. pallidum str. Nichols]
    METDYDVIIVGAGAAGLSAAQYACRANLRTLVIESKAHGGQALLIDSLENYPGYATPISGFEYAENMKKQAVAFGAQIAY
    EEVTTIGKRDSVFHITTGTGAYTAMSVILATGAEHRKMGIPGESEFLGRGVSY
    CATCDGPFFRNKHVVVIGGGDAACDES
    LVLSRLTDRVTMIHRRDTLRAQKAIAERTLKNPHIAVQWNTTLEAVRGETKVSSVLLKDVKTGETRELACDAVFFFIGMV
    PITGLLPDAEKDSTGYIVTDDEMRTSVEGIFAAGDVRAKSFRQVITATSDGALAAHAAASYIDTLQN

    >gi|15639904|ref|NP_219354.1| thioredoxin (trx) [Treponema pallidum subsp. pallidum str. Nichols]
    MALLDISSGNVRKTIETNPLVIVDFWAPWCGSCKMLGPVLEEVESEVGSGVVIGKLNVDDDQDLAVEFNVASIPTLIVFK
    DGKEVDRSIGFVDKSKILTLIQKNA

    >gi|15639906|ref|NP_219356.1| NADH oxidase [Treponema pallidum subsp. pallidum str. Nichols]
    MKIVIIGANHAGTACVNCLTDLTTTNEVVVFDRNNNISFLGCGMALWIGGQIRGSEGLFYANKEQLEKKGARVSMESDIT
    RIDFASKKVYGTARDGSAIAESYDKLIIATGSLPIIPKIDGMDLENVQRIKLFQDAEAVIKKLEQPSIKNIAVIGAGYIG
    VELAEAFERHQKKVTLIDAMDSSLSNYYDASFRALMDENLRSHHITLAFGQKVQKLRGSNGKVVAVVTDKGEYPADMVMV
    CIGFSPNTALGKNEVRTFANGAYAVDLKQETSVKDVYAIGDCATVFDNSLGQTSYIALATNAMRSGIVAAHNAAGFPLEG
    IGVQGSNGINIYDLKMVSTGVTQERAARMGLEVEVTDFEDSQLPAFMEVDNHPVKIRIVFDKKTRVIVGAQMASRHDMSM
    GIHLFSLAIQERVTIDKLKLLDMFFLPHFNKPYNYVTMAALRARS

    >gi|15639924|ref|NP_219375.1| pyruvate oxidoreductase [Treponema pallidum subsp. pallidum str. Nichols]
    MSEKNLVMMDGNTAVGHVAHALSEVIAIFPITPSSPMGEIADEYSARGRTNIWGTVPTVVELQSEAGASGAVHGALTTGA
    LSSTFTASQGLLLMIPNMYKIAGELTSAVFHVAARAVATSSLSIFGDHQDVMACRQTGWALLASNSVQEAMDTAVIAHAA
    TLEARVPFVHFFDGFRTSHEIQKIEEVSYDVMRAMIDDELVHAHRMRGLTPEKPVVRGTAQNPDVYFQVRESVNRYYAVA
    PSIVQKAMDRYAALTGRQYRLFDYYGAPDAEKVIVMIGSGSEAVEETVDVLNAQGGKCGLVKVRLYRPFSAECFVNALPK
    TVQAIAVLDRTKEPGSLGEPLYEDVRTAIGQMQSQKKCPFTHYPLVLGGRYGLGSKEFTPAMAKGVFDNLSGKKIPNFSV
    GIEDDVTFSSVDFDPNFQLDDQDVCQAVFYGLGSDGTVGANKNSIKIIGEATDNNAQAYFAYDSKKSGGFTISHLRFGKQ
    KIRKPYLITQADFVACHKFTYLETFDMLKTLKRGGTFLLNAPYSEHEVWHHIPIEVQRQIIEKEVKFYVIDAISIAQKAG
    MGTRINVVMQTAFFKIFGILPEAEAIDLIKKFIQKAYGKKGGEVVQRNITTIDMALAGVGLVEYPGVAGSLVTRRPAMSS
    DAPEFVQSVLGTIALNQGDSLGVSALPEDGTYPTGTTQYEKRCIAETIPIWDPSV
    CIQCGQCAMVCPHAVIRMKAYDGKE
    LEHAPSKFASCDYKGKEFGEAKFTIQVSPEDCTGCGLCVQQCPAKNKADPTRKAINMESFSKHRAVESENWAFFVKLPDP
    EAKKLNLSLPKGASMKRPLFEFSGACPGCGETPYIRLMTQIVGDRAIIANATGCSSIYGGNLPTTPYTTRPDGRGPAWSN
    SLFEDAAEFGFGMRVTSDKLAEYAREVGRKLQEKGVAADLFASIFSNQQADDVAVEEQRAYVNQLKKVLSESTEPLAKEM
    LSLVDHLIKRSVWIFGGDGWAYDIGYGGLDHVLASGRNITVLVMDTEVYSNTGGQMSKATPIGAVAKFAAAGKEISKKDI
    GLMAMSYGYVYVARVAMGANMSQVVKAFREAESYDGPSLIVAYSHCISHGIDMSKGMINQKEAVACGLWPLYRYDPRRIA
    EGKNPFQLDSKEPDFKLADFMYKEVRFKTLKNANPERAEMLLKRAEEKARRQWQEYKYLADRPF

    >gi|15640020|ref|NP_219473.1| cation-transporting ATPase, P-type [Treponema pallidum subsp. pallidum str. Nichols]
    MQVSFVVHGISCTACVRRIEEAVRHVTGAYDVYVNPTTSHLYVHTDLHPTEHTLFAQTIIDAVSHAGFKATLLDTHSTTA
    PLAATQPVHPDFVTLKRRVRTSLCLLVPLMYLSMGHMVHLPIPGFLHPLKYALSFALVQAFLTLPVLYANRSLFRAGLIA
    LYGAILRRNTATMDSLISLGSLSSFTYGLFATARIAMGVHANDTALVSHYVADLYFESAAMIVTLVTVGKYLSALSKGRT
    SRALTQLLDIKPKTARVIRQVSVPRGASPSSPTTASAASAHETHEIEIEIPAQDVLVGDTVLVKAGELVPVDGIITSGQA
    TLDESNVTGESIPVEKGRGDSVISASLVSTGFLKFRAERVGEHTTLAQIISLVEKTAASKVPVTKLVDAVSAYFVPSIVA
    LSLLSGCAWLCAGASAEFAFSIAVTVLVISCPCVLGLAVPTALMVATGKGAQMGILIKSAQVFQQMARTKVIAFDKTGTL
    TLGRPTLSHIHTLHPTYNEEDILHLAYSLEVCSGHPLAAAISVAAQRKGMTPLAITDFNSEQGLGLRARLVHTSYAKTVM
    VGNARMMVAHSIDGMDTYLSPSHNLEETPLFVAADKNLVGVLFVSDPVKVHSSAAIGALHKRGIQTLMLTGDVKHVAHTI
    AARCGVKKSKAELLPHDKEREISALKASGMMVAMVGDGVNDAPALASADVGIAIGAGSDIAVESADVVLMRNCIRDVVTL
    VDLSIATVRNMKQNLFWAFFYNTLGVPLAAGLGYPFFGLRLTPMLAAAAMSLSSVSVLCNALRLNQFQSSSP