Bacillus subtilis 168 uid57675

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|16077250|ref|NP_388063.1| O6-methylguanine-DNA methyltransferase [Bacillus subtilis subsp. subtilis str. 168]
    METNKPTLYWSLLMFKDWNFYIASTLKGLVFVGSQNKPIEELFEWARKRFPGSLLVEDDDKLEPYAVEITQYLEGKRKNF
    TVPVEYAGTQFQLAVWNALCEIPYGQTKSYSDIANDINKPAAVRAVGAAIGANPVLITVP
    CHRVIGKNGSLTGYRGGFEM
    KTLLLDLEKRASSEMDVPH

    >gi|255767054|ref|NP_388080.2| sibling killing effect ; sporulation killing factor biosynthesis and export [Bacillus subtilis subsp. subtilis str. 168]
    MKDEQMLTEWPSHLPWLNQSQNDFTFPSDTYLLLYFWSMSCPNCHQLTDKVLQDIKDMNVKVIGVHVPYIEEEKSMEVVL
    TYALDRGLAIPIVLDQNYEIVTTCHVQGIPSFCLLSQYGQIITKTMGDVGWDKMLKKIAGL

    >gi|16077522|ref|NP_388336.1| putative thioredoxin or thiol-disulfide isomerase [Bacillus subtilis subsp. subtilis str. 168]
    MKKITTNEQFNELIQSDKEIIVKFYADWCPDCTRMNMFIGDILEEYNQNDWYELNKDELPDLAEKYQVMGIPSLLIFKNG
    EKTAHLHSANAKTPEEVTEFLSEHIS

    >gi|16077607|ref|NP_388421.1| hypothetical protein BSU05400 [Bacillus subtilis subsp. subtilis str. 168]
    MSQRVSYYEIAPEGMKIMMDMEKYTKQSSINRTTRELIKIRVSQMNGCAFCIDMHTSDARKMGETEQRIYCLHAWNECDF
    YSPEEKAALELSEHITLIPSKRVPDELYHRVREHYDEEQYVDLVLIINQINSWNRISIAMGNRAASK

    >gi|16077618|ref|NP_388432.1| putative thioredoxin or thiol-disulfide isomerase [Bacillus subtilis subsp. subtilis str. 168]
    MKEMTGLHSLVSIENFIKQHKFSFIYISRPGCTVCHAVLPQLRIVLDQFPNIKLGHINADDVAEVAGRFSVFTVPVLLLF
    IDGTEFLREARFVHFEQLEQKLKRVYRLYEGE

    >gi|16077876|ref|NP_388690.1| dihydrolipoamide dehydrogenase [Bacillus subtilis subsp. subtilis str. 168]
    MTLAIIGGGPAGYAAAVSAAQQGRNVLLIDKGKLGGTCLNEGCIPTKSLLESANVLDKIKHADSFGIELPAGAISVDWSK
    MQSRKQQVVSQLVQGVQYLMKKNQIQVVKGTASFLSERKLLIEGENGKEIREADQVLIASGSEPIELPFAPFDGEWILDS
    KDALSLSEIPSSLVIVGGGVIGCEYAGLFARLGSQVTIIETADRLIPAEDEDIARLFQEKLEEDGVEVHTSSRLGRVDQT
    AKTAIWKSGQREFKTKADYVLVAIGRKPRLDGLQLEQAGVDFSPKGIPVNGHMQTNVPHIYACGDAIGGIQLAHAAFHEG
    IIAASHASGRDVKINEKHVPRCIYTSPEIACIGMTERQARSIYGDVKIGEFSFSANGKALIKQQAEGKVKIMAEPEFGEI
    VGVSMIGPDVTELIGQAAAIMNGEMTADMAEHFIAAHPTLSETLHEALLSTIGLAVHA

    >gi|50812202|ref|YP_054574.1| putative bacterioferritin comigratory protein; putative peroxiredoxin [Bacillus subtilis subsp. subtilis str. 168]
    MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKF
    KEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK

    >gi|16078215|ref|NP_389032.1| transcriptional regulator Spx [Bacillus subtilis subsp. subtilis str. 168]
    MVTLYTSPSCTSCRKARAWLEEHEIPFVERNIFSEPLSIDEIKQILRMTEDGTDEIISTRSKVFQKLNVNVESMPLQDLY
    RLINEHPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRKVRSFQLREAQRLAN

    >gi|16078235|ref|NP_389052.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus subtilis subsp. subtilis str. 168]
    MTGRYSRQELFAPIGPSGQKKLKEARAVIIGAGALGTASAEMLVRAGVGSVKIADRDYVEWSNLQRQQLYTEDDVKKEMP
    KAAAAERRLRSINSDVDVTGLVMDVTAENIFELIRDASIIVDAADNFETRLIVNDAAVKEGIPFLYGACVGSYGLTFTVV
    PGSTPCLHCLLDALPIGGAT
    CDTAGIISPAVLQVAVFQVTDALKLLTGEECEPVLRSFDLWKNERSEVRAASLKHDACPS
    CGTKDFPFLSYENQTKAAVLCGRNTVQIRSSITKEADLEALAGQLRQAGLEVAANPYLISCRSDDMKMVLFRDGRALIHG
    TNDIARAKSIYHKWIG

    >gi|16078379|ref|NP_389197.1| peroxiredoxin [Bacillus subtilis subsp. subtilis str. 168]
    MSQPLFTATVSAVGGREGKVISSDRVLELDVAMPGTPRAKKLEKATNPEQLFAAGYAACFDSALQLVARTERVKVETEVT
    ANVSLLKDEADQGYKLGVTLQVKGEGVSASELEALVKKAHGV
    CPYSKATSGNIDVTLEVAE

    >gi|16078381|ref|NP_389199.1| organic hydroperoxide resistance reductase B [Bacillus subtilis subsp. subtilis str. 168]
    MALFTAKVTARGGRAGHITSDDGVLDFDIVMPNAKKEGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDSEIEGQVS
    LMKDESDGGFKIGVTLVVNTKDLDREKAQELVNAAHEF
    CPYSKATRGNVDVKLELK

    >gi|16078418|ref|NP_389237.1| O6-alkylguanine DNA alkyltransferase [Bacillus subtilis subsp. subtilis str. 168]
    MNYYTTAETPLGELIIAEEEDRITRLFLSQEDWVDWKETVQNTEHKETPNLAEAKQQLQEYFAGERKTFSLPLSQKGTPF
    QQKVWQALERIPYGESRSYADIAAAVGSPKAVRAVGQANKRNDLPIFVP
    CHRVIGKNSALTGYAGSKTEIKAFLLNIERI
    SYKEK

    >gi|16078448|ref|NP_389267.1| thiol-disulfide isomerase [Bacillus subtilis subsp. subtilis str. 168]
    MLTKRLLTIYIMLLGLIAWFPGAAQAEEKQPAVPAVFLMKTIEGEDISIPNKGQKTILHFWTSWCPPCKKELPQFQSFYD
    AHPSDSVKLVTVNLVNSEQNQQVVEDFIKANKLTFPIVLDSKGELMKEYHIITIPTSFLLNEKGEIEKTKIGPMTAEQLK
    EWTEE

    >gi|16078486|ref|NP_389305.1| putative 2-cys peroxiredoxin [Bacillus subtilis subsp. subtilis str. 168]
    MAERMVGKQAPRFEMEAVLASKEFGKVSLEENMKNDKWTVLFFYPMDFTFVCPTEITAMSDRYDEFEDLDAEVIGVSTDT
    IHTHLAWINTDRKENGLGQLKYPLAADTNHEVSREYGVLIEEEGVALRGLFIINPEGELQYQTVFHNNIGRDVDETLRVL
    QALQTGGLCPANWKPGQKTL

    >gi|255767334|ref|NP_389306.2| thiol-disulfide isomerase [Bacillus subtilis subsp. subtilis str. 168]
    MKLRQPMPELTGEKAWLNGEVTREQLIGEKPTLIHFWSISCHLCKEAMPQVNEFRDKYQDQLNVVAVHMPRSEDDLDPGK
    IKETAAEHDITQPIFVDSDHALTDAFENEYVPAYYVFDKTGQLRHFQAGGSGMKMLEKRVNRVLAETE

    >gi|16078491|ref|NP_389310.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus subtilis subsp. subtilis str. 168]
    MEERYSRQIRFKQIGEEGQKRLADSHVLIVGAGALGTAGAEGLSRAGVGTITIIDRDYVEWSNLQRQQLYTESDAKLRMP
    KAMAAKEHLSAINSEIHIEAYVTEGTAETLEPLIEKADVVIDATDNFETRMLINDLAQKTKTPWVYGACVSSQGMFMTVI
    PGETPCLSCLFEQIPVGGAT
    CDTAGIIPPAVHIVSAYQQAEALKLLTGQKEAIQRGFVTFDVWNNSHMKINVNHVRREEC
    PSCGANAVYPYLQDWNTPKAAVLCGRDTVQVRSESLKRIPKQELIKRLKTIGKVEANAFLLHIFYEDFRIVIFNDGRALV
    HGTNDVKEANSVLARVIGL

    >gi|16078525|ref|NP_389344.1| dihydrolipoamide dehydrogenase [Bacillus subtilis subsp. subtilis str. 168]
    MVVGDFPIETDTLVIGAGPGGYVAAIRAAQLGQKVTVVEKATLGGVCLNVGCIPSKALINAGHRYENAKHSDDMGITAEN
    VTVDFTKVQEWKASVVNKLTGGVAGLLKGNKVDVVKGEAYFVDSNSVRVMDENSAQTYTFKNAIIATGSRPIELPNFKYS
    ERVLNSTGALALKEIPKKLVVIGGGYIGTELGTAYANFGTELVILEGGDEILPGFEKQMSSLVTRRLKKKGNVEIHTNAM
    AKGVEERPDGVTVTFEVKGEEKTVDADYVLITVGRRPNTDELGLEQVGIEMTDRGIVKTDKQCRTNVPNIYAIGDIIEGP
    PLAHKASYEGKIAAEAIAGEPAEIDYLGIPAVVFSEPELASVGYTEAQAKEEGLDIVAAKFPFAANGRALSLNETDGFMK
    LITRKEDGLVIGAQIAGASASDMISELSLAIEGGMTAEDIAMTIHAHPTLGEITMEAAEVAIGSPIHIVK

    >gi|16078791|ref|NP_389610.1| putative peroxiredoxin-related protein [Bacillus subtilis subsp. subtilis str. 168]
    MADHHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSGLEKEDLQMES
    EGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLCKKAESS
    CMISRAIQGNVELQLEASVKLGGE

    >gi|16078864|ref|NP_389684.1| putative membrane-bound proteins with a thioredoxin-like domain [Bacillus subtilis subsp. subtilis str. 168]
    MLKKWLAGILLIMLVGYTGWNLYQTYSKKEVGIQEGQQAPDFSLKTLSGEKSSLQDAKGKKVLLNFWATWCKPCRQEMPA
    MEKLQKEYADKLAVVAVNFTSAEKSEKQVRAFADTYDLTFPILIDKKGINADYNVMSYPTTYILDEKGVIQDIHVGTMTK
    KEMEQKLDLD

    >gi|16078867|ref|NP_389688.1| hypothetical protein BSU18060 [Bacillus subtilis subsp. subtilis str. 168]
    MNMTINEDALNWYKEELDLESGDQVRFFVRYGGCSNVQKGFSLGVAKDAPQEAGVTAEADGITFFIEESDLWYFDNHDLL
    VSYSEDADEPVFEYQ

    >gi|16079061|ref|NP_389884.1| SPbeta phage putative thiol disulfide oxidoreductase [Bacillus subtilis subsp. subtilis str. 168]
    MRLIKLEQPNCNPCKMVSNYLEQVNIQFETVDVTQEPEVAARFGVMGVPVTILLSDQGEEVNRSVGFKPNELDELLKELR


    >gi|16079205|ref|NP_390029.1| bacteriophage SPbeta thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis str. 168]
    MKKWIVLFLVLIAAAISIFVYVSTGSEKPFYNDINLTQYQKEVDSKKPKFIYVYETSCPPCQEIKPELNEVIKKEKLKVQ
    ALNIEEKENYNTEFLDKYNLNKTPTILYYKDGKEKDRLEGYRSASQIEKFFDKNGDR

    >gi|16079227|ref|NP_390051.1| methionine sulfoxide reductase B [Bacillus subtilis subsp. subtilis str. 168]
    MAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLD
    TSHGMIRTEVRSRTADSHLGHVFNDGPGPNGLRY
    CINSAALRFVPKHKLKEEGYESYLHLFNK

    >gi|16079228|ref|NP_390052.1| methionine sulfoxide reductase A [Bacillus subtilis subsp. subtilis str. 168]
    MSEKKEIATFAGGCFWCMVKPFDEQPGIEKVVSGYTGGHTENPTYEEVCSETTGHREAVQITFHPDVFPYEKLLELFWQQ
    IDPTDAGGQFADRGSSYRAAIFYHNDKQKELAEASKQRLAESGIFKDPIVTDILKAEPFYEAEGYHQHFYKKNPAHYQRY
    RTGSGRAGFISEHWGAK

    >gi|255767476|ref|NP_390058.2| assembly factor BSco of the Cu(A) site of cytochrome c oxidase [Bacillus subtilis subsp. subtilis str. 168]
    MKVIKGLTAGLIFLFLCACGGQQIKDPLNYEVEPFTFQNQDGKNVSLESLKGEVWLADFIFTNCETICPPMTAHMTDLQK
    KLKAENIDVRIISFSVDPENDKPKQLKKFAANYPLSFDNWDFLTGYSQSEIEEFALKSFKAIVKKPEGEDQVIHQSSFYL
    VGPDGKVLKDYNGVENTPYDDIISDVKSASTLK

    >gi|16079249|ref|NP_390073.1| putative peroxidase [Bacillus subtilis subsp. subtilis str. 168]
    MSIYHMKVRTITGKDMTLQPFAGKVLMIVNTASKCGFTSQLKQLQELYDTYQQEGLEILGFPCNQFMNQEPGEEADIQEF
    CETNYGVTFPMFSKVDVNGKNAHPLFVYLTEHAKGMLGTKAIKWNFTKFIVDRNGEIVGRYSPNTNPKELEDDIVKLLEQ


    >gi|255767500|ref|NP_390196.2| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis str. 168]
    MKKKRRLFIRTGILLVLICALGYTIYNAVFAGKESISEGSDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKE
    FPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTM
    TESMIHDYMNLIKPGETSG

    >gi|16079423|ref|NP_390247.1| hypothetical protein BSU23660 [Bacillus subtilis subsp. subtilis str. 168]
    MNIHVTDAAKQALQQAFDANPGKKAQLRYDAEGCGCAVSGVPTIWLAEELTGQCEQLETNGIPLYIQSSQKVFFDDQMTI
    DYNEKAKTLALKSPAEMLSPRMSILVK

    >gi|255767526|ref|NP_390286.2| dihydrolipoamide dehydrogenase [Bacillus subtilis subsp. subtilis str. 168]
    MATEYDVVILGGGTGGYVAAIRAAQLGLKTAVVEKEKLGGTCLHKGCIPSKALLRSAEVYRTAREADQFGVETAGVSLNF
    EKVQQRKQAVVDKLAAGVNHLMKKGKIDVYTGYGRILGPSIFSPLPGTISVERGNGEENDMLIPKQVIIATGSRPRMLPG
    LEVDGKSVLTSDEALQMEELPQSIIIVGGGVIGIEWASMLHDFGVKVTVIEYADRILPTEDLEISKEMESLLKKKGIQFI
    TGAKVLPDTMTKTSDDISIQAEKDGETVTYSAEKMLVSIGRQANIEGIGLENTDIVTENGMISVNESCQTKESHIYAIGD
    VIGGLQLAHVASHEGIIAVEHFAGLNPHPLDPTLVPKCIYSSPEAASVGLTEDEAKANGHNVKIGKFPFMAIGKALVYGE
    SDGFVKIVADRDTDDILGVHMIGPHVTDMISEAGLAKVLDATPWEVGQTIHPHPTLSEAIGEAALAADGKAIHF

    >gi|255767550|ref|NP_390334.2| putative sulfur transferase [Bacillus subtilis subsp. subtilis str. 168]
    MSNMIVLIIFAAFIIYMIASYVYQQRIMKTLTEEEFRAGYRKAQLIDVREPNEFEGGHILGARNIPLSQLKQRKNEIRTD
    KPVYLY
    CQNSVRSGRAAQTLRKNGCTEIYNLKGGFKKWGGKIKAKK

    >gi|255767555|ref|NP_390357.2| transcriptional regulator of stress [Bacillus subtilis subsp. subtilis str. 168]
    MEQQLTFYSYPSCTSCRKTKHWLKAHQIEFNERHLFRETPTREELKYILSLTTEGIDEILATRSQTFKNLNLNIEEMTVN
    EVLELLIEKPKLLRRPILVDNKKLVIGYNPGELLKLSKKKTVHQSA

    >gi|16079706|ref|NP_390530.1| putative rhodanese-related sulfur transferase [Bacillus subtilis subsp. subtilis str. 168]
    MMKATIVLDAKGLACPMPIVKTKKRMKDLKAGEVLEIHATDKGSTADLEAWAKSTGHEYLGTEAEGEILRHFLRKGGEHS
    SENASSIPEISLEAFKQKVDSDESLNILDVREIEEYEKAHIPGVVHIPLGEVEKRANELNENDEIYII
    CHSGRRSEMAAR
    TMKKQGFKKVINVVPGMRDWTGKTE

    >gi|16079902|ref|NP_390728.1| thioredoxin [Bacillus subtilis subsp. subtilis str. 168]
    MAIVKATDQSFSAETSEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKD
    GEVVETSVGFKPKEALQELVNKHL

    >gi|16079984|ref|NP_390810.1| putative redoxin [Bacillus subtilis subsp. subtilis str. 168]
    MSDVVNIVVWSKKGCSYCEEVKNYLNEKGFPFQNIDVSEKEKLRDILQVKYGVRHVPVVEIGRGNQYQGITEIGIEHLDL
    ALANHAQIKEAKR

    >gi|16080001|ref|NP_390827.1| putative peroxiredoxin [Bacillus subtilis subsp. subtilis str. 168]
    MAEITFKGGPVTLVGQEVKVGDQAPDFTVLTNSLEEKSLADMKGKVTIISVIPSIDTGVCDAQTRRFNEEAAKLGDVNVY
    TISADLPFAQARWCGANGIDKVETLSDHRDMSFGEAFGVYIKELRLLARSVFVLDENGKVVYAEYVSEATNHPNYEKPIE
    AAKALVK

    >gi|16080036|ref|NP_390862.1| putative thiol-disulfide oxidoreductase with thiredoxin domain [Bacillus subtilis subsp. subtilis str. 168]
    MKKIESTQELEKAVKDDWSVFMFSADWCPDCRFVEPFLPELEANFPEFTYYYVDRDKFIDTCAEWEIYGIPSFVVFNEGK
    EVNRFVSKDRKTKEEIEQFLTDSLAKA

    >gi|255767688|ref|NP_390884.2| putative NAD(FAD) dehydrogenase [Bacillus subtilis subsp. subtilis str. 168]
    MKQYDVIVIGGGPSGLMAAIAAGEQGAGVLLIDKGNKLGRKLAISGGGRCNVTNRLPVEEIIKHIPGNGRFLYSAFSEFN
    NEDIIKFFENLGIQLKEEDHGRMFPVTDKAQSVVDALLNRLKQLRVTIRTNEKIKSVLYEDGQAAGIVTNNGEMIHSQAV
    IIAVGGKSVPHTGSTGDGYEWAEAAGHTITELFPTEVPVTSGEPFIKQKTLQGLSLRDVAVSVLNKKGKPIITHKMDMLF
    THFGLSGPAILRCSQFVVKELKKQPQVPIRIDLYPDINEETLFQKMYKELKEAPKKTIKNVLKPWMQERYLLFLLEKNGI
    SPNVSFSELPKDPFRQFVRDCKQFTVLANGTLSLDKAFVTGGGVSVKEIDPKKMASKKMEGLYFCGEILDIHGYTGGYNI
    TSALVTGRLAGLNAGQYARS

    >gi|255767695|ref|NP_390909.2| putative sulfur transferase [Bacillus subtilis subsp. subtilis str. 168]
    MEIKEISTAALKEKIEADEELYLIDVREDEEVAEGMIPQAVHIRMGDIPEKMETLDKDKEYVFICRSGMRSMNVCKYLDE
    QGFKTVNVEGGMMAWEGETKPKN

    >gi|16080269|ref|NP_391096.1| putative chaperone involved in Fe-S cluster assembly [Bacillus subtilis subsp. subtilis str. 168]
    MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKSESDSVFDQHGITVLVDKESLDIMNGTVI
    DYKQSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC

    >gi|255767739|ref|NP_391100.2| putative NADH dehydrogenase [Bacillus subtilis subsp. subtilis str. 168]
    MKKLVLIGGGYGNMRVLHRLLPNQLPDDVSITLIDRNPYHCLKTEYYALAAGTISDHHIRVSFPEHPRLDVQYGDITSID
    IVQKQVLFQDREPISYDDAIIGLGCEDKYHNVPGAPEFTYSIQTIDQSRETYQKLNNLSANATVAIVGAGLSGVELASEL
    RESRDDLNIILFDRGNLILSSFPERLSKYVQKWFEEHGVRIINRANITKVEEGVVYNHDDPISADAIVWTAGIQPNKVVR
    DLDVEKDAQGRIVLTPHHNLPGDEHLYVVGDCASLPHAPSAQLAEAQAEQIVQILQKRWNGEALPESMPQFKLKGVLGSL
    GKKAGFGLVADRPLIGRVPRMLKSGLLWMYKHHNG

    >gi|16080329|ref|NP_391156.1| putative thiol-disulfide oxidoreductase with thioredoxin domain [Bacillus subtilis subsp. subtilis str. 168]
    MKELQEHELDHIEDDVYLLYLYTPFCGTCQLASKMLTVVKEMLPDVAFYQNNVNYSPTFAKAYQIESVPCFLLFKGGKMV
    ERGYAFHSVSYLYELIKQKSSSASHL

    >gi|16080333|ref|NP_391160.1| putative oxidoreductase with thioredoxin domain [Bacillus subtilis subsp. subtilis str. 168]
    MSLTFYWYPKCGTCRKAKKWLEEHGKEINEIHIAEQPPSKEELKALYEKSGLDLKKFFNTSGMKYRELNLKEKLYHMSED
    EQLELLASDGMLIKRPLTTDGEKVTVGFKEDQFEENWA

    >gi|16080401|ref|NP_391228.1| thiol-disulfide oxidoreductase [Bacillus subtilis subsp. subtilis str. 168]
    MKKKQQSSAKFAVILTVVVVVLLAAIVIINNKTEQGNDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIF
    PKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDLAKSTTKIK
    PETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKELKGK

    >gi|255767764|ref|NP_391229.2| copper(I)-transporting ATPase [Bacillus subtilis subsp. subtilis str. 168]
    MKQEYVLDGLDCSNCARKIENGVKGIKGINGCAVNFAASTLTVSADGKEEQWVTNKVEKKVKSIDPHVTVRQKHIKKSAD
    DGYRNRMVNMLIRMAAAVILGAAAYLVQSGTIEFFLFLGAYLIIGGDIIIRAVKNIIRGQVFDEHFLMALATIGAFLIQQ
    YPEGVAVMLFYQIGELFQGAAVSRSRKSISALMDIRPDYANLKTKNGIEQVSSEDVQTGDIIVVNPGESIPLDGKVVQGS
    AMVDTSALTGESVPRKAAEGQDVMSGFINQNGVLHIEVTKGYQESAVSKILDLVQNASSRKARTENFITKFAKYYTPAVV
    IIAVLLAFVPPLVLSGAALSDWVYRALIFLVISCPCALVVSIPLGFFGGIGAASKAGVLVKGSNYLEALNQVKYAVFDKT
    GTLTKGSFEVTEIKPAEGFTKDRLLEAAAYAELHSQHPIAESVRKAYGKMLSSDEIESYEEISGHGIFAKVNGTEILAGN
    KKLMEREQIEDVPDENAGTIVHVAVDQRYAGAIIIADEIKEDAAQAVADLKSLGIKQTAMLTGDSKQTGEAVGKQLGIGE
    VYAELLPQDKVAQVEALEAKLLPSEKLIFVGDGINDTPVLARADIGVAMGGLGSDAAVEAADIVLMTDQPSKIAEAIRIA
    KRTRRIVWQNIGFALGVKAIFLILGAFGIATMWEAVFSDVGVTLLAVANAMRVMRLKNK

    >gi|255767765|ref|NP_391230.2| copper transporter ATPase [Bacillus subtilis subsp. subtilis str. 168]
    MSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETSNVIYDPAETGTAAIQEKIEKLGYHVVTEKAEFDIE
    GMT
    CAACANRIEKRLNKIEGVANAPVNFALETVTVEYNPKEASVSDLKEAVDKLGYKLKLKGEQDSEAAAKKKEERKQTA
    RLIFSAVLSFPLLWAMVSHFTFTSFIWVPDIFLNPWMQFALATPVQFLIGWPFYVGAYKALRNKSANMDVLVALGTTAAY
    AYSLYLTFQSIGSHGHTDGLYYETSAILLTLILLGKLFETKAKGRSSDAIKKLMKLQAKTATVVRDGQEQIIPIDEVLVN
    DIVYVKPGERIPVDGEVVEGRSAVDESMITGESLPVDKNPGDSVTGSTVNANGFLKIKAVNVGKDTALSHIIKIVEEAQG
    SKAPIQRLADQISGIFVPIVLGIAVLTFLIWYLWAAPGDFAEAISKFIAVLVIACPCALGLATPTSIMAGSGRAAEFGIL
    FKGGEHLEKTHRLDTIVLDKTGTVTNGKPRLTDAIPFGRFEEKDLLQFAAAAETGSEHPLGEAIIAGVKDKGLEIPKLTR
    FEAKVGAGILAEAGGKSILVGTRKLMESEQVEHGALLAQMEELEAEGKTVMLVSIDGEAAGLVAVADTIKDTSRKAVARL
    KELGLDVIMMTGDNRRTAEAIAKEAGIANIIAEVLPEQKAAEIARLQKEGRQTAMVGDGINDAPALATADIGMAIGTGTD
    IAMETADITLIRGDLNSIADAIRMSRLTMKNIKQNLFWALGYNSLGIPIAALGFLAPWIAGAAMAFSSVSVVLNALRLQK
    VK

    >gi|16080404|ref|NP_391231.1| copper insertion chaperone and transporter component [Bacillus subtilis subsp. subtilis str. 168]
    MEQKTLQVEGMSCQHCVKAVETSVGELDGVSAVHVNLEAGKVDVSFDADKVSVKDIADAIEDQGYDVAK

    >gi|16080532|ref|NP_391359.1| thioredoxin reductase [Bacillus subtilis subsp. subtilis str. 168]
    MSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMIERGIPGGQMANTEDVENYPGFESILGPELSNKMFEHAKKFGAEYA
    YGDIKEVIDGKEYKVVKAGSKEYKARAVIIAAGAEYKKIGVPGEKELGGRGVSY
    CAVCDGAFFKGKELVVVGGGDSAVEE
    GVYLTRFASKVTIVHRRDKLRAQSILQARAFDNEKVDFLWNKTVKEIHEENGKVGNVTLVDTVTGEESEFKTDGVFIYIG
    MLPLSKPFENLGITNEEGYIETNDRMETKVEGIFAAGDIREKSLRQIVTATGDGSIAAQSVQHYVEELQETLKTLK

    >gi|16080876|ref|NP_391704.1| putative sulfur oxido-reductase [Bacillus subtilis subsp. subtilis str. 168]
    MTVHIKVYSDYVCPFCFVGKAAFEEAIKGKDVEVEWMPFELRPSPSPQLDPVNDPSKQYMWQTSIQPMAEKLGVEINFPN
    VSPHPYTDLAFEGFHFAKEYNKGHEYNTRVFQAFFQEDQNIGDIDILTKLAEEVGLDGASFKSALETRTYQDVQRQALKH
    AYEEADITAVPTFIIGDTVIPGAAGKDVFEKAISDEQKKK

    >gi|16081061|ref|NP_391889.1| alkyl hydroperoxide reductase (small subunit) [Bacillus subtilis subsp. subtilis str. 168]
    MSLIGKEVLPFEAKAFKNGEFIDVTNEDLKGQWSVFCFYPADFSFVCPTELEDLQEQYAALKELGVEVYSVSTDTHFVHK
    GWHDSSEKISKITYAMIGDPSQTISRNFDVLDEETGLADRGTFIIDPDGVIQTVEINAGGIGRDASNLVNKVKAAQYVRQ
    NPGEVCPAKWEEGGETLTPSLDLVGKI

    >gi|16081062|ref|NP_391890.1| alkyl hydroperoxide reductase (large subunit) [Bacillus subtilis subsp. subtilis str. 168]
    MVLDANIKAQLNQYMQLIENDIVLKVSAGEDDTSKDMLALVDELASMSSKISVEKAELNRTPSFSVNRVGEDTGVTFAGI
    PLGHEFTSLVLALLQVSGRPPKVDQKVIDQVKKISGEYHFESYISLT
    CHNCPDVVQALNMMSVLNPNITHTMIDGAAYKA
    EVESKNIMAVPTVYLNGESFGSGRMTLEEILAKMGSGTDASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
    FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKEYDIDVMNLQRAKRLEKKDLFELELENGAVLKSKTVILSTGARWRN
    VNVPGEQEFKNKGVAY
    CPHCDGPLFEGKDVAVIGGGNSGIEAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTV
    VKNAQTKEITGDQSVNGITYVDRETGEEKHVELQGVFVQIGLVPNTEWLEGTVERNRMGEIIVDKHGATSVPGLFAAGDC
    TDSAYNQIIISMGSGATAALGAFDYLIRN

    >gi|16081131|ref|NP_391959.1| hypothetical protein BSU40790 [Bacillus subtilis subsp. subtilis str. 168]
    MPNKSKPNRLIAEKSPYLLQHAHNPVDWFPWGEEAFAKAKRENKPVLVSIGYSTTCHWWPGIIKSCGTPLKDNRSHFKR

    >gi|16081134|ref|NP_391962.1| hypothetical protein BSU40820 [Bacillus subtilis subsp. subtilis str. 168]
    MPNKSKPNRLINEKSPYLLQHAHNPVDWFPWGEEAFEKAKRENKPVLVSIGYSTCHWCHVMAHESFEDEEIARLLNERFV
    AIKVDREERPDVDSVYMRICQLMTGQGGWPLNVFITPDQKPFYAGTYFPKTSKFNRPGFVDVLEHLSETFANDREHVEDI
    AENAAKHLQTKTAAKTGEGLSESAIHRTFQQLASGFDTIYGGFGQAPKFPMPHMLMYLLRYDHNTGQENALYNVTKTLDS
    MANGGIYDHIGYGFARYSTDDEWLVPHFEKMLYDNALLLTAYTEAYQVTQNSRYKEICEQIITFIQREMTHEDGSFFSAL
    DADTEGEEGKYYVWSKEEILKTLGDDLGTLYCQVYDITEEGNFEGKNIPNLIHTKREQIKEDAGLTEKELSLKLEDARQQ
    LLKTREERTYPHVDDKVLTSWNALMIAGLAKAAKVYQEPKYLSLAKDAITFIENKLIIDGRVMVRYRDGEVKNKGFIDDY
    AFLLWAYLDLYEASFDLSYLQKAKKLTDDMISLFWDEEHGGFYFTGHDAEALIVREKEVYDGAVPSGNSVAAVQLLRLGQ
    VTGDLSLIEKAETMFSVFKPDIEAYPSGHAFFMQSVLRHLMPKKEIVIFGSADDPARKQIIAELQKAFKPNDSILVAEQP
    EQCKDIAPFAADYRIIDGKTTVYICENFACQQPTTNIEEAIHTLISSRD