Tolumonas auensis DSM 9187 uid59395

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|237806918|ref|YP_002891358.1| Thiosulfate sulfurtransferase [Tolumonas auensis DSM 9187]
    MSQFTRISIQQAAALLQLPSVCLADIRDPSSFNAAHVTGAFHLTNDTLPQFTQQITKETPVLVMCYHGNSSQGVANYLTS
    IGYEKVYSIDGGFEGWRHVYPYTATV

    >gi|237807087|ref|YP_002891527.1| Disulphide bond formation protein DsbB [Tolumonas auensis DSM 9187]
    MTFWLRHITRERSAWLLLGLSAVFLEVCALLFQHGLGLRPCLMCIYERLAVIGLFGSALIALIDPAKSLWRWGGLILWGL
    SIYRGLQLSLRHVDYLLHPSPFNS
    CAFFPDFPAWLPLDIWFPWWFKPLAECSERQWNLWGWELPQWLVLIFSVYLIVWIV
    IVAANLLTHKYLAE

    >gi|237807091|ref|YP_002891531.1| Peroxiredoxin [Tolumonas auensis DSM 9187]
    MTEAGNNVAMPRLNEAAPSFTAKTTHGMLSLSDYKGKWLILFSHPADFTPVCTTEFMGFAKAGGDFKALNCELLGLSIDG
    VHAHIAWARSIKDNFGVEINFPIIADLNMAVARSYGMVQPGASDTSAVRATFVIDPDGVLRAMLYYPMSNGRSVAEILRL
    VKALQTTDNNVCATPENWQPGDEVIVPPPATTMAAEARKSEGFNYTDWYFSKRKL

    >gi|237807093|ref|YP_002891533.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Tolumonas auensis DSM 9187]
    MTKIVIIGGVAGGASAAARARRLSETAEIIVLERGEFVSFANCGLPYHISGEIEARDALLLQTPESFRHRFNVDVRVFNE
    VIAIDKHKKEVTVRRVLTGEIYQESYDKLLLSPGASPVKPPIPGINSHYVFSLRNIPDMDQILSSLLLNQPQHATVVGGG
    FIGLEMVEALHHRGIKVTLLELSDQVMAPVDREMANMLHQELVEKGVDLRLNTGLAAVTELEIQPAEPEATGEYDKQIEH
    TNTLELMLSTGEMLKTGLVVLAIGVKPETMLANQAGIELGARGGIKVDARMCTSDPDIFAVGDVVETEDFVTALPSLVPL
    AGPANRQGRIAADNMLGRREIYRRTQGTSICKLFDMAIGSTGLNEKTLKRLKLPYEKIYVHTASHASYYPGAHPVTLKLL
    FNPTDGEILGAQAAGLDGVDKRIDVLAVAQRARMSVYTLQDLELTYAPPFGSARDVVNQAGMVASNILKGDEAVCHSEEL
    LLGASDQIVLDVRNPPELEASGTFPDAINIPLDQLRQRLHELPKDKEILVA
    CQVGLRGHVACRMLIQHGFKARNLTGGFK
    TYQMVTTKF

    >gi|237807094|ref|YP_002891534.1| alkylhydroperoxidase like protein, AhpD family [Tolumonas auensis DSM 9187]
    MAKSYKEINQDQRQFGSAYRKASPDTMNAFLALHKAAMVEGAVSIKHKELIATGIAIAARCDGCIGAHVAAALKAGATKQ
    ELIETIDVAVLMGGGPAIIYGTQALAAVEELSAE

    >gi|237807097|ref|YP_002891537.1| Rhodanese domain protein [Tolumonas auensis DSM 9187]
    MFRVFLLFTALTGCFTVSAKEWLIDVRTAAEYTIEHADGAANIEYQQIVIGAQQAGIEKQDTVHLYCRSGRRAEIAKELL
    IQNGYQKVENLGSLQDAESWAKTSHLAVATNH

    >gi|237807282|ref|YP_002891722.1| Rhodanese domain protein [Tolumonas auensis DSM 9187]
    MQEYIDFAMRHELLVLAWVGLATAVIASAVKARLSPVKQIDNQTAVALINKQDAVVVDVRTQDEFARGHIAGSHHMPLAQ
    IEQGNTTEIDKHKEKPVIVV
    CETGARAETAGSKLVKAGFQQVYLLRGGLTQWRSSNLPVTKKR

    >gi|237807340|ref|YP_002891780.1| peroxiredoxin [Tolumonas auensis DSM 9187]
    MSLINTEVKTFATNAYHNGKFVPVTSDDLKGKWSVVFFYPADFTFVCPTELGDLADNYAEFQKLGVEIYSVSTDTHFTHK
    AWHDTSDTIKKIQYPMLADPTGVISRNFDVMIEEEGLALRGTFVINPEGQIKLCEIHDNGIGRDAKELLRKVQAAQYVAN
    HPGEVCPAKWTPGAATLAPSFDLVGKI

    >gi|237807341|ref|YP_002891781.1| alkyl hydroperoxide reductase, F subunit [Tolumonas auensis DSM 9187]
    MLDANVKTQLKGYLANVTHPIEIIASTDDSDSSRELQSLLNDIVEQSDKISLRQSDDPTTRKPSFAINRVGADMGVAFAG
    LPMGHEFTSLVLALLQVGGHPPKADAELLEQIRNLPGEYNFETYISLT
    CQNCPDVVQALNLMSVVNPKIRHVMIDGSLFQ
    DEVNARQIMAVPTVYLNGEVFGQGRMGLEEIVAKLDTGSSARAAAKLNEKTPFDVLVVGGGPAGAAAAIYAARKGIRTGV
    VAERFGGQVLDTMSIENFISVKETEGPKLAMALEQHVKEYDVDIMNLQRAAELVRGPEYVEVKLQSGAVLKSKSVILATG
    ARWREMNVPGEQEYRTKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQSKLRSL
    PNVTIITEALSTEVLGDGNKVTGLTYTDRATNEGHKIDLEGIFVQIGLLPNTDWLKGSEVELSNRGEIIVGAHGNTSMEG
    VFAAGDATIVPFKQIIIAMGEGAKASLGAFDYLIRSSAPKA

    >gi|237807355|ref|YP_002891795.1| iron-sulfur cluster assembly accessory protein [Tolumonas auensis DSM 9187]
    MSDVAVQFPIEMTDAAAAKVKTLITEEENPELKLRVYITGGGCSGFQYGFTFDEKINEGDTVVEKDGVIMVVDGMSLQYL
    VGGVVDYIDGLEGSRFTVTNPNATTTCGCGSSFSV

    >gi|237807364|ref|YP_002891804.1| heavy metal translocating P-type ATPase [Tolumonas auensis DSM 9187]
    MTGQKTERLMLPIQGMYCAACATRLEKVLSKVAGVSHASVNLASEKAQIESDAKIAPAAFISAVEKAGFTVPQRTVTLQI
    KGMH
    CAACQQRLEKVLNREPGVISAVVNLASEKARIQVLPDVADTQLLQAIAKAGYEGIVPDSTSNAAEQPKRDTDRDWL
    IVGALCTLPLLLPMIAGLWGAQVLLPVFWQFLLASIVQFGLGWRFYRGAWAALRVGSSNMDVLVALGTTAAYGLSLYQWL
    LQAHHAHLYFESSATVITLVWFGKWLEQRAKRQTSEAIRALQALRPEQAWVERDGVEQWLLLAMIRLGDRVRVRAGERIP
    VDGEIIEGSSHLDESLLTGESLPVSKQAGDKVSTGAMNGEGLLWLRTSALGEDTLLARIIARVEQAQMAKPPIQKKVDQI
    SAVFVPVVLVLALLTVTGWYVFTGQGEAALIHAVSVLVIACPCALGLATPAAIMAGTGTAARHGILIRDAEVLEKAEKIN
    MVVFDKTGTLTQGHPALSAQQVIGISEQQALQIAAALQQGSAHPLGIALQQAAEHQGLALPLLSEIRTVAGIGVQGKWQD
    LDYALVGGQGLIQRQLTPDAALQAGAEQQYQQGRTVSWLIAAEQVVAWFAFQDPPKPEAAAAIKTLQQQGIKVALLSGDN
    QQSVQQIASLLGIDEMAAQVLPEQKAEAVVRWQKQGFTVAMVGDGINDAPALAESDLGIAMGSGTDVAMASAAMTLMRND
    PRAVADALMIARLTSRKIRQNLFWAFIYNLVALPLAVMGFLDPMLAGAAMAFSSVSVVTNALWLTRWHPAWAVIRES

    >gi|237807422|ref|YP_002891862.1| Redoxin domain protein [Tolumonas auensis DSM 9187]
    MATVTLAGNPVTVNGDFPKAGTTAKPFSLVNKELADVTLASFAGKRKVLNIFPSVDTSVCAASVRHFNEAAGKLENTVVL
    CISADLPFALARFCGAEGLDNVITLSTLRGAEFKQAYGVDIADGVLAGLTARAVVVLDEADKVLHAELVDEITHEPNYDA
    ALKALA

    >gi|237807458|ref|YP_002891898.1| protein of unknown function UPF0061 [Tolumonas auensis DSM 9187]
    MAFLHFDNRFIRELPGDPLTLNQPRQVHAAFWSAVTPAPVPQPQLIASSAEVAALLGISLAELQQPAWVAALSGNGLLDG
    MSPFATCYGGHQFGNWAGQLGDGRAISLGELIHNDLRWELQLKGAGVTPYSRRGDGKAVLRSSIREFLCSEAMFHLGVPT
    TRALSLVLTGEQIWRDMFYDGNPQQEPGAIVCRVAPSFIRFGHFQLPAMRGESDLLNQLIDFTIDRDFPHLSAQPATVRR
    GVWFSEVCITTAKLMVEWTRVGFVHGVMNTDNMSILGLTIDYGPYGWVDNFDLNWTPNTTDAEGLRYCFGRQPAIARWNL
    ERLAEALGTVMTDHAILAQGIEMFDETFAQEMAAMLAAKLGWQQWLPEDSELVNRLFDLLQQAEVDMTLFFRRLALVDVS
    APDLTVLADAFYRDDLFCQHQPAFTQWLTNYSQRVLSEGVLPAERAARMNQVNPVYVLRNYLAQQVIDAAEQGNYQPIAE
    LLEVLRQPYTEQSGKEAYAQKRPDWARHKPG
    CSMLSCSS

    >gi|237807564|ref|YP_002892004.1| Glutathione S-transferase domain protein [Tolumonas auensis DSM 9187]
    MKLYYAPGACSQASHIALREAGLDFQLERVDLRKKVTASGEDYRQINPQGYVPALQLDNGDVLTEGPAIMQFIADHAPAA
    GLLPTEGIARYRGIGWLNFIATELHKTCSPLFSPAITEEQRKPIIERLSARLDTVEHTLSTGRYLLGTEFSVADIYLFVV
    TGWFGHMNIPLKKWPHLERFREVVATRPAVHAALEAEGLL

    >gi|237807695|ref|YP_002892135.1| Thioredoxin domain protein [Tolumonas auensis DSM 9187]
    MIVTITPQNFHTELLEASRQKTIAVFFYADQLPECRPMGQQLEQLIGPANPAITLAKVDVADPQLQSLAVQLGLQALPAV
    VIFKNGQPADALMGPQEPAAVENLLIKYLPTEDETLFAEGQQLLQNGDAGAAYAVLQKAHQIAPQRYEIQVALADACVKS
    ARLEDAQELLNAIPNVYQDSAYQQVKSALDLAQQASDSPEIRALESLLAAEPENKQLQQELAIQYSQAGRKQEALEMLFA
    ILSKDLSFGEARKTYQDILATMGSDPLVSKYRKKLYTLLY

    >gi|237807767|ref|YP_002892207.1| SNARE associated Golgi protein [Tolumonas auensis DSM 9187]
    MKKIMVISVITLLVILIYAFDIQAYLSVDGLKHSVSQLEMWRVERPLLVGALFFSLYILIALLSLPGAAVMTIGAGALFG
    LLWGSIIASFASSIGATLAFLLSRYLLRDVVQNRFDKQLTAINAGMAKDGLLYLFALRLVPIFPFFLINLLMGLTTIRTR
    DYYWVSQLGMLAGTLVYVNAGTQLIRLTSLSEIMSPALLASFALLGVFPMMAKYVVKYLERRRVYARWSEPEKFDRNLIV
    IGGGAAGLVTSYIAAAVKAKVTLVEAHKMGGD
    CLNYGCVPSKAIIKSARLAHTIRHGEHYGLENLTPTFSFRNVMARVHE
    VIRHVAPHDSIERYTRLGVEVLEGYATIIDPWTVEIKLNNGGTQRLTTRSIVIATGARPVVPPLPGLEEVGYLTSDTMWR
    ELAKLDAPPARLVILGGGPIGCELSQSFARLGSQVTQVEMASRIMIREDEDVSALARDALTRDGVLVLTEHKALRCEKEG
    ERKFIVLEHKNIELRIEFDVLLCAVGRAARLSGYGLEALGIETQRTVITNDYLETLYPNIFAAGDVAGPYQFTHTAGHQA
    WYAAVNALFGDFKRFKVDYSVVPWATFIDPEVARVGLNEQDAREKGIPYEITRFGLADLDRAIADGTTHGFIKVLTVPGK
    DRILGVTIVGEHAADLLAEFVLAMKHRLGLNQILGTIHTYPTLSEANKYVAGEWKRQHAPQRILNWLARYHSWKRGA

    >gi|237807772|ref|YP_002892212.1| methionine-R-sulfoxide reductase [Tolumonas auensis DSM 9187]
    MKRVLKYLGGLAALLLVVSFSAAAEQTKTPASMTEKAMFAGGCFWCMTSPFETLNGVISVVSGYAGGTTENPTYENYGRG
    GHTEVVQITYDPKLVTYNQLLNIFWHQIDPTDADGQFVDRGHEYISAIYAYNDEQKQLAQQSRERLANSGIFNQPIVTEI
    LAAPAFWRAEEYHQDYHKKNPIRYKYYRSRSGRDDFLHKTWDGIWFDPTGMQPKVDLKTQLTPLQYKVTQENGTEPPFDN
    IYWDNKKPGIYVDIVSGEPLFSSTDKYDSGTGWPSFTRPLVAGNITEVEDNTLFTTRTEVRSRLGNSHLGHVFPDGPAPT
    GLRY
    CMNSAALRFIPADKLKEAGYGEYEKLFK

    >gi|237807777|ref|YP_002892217.1| redox-active disulfide protein 2 [Tolumonas auensis DSM 9187]
    MKNIKVLGPGCANCRTTAKLIEEVAKEYGEDIQLEKVEAIKDIVSFGILSTPGVIVDGKVVHSGGIPSKDKIKQWFMQS

    >gi|237807848|ref|YP_002892288.1| UBA/THIF-type NAD/FAD binding protein [Tolumonas auensis DSM 9187]
    MPDELTDNEFLRYGRQILLPEIGEAGQLRLKKSKVLIVGLGGLGSPASLYLAAAGVGQLWLADGDTVDSSNLQRQILYRT
    ADRHQAKTRVASTNLTALNPAVQCRIFPAVDDVLLADIVPQVDAVLDCTDNMVTRQRVNAACIAAQKPLITAAATGWEGQ
    LLLTEPAQKSACYHCLFPLSDEPGLN
    CREAGIVGPVVGMLGTAQALLALQLLCDLPRPTGVLQRFDGRTLQWQRLKTQPD
    PACPVCHPSASSSFPLEFPTCKSA

    >gi|237807863|ref|YP_002892303.1| methylated-DNA/protein-cysteine methyltransferase [Tolumonas auensis DSM 9187]
    MMIAICYFQSPVGYLRLQADDEGLQSLLLNSSPVDEPEVTDPLSHPVLALACQQLQEYFSGSRQEFSVPLSMQGTVFQLA
    AWQALQRIPYGSTVSYKSIAEQIGRPKAMRAVGMANNRNPVAIIVP
    CHRVIGANGKLVGYGGGLDMKQWLLDHEHQHAG

    >gi|237807877|ref|YP_002892317.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Tolumonas auensis DSM 9187]
    MTKIIIIGGVAGGASAAARARRLSEDAEILMLERGEFISFANCGLPYHISGDITQREALLLQTPQSFKSRFNVEVRVFSE
    VVAIDRQKKVITVKNLLSGEEYQESYDKLLLSPGAAPVRPPLPGINCENVFSLRNIPDMDRILAAIMLNKPKHATVVGGG
    FIGLEMVEALHQQGIEVTLLELSGQVMAPVDPEMANFVHQVLVQNKTDLRLNTGLTAITEIPVTPAEPDATGDFAIHPDL
    PNHLELTLNNGEKLVTGLVVLAIGVKPETMLASAAGLELGARGGIKVDEGMRTSDPDIYAVGDAVETLDFVTEQPTLIPL
    AGPANRQGRIAADNMLGRDEKYQRTQGTAICKVFDFAIASTGHSEKSLKRLGRAYEKVYVHPGNHAGYYPGAFPVSFKLI
    FDPATGQILGGQAFGKEGVDKRIDVLAVAMRAGLKVQDLEHLELTYAPPFGSARDVINQAGMVATNVIKGDERICHTADV
    LNISADQFLLDVRNPPELTNIGAIPGAVNIPVDQLRNRLAELPKDKEILIT
    CQVGLRGHVAYCLLANNGFKARNLSGGFK
    TFQMATKKF

    >gi|237807897|ref|YP_002892337.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Tolumonas auensis DSM 9187]
    MNRLTAGTTAPDFELPDQNGVMTRLSTFQGKKVLVYFYPKAMTPGCTTQACALRDSKSELDQRNVVVLGISPDASEKLKK
    FEARDELNFTLLGDEDHQVADAFGVWGPKKFMGKEYDGIHRISFLINEQGVIEQVFDDFKTSNHHQVVIDYLDSL

    >gi|237807903|ref|YP_002892343.1| arsenate reductase and related [Tolumonas auensis DSM 9187]
    MAVTIYGIKTCDSVKKAQNWLKQNNIAFELIDFKQTPPDEAQISQWCQSAGWEKLLNKQSKTFRELPPEQKVVHDEEQAI
    ALMHQFPLLIKRPVLVSEENIMIGFSESAYNSLIN

    >gi|237807967|ref|YP_002892407.1| Disulphide bond formation protein DsbB [Tolumonas auensis DSM 9187]
    MIVWLRSITQARLAWVLLGVSAVFLEVCALLFQHGLGLRPCLMCIYERIAVIGLIVSSVVALIDPSKRIWRWSGLIMWGL
    CIYRGLQLSLRHVDYLLHPSPFNT
    CSLFPDFPSWLPLDVWFPWWFKPLAECSERQWSMLGWELPQWLVLIFSLYLLVWLM
    VITANLLTHRYLTD

    >gi|237807973|ref|YP_002892413.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Tolumonas auensis DSM 9187]
    MNSEINTDVVIVGAGSAGLYALREVRRARKSFILIDTGPLGTTCARVGCMPSKVALHAAKLWAGCNKLSQIGVTGTDVLS
    IDLSATWSALRAQRDKFSHSAATKARNAAGEHLIIGAARFLEPTLIEVDSINGKQTIRASSVVIATGSRPVVPAWLEPVK
    NRMVTTDDFFELSALPERVGILGLGAIGLEMGAALSRLGVEVIGADLASTVAGITDPVIAKQATAYFGSEMTLWLGAPVS
    VERTEKGVLVRSGDNQAEVDLILSALGRRPNVDMLGLAEAGFPIGERGMPVFDTRTLQIGHLPVFIAGDANGFRPLMHEA
    ADEGAIAGFNAVQETVTRFRRKVAVGIAFTDPDICSVGARFDELHLEHVVIGSASGEANGRAKILGAESSLLRVYADARD
    GQLLGASILADGGEHLAHLLAWAIQRGETATSLLELPFYHPVMEEMLQTALQEIAKKVTMPGGVPLGLVADEFS

    >gi|237807977|ref|YP_002892417.1| Rhodanese domain protein [Tolumonas auensis DSM 9187]
    MLLRTFLLVTALIFSFTVKAKDWLIDVRTANEYSIDHADGAANIEYQQIVLGAQHLGIQKQDTVRLYCRSGRRAEIARES
    LLHAGYQKVENLGSLQEAESWTQTSRIAAVQQ

    >gi|237808048|ref|YP_002892488.1| Thioredoxin domain protein [Tolumonas auensis DSM 9187]
    MTMLVYQDEEPSVTEVESFTGPVVIEFGNSWCGFCQAAHHFISAAMSEHPQVKHIRIADGRGKPLGRAFKVKLWPTLIFL
    RDGQEVARIVRPDNTDEISNALAQIEIIS

    >gi|237808070|ref|YP_002892510.1| Rhodanese domain protein [Tolumonas auensis DSM 9187]
    MKSPLVSTEWLHDHLNDHNLVIIQATISKIIGKEPLIYSDPVHIPNAFKVDIEDDLSDLTSDVVHAFPSEQQFNALSQRL
    GICRDHTIVIYDDQGIYAAPRIWWIFKSFGVENVFILDGGLPKWLKENKPTTTEYRAMPEIPSAVNFSFNSQNVCSLELV
    KQNILTKQFIIVDARAAERFSGLVPEPRPGIRSGHIPNAINLPFGQVIDDICYKSPETLSDIFDVISHDKFRPLSFS
    CGS
    GVTGCIILVAAIIAGRSNVSLYDGSWSEWGSIPTLPVEL

    >gi|237808205|ref|YP_002892645.1| electron transport complex, RnfABCDGE type, E subunit [Tolumonas auensis DSM 9187]
    MESSPKGCHDLSPQQKVSGNGFTEIAKQGLWKNNPILVQVLGLCPTLAVTNSAANALGMGIATMLVLTLSNLGISLFRRW
    IPTEIRIPIYVLLIAAIVTCLQLVMNAYVYELYKSLGIFIALIVTN
    CIVAGRAEAFASQNSPLKSAFDGFMMGMGFAVTL
    FVLGSIREILGQGTLFAGADVLFGSWASALRVDVYHSDTTFLLAILPPGAFLVLGFLIAAKNALNARFARRKAPVRAQVE
    RVRVTTF

    >gi|237808210|ref|YP_002892650.1| electron transport complex, RnfABCDGE type, A subunit [Tolumonas auensis DSM 9187]
    MLEYLLLLISTVLVNNFVLVKFLGLCPFMGVSKKIEPAVGMGLATTFVLTLTSAFAYLVQHYLLVPLAAESLSTLAFILV
    IAVVVQFTEMVIHKSAPDLYRILGIYLPLITTN
    CIVLGLALLNITMQHNFMQSVVYGFGGGLGFMLVLILFASLRERLAA
    ADVPAPFQGIAIGMVTAGLMSLAFLGFTGLIKL

    >gi|237808289|ref|YP_002892729.1| DSBA oxidoreductase [Tolumonas auensis DSM 9187]
    MKLKTLATVLLGGMLSFSTIAAEMTKTEVEKIVREYLVSNPEILIEMSNGLRAKQEMQQDETDKALLKKHADQLFRQKDD
    PATGNAKGTLTIVEFVDYN
    CGYCKRSAPLVQALLKKDQDIRYIYKEFPILSDTSVYASKAALAVNALFPEKYAAFHDALM
    SHSGAFKTNDDIALVAKNLGLDWDKIAEKAKDPAIESKIATNHALARTLNITGTPAFIIGDQLLRGAPQTLEMLETSVKQ
    ARGK

    >gi|237808473|ref|YP_002892913.1| Disulphide bond formation protein DsbB [Tolumonas auensis DSM 9187]
    MIQFIRNITQSRTAWGILLGSTLFFELCGMVFQHVMGLQPCVMCIYQRVAILGIMAGALIGFINPRNWILRWTGLLIWAY
    SSIEGLRLALRHTDLQLNPSPFNT
    CDLFVTFPQWLPLDRWMPWFFNATGDCAELQWQFLSWTMPQWLIVSFGIYAIISFI
    IIAGNLIKGRCCG

    >gi|237808505|ref|YP_002892945.1| heavy metal translocating P-type ATPase [Tolumonas auensis DSM 9187]
    MGQPESGKISKITSLTPGKNGAIRRGTPAAVSETKPALKISGIACGCGSCDTETPKQELPPSEPKLTTAINCGCDSCDDE
    QKEQKADTQPSVSVGAISCSCDSCDDSHESVTSEEKQSLLTSNQKLVLAGIFAIAAEAIDWFSVSEWLAAFFALIAVALS
    GVTTYKKGWQALRRFDPNMHALMSIAVTGAFLIGQWPEAAMVMVLFNIAEFLESKSLERARNAIQELMTLTPEQALVQQS
    DNTWKELYINTVGVNQVIRIKPGVRIPLDGTVIRGSSSVDQAPITGESLPAEKNEGDLVYAGTINQQGSFDYRVTATTQN
    TLLARIIHSVEEAQGKRAPIQRLVDRFARIYTPIILIIAVLVALVPPLFFAAPWFEWLYKALVLLVIGCPCALVLSTPVA
    IVTALSVAARHGILIKGGHYLELGRKLQVLALDKTGTITTGKPELTDMIPLADTNIAECQQIAVALALHSEHPVSRTIVR
    AYPETADLSVQDITSLTGAGIQGVIAGETFRLISPKAFAANNALTAQVAQPISQYEAQGKTVVLLVKADTPLALFAVADT
    IKASSQQAITELHHLHIHTVMLTGDNAHTANRIATQAGIDQVYSNQLPEDKLNQIDTMSKHQIVGMVGDGINDAPALARA
    SIGFAMGGMGSDTAIETADIALMDDDLRKVPLFVRLSQATWRNILQNITVALGIKAGFLLATLLGFGTLWMAVFADMGTS
    LLVVANAMRLLRFK

    >gi|237808517|ref|YP_002892957.1| UBA/THIF-type NAD/FAD binding protein [Tolumonas auensis DSM 9187]
    MKELTDQELLRYHRQINLRSVDIDGQTALKNACVLIVGLGGLGCAAAQYLTTAGVGQLTLVDGDTVDVSNLQRQVLHHDA
    RIGMNKAESARQTLAVLNPNCQFEVIPRYLDESSVLSLVAAHGLVLDCSDNLDTRNLLNLTCFQQKTPLVSGAAIRFEGQ
    VSVFRWLQDEPCYHCFSQFFSNSSSANQGQS
    CVEAGVLAPIVGVVGCLQAMEALKLLTNAGIPMSGQLLLIDGLSGQFRS
    MKLKKNSSCAVCGDGARTNSYSEIDTP

    >gi|237808742|ref|YP_002893182.1| hypothetical protein Tola_1997 [Tolumonas auensis DSM 9187]
    MRYLVRILLSATLFLGVAGPGLAAATDPLFINMTTNEEHRSAMAIGFGKSQLDRGHPLTLFLNDKGVLLASKVNAAKYAN
    QQKILSELVAKGAVVLV
    CPTCIKHYNVQESDLLPGLKVSNPDLTGGALFQDNTKALSW

    >gi|237808762|ref|YP_002893202.1| iron-sulfur cluster assembly protein IscA [Tolumonas auensis DSM 9187]
    MAITLSDSAAERVKRFLTNRGKGVGLRLGVKTSGCSGMAYVLEFVDEVHEEDQVFDDKGVKVIIDAKSLSYLDGTELDFV
    KEGLNEGFKFNNPNVKDACGCGESFTV

    >gi|237808771|ref|YP_002893211.1| Rhodanese domain protein [Tolumonas auensis DSM 9187]
    MQHNPRFLALVNEVRQRVDEVDVHQVKRWMEQSRPFVLLDVREESEWNKGHLPSAQYMGRGILERDIETSFPELDTPLVL
    Y
    CGGGFRSVLAADNLQQMGYRDVISMDGGYRGWKDAGYPVEEDF

    >gi|237808820|ref|YP_002893260.1| glutaredoxin [Tolumonas auensis DSM 9187]
    MEPVIIYGKPDCPYCEMAVKFCEERDFAFTYIDIFATGMTVADLQKKVGQPVRTVPQIFVGKKHVGGYTDFYKAVTENLL


    >gi|237808968|ref|YP_002893408.1| glutaredoxin-like protein [Tolumonas auensis DSM 9187]
    METIEKIKQQIAENPILLYMKGSPKLPSCGFSSQASQALMACGVPFAYVDILQNPDIRAELPKYADWPTFPQLWVEGELI
    GGCDIMLEMFQQGELQPLLKAVHAKQTAAE

    >gi|237809059|ref|YP_002893499.1| thioredoxin reductase [Tolumonas auensis DSM 9187]
    MTQVKHSKLLILGSGPAGYTAAVYAARANLNPVLITGMQQGGQLTTTTEVENWPGDAEGLTGPALMDRMKAHAEHFDTQI
    LFDHINAVELQQKPFRLKGDNGEYTCDALIIATGASARYLGLDSEEAFKGRGVSA
    CATCDGFFYRGQKVAVVGGGNTAVE
    EALYLANIASEVHLIHRRDTFRSEKILIKRLYDKVEQGIIKLHLDRTLEEVLGDEMGVTGVRLRNLKDDSVEDVEVMGAF
    IAIGHSPNTAIFDNQLEMQNGYLKVKGGSDGFATQTSIEGVFAAGDVADHIYRQAITSAGTGCMAALDAERYLDSLAK

    >gi|237809073|ref|YP_002893513.1| electron transport complex, RnfABCDGE type, A subunit [Tolumonas auensis DSM 9187]
    MRDLLLIILANGLVNNVVLSRFLGLCSFMGVSNKVSSAIGMAMATTFVLTMATGVGWIIEHAVLVPLGLEYLRLLSFIMV
    IASLVQLTELFIAKQSPELHRTLGIFLPLITTN
    CAVLGVSLLTIQENLNFIQALVYGLSSALGFSLVIILFAGLRQRLEK
    SVLPDLFHGTPISFITAGILAMAFAGFGGLAG

    >gi|237809078|ref|YP_002893518.1| electron transport complex, RnfABCDGE type, E subunit [Tolumonas auensis DSM 9187]
    MSTKNVFTNGLWKENVIFTQLLALCPLMAVTTTATNGLGMGAVTTLVLVASNLLVSLIRSIVPNQIRIPIFTLLIAALVT
    LVDLGMNAWMHDLHKVLGLFIALIVVN
    CAILGRAEAYAMKNPPVLAMLDGLGMGLGFTLSMTIMGGCREILGSGTLFSGA
    SLLLGPHFKFMELHVLPGYHGFLLMLLPPGGFIMMGLLLCAIRISKRLLAGKNAPATTTPATEGGCHV

    >gi|237809186|ref|YP_002893626.1| DsbA-thioredoxin family protein [Tolumonas auensis DSM 9187]
    MPLHRSTNPPPAVRRRRCLHLLLCAVGLLAVLLFALLAVVLRDSPDAAPTPTTQHHPGGPPWRHGQADARFVLTLFADLE
    CPFCKAYYPSLKSWIDQHADVSLQWHHLPLAIHEPAASELARVAECAGETGGHGAFFDAVGWLYQHTRGGGQGLPGGLRY
    PGLTPVLQRCLDSERPQLIVRDQAEQGAHGGITATPSLRLEDRQTERSLLLQGPVEGDALLSAMDLLMGDVPDAAPARAA
    GLSAIDDGDMPR

    >gi|237809240|ref|YP_002893680.1| peptide methionine sulfoxide reductase [Tolumonas auensis DSM 9187]
    MHTRTRMVAPDEALTGRETPMLTEPLHYVKQVSMFPPYPAGLEVAHFAMGCFWGAERLFWIQPGVYVTAVGYQGGFTPNP
    TYDEVCSGATGHTESVRVVYDPAIISYATLLKLFWEQHDPAEGARQGNDIGTQYRSMIFTRTEQQQQLAIQTLERYQAAM
    RTNNDARTITTEITQEKAFYFAEQYHQQYLAKNPGGYCGLGGIGICLPEPDLS

    >gi|237809246|ref|YP_002893686.1| arsenate reductase [Tolumonas auensis DSM 9187]
    MSEVTIYHNPKCGTSRNTLEMIRNAGIEPNVILYLETPPTRDTLVKLIADMGISVREVLRQKCDPYVELGLDDPKWTDEQ
    LLDFMMQHPILINRPIVVTELGTKLCRPSELVLDILPAAQQGAFTKEDGEAVVDAEGKRLI

    >gi|237809314|ref|YP_002893754.1| dihydrolipoamide dehydrogenase [Tolumonas auensis DSM 9187]
    MSNEIKTQVVVIGAGPAGYSAAFRAADLGLETVLIERYGTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPQ
    TDINKIRLWKEKVVTKLTGGLSGMAKQRKVPVVNGVAKFTGPNSIDVTATDGSVTTVKFDNAIIAAGSRPVKLPFIPHND
    PRVWDSTDALELKEVPGKMLVLGGGIIGLEMGTVYSALGAEIDVVEFADQLVPVADKDVVKVYAKRVEKKFNVMLETKVT
    AVEAKKDGLYVSFEGKQAPAEPVRYDSVLVAVGRVPNGKALDAEKAGIAVSDRGFIEVDKQLRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEIAWVGLTEKEAKAKGINFETAVFPWAASGRAIASDCADGMTKL
    IFDKATHRVIGGAIVGTNGGELLGEIGLAIEMGADAEDIALTIHAHPTLHESVGLAAEVYEGSITDLPNAKAKKR

    >gi|237809399|ref|YP_002893839.1| thioredoxin [Tolumonas auensis DSM 9187]
    MSDKIVHVTDASFENDVLNASAPVLVDFWAEWCGPCKMIAPILDEVAGEYAGKLTIAKLNIDQNSGTPPKFGIRGIPTLL
    LFKNGAVAATKVGALSKTQLKEFLDAHL

    >gi|237809433|ref|YP_002893873.1| methionine-R-sulfoxide reductase [Tolumonas auensis DSM 9187]
    MTDWRLKLTPEQFHICREKGTERPFSGALLHNRKTGIYHCVCCDAPLFESNAKFDSGCGWPSFDRTIPDAVRYEEDSSHG
    MRRIEILCANCGSHLGHVFPDGPTETGQRY
    CVNSVSLEFSEEQKTTD

    >gi|237809556|ref|YP_002893996.1| cytochrome c biogenesis protein transmembrane region [Tolumonas auensis DSM 9187]
    MTRYLYLICSCFFLLFMLPLKANEALLQQLIPAAKPQFLPADQAFVVTTQQTDNQLQIILQPAEGYYLYREKIRVDVAGA
    ESAPLSLPAGVLHEDEFLGKTEIYPQTVSTTLSFPAIAAGAKITLHYQGCTTGLCYPPQQTTIALQAFRPALTQSEPVVP
    AAPDSTDTTALLQPGLLALLSFFAMGVGLSLTPCVYPMYPVLSAMLSQHGNTLSWQRGFTLSFVYVLGMALTYTVIGIFI
    ASAGAGIQGWLQNPWLLGIFSLFYLLLALSLMFGNGIQLPRALQDKLQGLANQQSLHSLRGVAMLGALSGLIGSPCTSAP
    LSGVLLFIAQSGNPLYGALTLFLLSLGMGLPLLLMGIFGGKVLPRAGAWMVFIKQLFAVLLLAMPLFLLERLLPAHIATL
    LWSCFVLAVVLWLIWRLWPVTKAPGLKTVTLLLLLSAGIFAATQYEWQPADALPFTAVNNSEELQQQLAAAKAQGKPVML
    DLYADW
    CTACRELDDKTFSDPQVQHSLSDYQLLRADVSANNAEHRALMQELQVLGLPNVLFFDKQSKPSPHLRIQGFIPA
    DELQGKLEQCQHSQLC

    >gi|237809731|ref|YP_002894171.1| NADH:ubiquinone oxidoreductase, subunit D [Tolumonas auensis DSM 9187]
    MTDHNEAKKVLLSPFISNNPIMLQVLGICSALAVTSKMETAFVMALAVTVVTGFSNLFISLIRHIIPNSVRIIVQMTIIA
    SLVIVVDQLLKAFSYELSKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPWLSFLDGIGNGLGYGFILLLVGTIREVIGSGSW
    FGITLFETVNNGGWYIPNGMLLMPPSAFFLIGLFIWVLRTLRPEQQEPTEHGHKE

    >gi|237809732|ref|YP_002894172.1| NADH:ubiquinone oxidoreductase, subunit E [Tolumonas auensis DSM 9187]
    MEHYLSLFVKSIFIENLALSFFLGMCTFLAVSKKVKTAMGLGIAVVVVQAIAVPANNLVFTYVLKENALVQGMDLTFLGF
    ITYIGVIAALVQILEMFLDRYVPSLYSALGIFLPLITVN
    CAIFGGVSFMVQREYNFPESVVYGVGSGISWALAIVLMAAI
    REKMKYSDVPPGLRGLGITFITAGLMALGFMSFSGISL

    >gi|237809757|ref|YP_002894197.1| DSBA oxidoreductase [Tolumonas auensis DSM 9187]
    MKKMFVLLAGLLIAPFLQAAPEFKENVNYEVIRQTNTPKPEVMEFFSYYCPHCYQFEPIMAELKKQLPADVAFKRTPVAF
    LGKEMGPELQRAYAVADLLKAEDKVTPVLFQRIQTERNPPQNRADVRALFEQAGVDGKDFDGAIDSFAVTGMVAQYDRNT
    GSMNIRAVPSTVVNGKYLVKTEGIKSTEEFIALVKFLLAKKD

    >gi|237809858|ref|YP_002894298.1| hypothetical protein Tola_3124 [Tolumonas auensis DSM 9187]
    MDKPVVDIYYCRQCNWMLRAGWMAQELLHTFSEELGSVNLHPDTGGRFEILVNGVCIWERKADGGFPDVKALKQRVRDQI
    APERDLGHVDKKTY

    >gi|237809242|ref|YP_002893682.1| thiamine biosynthesis/tRNA modification protein ThiI [Tolumonas auensis DSM 9187]
    MKFIIKLFPEITIKSKSVRQRMVKILQGNIRNVLQKVDETVTVRNDWDKLMVSSKNDSPENRDKLVERLSCMPGIQAFLE
    VTQVPFTDLHDIYEQTAAVYGPTLANKTFCVRVKRKGKHEFTSIEIERYVGGGLNQNFPSNGVRLSHPDLQINLQIENEL
    LYLVTAIHKGLGGYPLSTQEDVLSLISGGFDSGVASYLFIKRGSRVHYCFFNLGGAAHEIGVKQVAYYLWSKYSQSHKVK
    FVSVPFEPVVGEILEKIDNGLMGVVLKRMMMRAASRVAERMGVEALVTGESVGQVSSQTVTNLSVIDRVTDTLILRPLIV
    SDKQDIIDQARAIGTQEFAETMPEYCGVISNKPTVKARYEEVLANEAKFNFDVLENVITSAKVIDIREIANETEAQVQEV
    ETTSALAENEVILDIRSPDEHEDKPFNPEGMTVIHLPFYKLSTQFGDLDQSKTYLLY
    CERGVMSKLQALYLKEQGFNNIK
    VYRQN

    >gi|237809687|ref|YP_002894127.1| hydroxymethylbutenyl pyrophosphate reductase [Tolumonas auensis DSM 9187]
    MKILLANPRGFCAGVDRAITIVKNALHKFGAPVYVRHEVVHNKYVVDELKAMGAIFVDELDEIPDGNTVIFSAHGVPKRV
    REEARKRGLQVFDAT
    CPLVTKVHMEVHRASRKGQEVVLIGHKGHPEVEGTLGQYDENGTGMYLVEDANQVDSLPVQQPEK
    VSFVTQTTLSVDETRDIIDALREHFPAIQGPRKDDICYATQNRQDAVRALAPQVDVMLVVGSKNSSNSNRLRELAERLGT
    RAYLLDDASQLQDEWFTNVNSVGVTAGASAPEVLVQSVIDRLYQLGGSKLEQMDGVIEDTVFEVPVELRV