Thiomonas intermedia K12 uid48825

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296134561|ref|YP_003641803.1| Dihydrolipoyl dehydrogenase [Thiomonas intermedia K12]
    MRHVHIAILGAGTAGLTALSQVRKHTDDFVIINHGPYGTTCARVGCMPSKALIQAADDFHRGSQLATLGIRGGEGLEVDL
    PAVLQRVRDYRDARVAGVLGATHSLQPVQNIAGRARLDGPGRVIVTHDDGREEIITADRILIATGSRPVVPQAWQAFGNR
    ILTTDDLFERPDLPRRIAVVGLGVIGLELGQALARLGLEVHGFELRASLGPLTDPVIQAEAQHRIGAEFPLHLGRAVDLR
    EGAAGTLIVDNGESPVEVDAVLAAMGRRTNTDGLGLQTLGVPLDARGLPDFDRNTLQIGDLPVYFTGDVNGELQVLHEAS
    DEGFIAAFNALHGAARFRRRVPLAIAFTDPQIAVVGQTWQALQGRSFATGGFNFAQQARAMAMLRAAGQLHVYAEPGSGK
    LLGAEMCVPGAEHLGHLLALALQRNMTVAELLTLPFYHPVLEEGLRAALRVLARAVYGEAPLEMARL

    >gi|296134580|ref|YP_003641822.1| iron-sulfur cluster assembly accessory protein [Thiomonas intermedia K12]
    MSAMLDTAPTAEMAAPPAPLLFTDSAAAKVKELIDEEGNNDLKLRVFVQGGGCSGFQYGFTFDEAVNEDDTQMVKNGVTL
    LIDAMSLQYLVGAEIDYKDGLEGAQFVIKNPNATTTCGCGSSFSV

    >gi|296134644|ref|YP_003641886.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thiomonas intermedia K12]
    MAATADPLQRGFPAPDFHLPGIDGSNYTLAELRGPKGLLVMFICNHCPYVQAVADRMVRDARELRALGVHAVAINSNDVS
    AYPEDSFDNMKLFAAQHGFGFPYLYDETQAVAKAYGAVCTPDFFGFNADLKLQYRGQLDASRKQAAPTDARRDLFEAMKQ
    IAETGIGPAEQYPSIGCSIKWKGEA

    >gi|296134664|ref|YP_003641906.1| Rhodanese domain protein [Thiomonas intermedia K12]
    MKIARRGLPKGWIGAWLFALAAVTSAAQAAVLPGALVTPPWLHDHAKQVQIVDIRDSLGSLTNDPKYATVNGQKVLEEVG
    GHIPDALSVNFWGLRQKHVIDGKKIDFMLPTAKEFEQTMQAVQLEPGKPIVIVPTGDDATSLQEAAFFAWELQVFGVPQE
    QIAILNGGMHAWISAGYDVDTDAIAPMSSSKWKARAPNPALLATTAEVQAAQRAHGLLLDARPLAQIAGLERTPVVPAAG
    RLADASPLPAELLYRNADDGSWRFLSAHVYRKVLAGGGVQRVAPGIVY
    CNTGQYAAGAWFVIDRIMGRKGLREYPGGMNE
    WEQRGLPVVSF

    >gi|296134770|ref|YP_003642012.1| Heavy metal transport/detoxification protein [Thiomonas intermedia K12]
    MNTVQLQVTGMSCGHCVAAVTKALKSVPGTQDAQVDLASGRATVQGSAAPEALAKAVADEGYGVTLKD

    >gi|296134772|ref|YP_003642014.1| heavy metal translocating P-type ATPase [Thiomonas intermedia K12]
    MKAPTSPASDLAACPVDLSDAPTPEPSGKAPDAGQTLRLDVGGMTCASCSARVERALNKLPGVQAASVNLATTQAEVTYD
    PQTATPQAIADAVSAAGYTPIVAETALDVEGMTCASCVGRVERALRKQPGVLSATVNLAVNRAQVRYLPAMLDAQALAQA
    VVDAGYGARPVQEGDAAAEDASAAAHARNLARMRRGLLLAAALALPVLLLSMLPMFWPALDAALLRASPLPSDARFWDWV
    QFVLTSAVLFGPGRRFFRTGAIAYRHLSPDMNSLVATGTGAAWAYSTLVLLAPQWFAAESRHVYFDSTAVVVAVILAGKY
    LEELAKGRASTAIHKLLGLQAKQATRLDAQGAEQQVNLAALHIGDRVLVRPGERIPVDGRVIEGDSHVDESMLTGEAVPV
    RRKPGDRVVGGTVNAEGRLVIEATALGKDTVLSQIVRLVESAQTGKLPVQRVADRVVAVFTPVVLLIAAASFAAWLALTG
    DVSAALVAAVAVLVVACPCAMGLATPAAILVGSSRAAEMGVLFRKGEALEALSRIDTVLLDKTGTVTLGKPALTALHSTL
    DDTAALRLAAALEADSEHPLARAVRDAAAQRGLTPPAVQGFAAIPGYGVRASLDGHTLLLGARRLMEREGISLNTLGEQA
    DALEAQGQTAVFLAQDQTCIAVLGISDPLKPEAVAVVQALRQRGLAIALVTGDARRTAQAVAVALGIHDAPAAEPPQGGH
    LPLPTSPTAWGRSDHSLPASGEGRGGDGPLGGQRAHASVGVSVPAAEPPQGGHLPLPTSPTAWGRSDHSLPASGEGRGGD
    GPLGGQRAHASVGVSVHAEVLPQDKARVVAELQAQGRRVAFVGEGLNDGPALAQADVGLALASGTDVAIEAADVSLTRGD
    LAALPSAIDTARSTLRTIHGNLFWAFAYNIVLIPLAAGIAAPWGVHLHPMLAGVAMGLSSVFVLGNSLRLKRLSPWQAPV
    SRPAAQSPALSPLIHTP

    >gi|296134832|ref|YP_003642074.1| thioredoxin domain protein [Thiomonas intermedia K12]
    MEPLLVACLCAQWCGICRDWRAGFEALATQLPPDVAVRWAWIDVEDCADALADYEPPNFPVLAVQRGDDLVYCAPLPQQP
    ALWLRVLTELARVDGAAARKLAQQAAKGGLPDLRSLV

    >gi|296134937|ref|YP_003642179.1| alkylhydroperoxidase like protein, AhpD family [Thiomonas intermedia K12]
    MTTHQKLEEITSLMTYLNKDYPTETRAFSNFMQKAEGGPALDKRTKELINVALSVAAQCEWCIAIHVKGALEAGASRDEV
    MSAGFMAVLMHGGPALMYLTPTRQALDELGVPGGGAARPAV

    >gi|296135070|ref|YP_003642312.1| Redoxin domain protein [Thiomonas intermedia K12]
    MDQSRRTQLKWFGAALGAVAVPAWAQNVAEQASALEKKDKKAVPLPKEGSEFALPPTVELLGGKTLHTKDWAGKVIVLEY
    WATW
    CPFCARQMPHVEALYTKEHHRGLEVLALSIDKKAADIAPFLKSKNYTFPVAWLSPALAKVLPKPAGLPVTIVIGRD
    GRVKMADSGELFAEDIAGIAKFL

    >gi|296135088|ref|YP_003642330.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thiomonas intermedia K12]
    MDALRLGPIVLPWAPLLLVLGYAVAVWVAGVAQKAGRGNAEPALLPLLIGALVVARAVFVARHSADYSSVLAMIDIRDRG
    FDPWAGWAAAAAGVAFWAWRRPALRMSLPLSASAGAAIVLAGMGALTLLQPARPLLPDLTLQTLQGRSVALASLRGQPLV
    VNLWATW
    CPPCRRELPLLIQAAQQQTGARIVLVNEGEAAPRVAAYLQRERLTDPGVLLDPGNRLLSLYQSPGLPTTLFIR
    ADGTVQRVHIGELSTATLQQGIAALRK

    >gi|296135096|ref|YP_003642338.1| methylated-DNA/protein-cysteine methyltransferase [Thiomonas intermedia K12]
    MKTVLVMDSPLGALQLTAEEDGLTALSFLDDAKPPTAADTPLLQRAREQLQAYFSGDAIAFDLPLRPQGTPFQQAVWRAL
    QTVPYGQTISYALLAQRLGLPASHARAVGAAVGRNPLLIIVP
    CHRIIGHDGSLTGYAAGLPRKQALLDLERAAPISTQTP
    TQTPTPRRPRAA

    >gi|296135186|ref|YP_003642428.1| hypothetical protein Tint_0700 [Thiomonas intermedia K12]
    MVRSRFCFRLLCLGGAAFCLGALPVQAQQQAASPAVQTRVAPDIRAAAQVLAQLHKTTRIREGEGPRVLTVFFDPNCPYC
    RQLYSALRPYVGKDGLQVDWVPVAILAPSSAAKAAAILQAKDRLQAFRATEEHGLDPNRPAPALPGAGQITAATGRILAA
    NVGVLKQAGVYESVPLAVYRDRNGLAQLAMGAPRDQAALRAWLQSIGP

    >gi|296135191|ref|YP_003642433.1| hypothetical protein Tint_0706 [Thiomonas intermedia K12]
    MTLNRRAALRTAFAAVVAASVMGLAPFASAQQTQNPDAVKVLGEMGKATIITEGRGPRVIYIFFDANCPYCHELYTNLRP
    KVGKDGLEIRWVPVAVLTPTSVTKGAAILQAPDRLKAFHENENTYGKGPTGQGGGIAPASKVLPATSAMLNANNALLEAT
    KSPGVPTLLYRDKQGGAMLVVGPPDAQQLKDILASVK

    >gi|296135200|ref|YP_003642442.1| hypothetical protein Tint_0716 [Thiomonas intermedia K12]
    MPSPQSIHRRHLLRVLAVAPLMAAWPAARAQSARQAEGILANISKATFIAEGTGQRALYIFFDPNCPFCHELFKKLRAFV
    GKDGVQFRWIPLGMLTPSSLPKAAAILQSPDPLTAFHKNENDYDFAANGQPGGGIEPTESITPKVRAELAANLALYNSEK
    LFGVPVVIWRKADGRADMMIGVPSDAQIQIMLKQAR

    >gi|296135203|ref|YP_003642445.1| peptide methionine sulfoxide reductase [Thiomonas intermedia K12]
    MTDFNLPALPQRITLAGGCFWCLDAAYRPLRGVLRVECGYSNGTTLRPSYREVCTGQTGHAEVIRLDFDPDVLSLDTVLE
    VFFAMHDPTTLNRQGNDVGTQYRSGIYTHDAAQLAAVRAYVQGLRDQALFTDPIVTEIAPEANYSPAESEHQDYFTHHPY
    QGYCAAVIAPKVDKLRRQYAALLRKDA

    >gi|296135218|ref|YP_003642460.1| UBA/THIF-type NAD/FAD binding protein [Thiomonas intermedia K12]
    MAPGMSLDDRQLLRYSRHILLDEIGIEGQERICAGRALILGAGGLGSPAALYLASAGVGRITLVDDDTVDLTNLQRQIAH
    TEARIGQRKVDSAREAMRQINPSIEVDIIARHADAALLDELVSAADVALDCSDNFATRQALNRACVARGVPLVSGAAIRF
    AGQVSVFDTRRDAQGERGPCYACLFPPDAPVEEVQ
    CATMGVLAPLVGLVGSLQAVEALKILSQTGKTLRGKLLLIDALDT
    DFQTINLPRNPHCPVCGDLHPHG

    >gi|296135221|ref|YP_003642463.1| Rhodanese domain protein [Thiomonas intermedia K12]
    MQFLIENWALVLIALTSGGMLLWSSYGGASGSDGVSAAQAVLKVNREKGVIIDVCEPHEFQAGHAVGSKSIPLGQLDKRL
    SDLPKDKNTPVLIM
    CASGMRAKRAAAQLRKQGFVNAAAVSGGMRSWREAGLPVEKG

    >gi|296135222|ref|YP_003642464.1| glutaredoxin 3 [Thiomonas intermedia K12]
    MNKVRMYTSAVCPYCIRAKALLQKRGVVDIEEIRIDLDPGQRQHMMASTGRRTVPQIFIGDIHVGGCDDLYALDARGGLM
    PLLRDAA

    >gi|296135235|ref|YP_003642477.1| transcriptional regulator, ArsR family [Thiomonas intermedia K12]
    MNSRELKNHLYEQVARIGAAVSSPKRLELLEILAQGEKPVEALAREAAIDIKLASAHLRVLKGAQLVQVRQDGKSRIYRV
    SGADVAALWVALRSVAEAHVADLQVVMQRLFSGPERLTLESSQTLLDKVRKGDAVLIDVRPEAEYRTAHLPEARSLPLPE
    LEARLRELPRSKEIVAYCRGPF
    CVMSDTAVKLLVERGFRARKIAEGVPEWQAAGLPLEQNTAP

    >gi|296135276|ref|YP_003642518.1| thioredoxin [Thiomonas intermedia K12]
    MIDATVANFETEVVEASHTVPVLVDLWAPWCGPCRALGPILEKLEVAYEGRFKLVKINTEEEQELAAAFGVRSIPMVMLL
    KDGQPVDGFVGALPEGQIREFLDKHVPDTAPEQADEAEPSDAEAASAPALPPLEKLQQDLATNPANDNARKAYVELLLKD
    GRTADAKLAFEPIAGKALADARIQALADWLCAAQAAPGLPPVAALQSSIAANKRDFDARYALAQQHMAAQQWTAALDELL
    DILMRDKSWSEDRARKTFVNILELMTPADAPKPAPGQPPVADPTVESYRRRLSMTVLS

    >gi|296135311|ref|YP_003642553.1| glutaredoxin [Thiomonas intermedia K12]
    MSKVKVFSLKETQGRPKFPCPPRGAGWVQSSPGGAQCDHREGFVALSQQWRQFLRLVSLLLLSLTAGAAWAETPLPPVQN
    LQQSALQAAAKDQPLIVMFSLPN
    CPFCEKLRRTQYQFMAKEGYVVQQIEITSRTPVTGFDGKPTTGLQLARQFGIRLAPT
    VLFFGPGGKEIGERITGAPTADFYGAFIDRALKESAQALKAKPGAA

    >gi|296135430|ref|YP_003642672.1| Rhodanese domain protein [Thiomonas intermedia K12]
    MIKQLSVRELADKIEAATAPITDWQFLDVREPWEFQMAAIKHPHCPVTHIPMSIVPLRQNELDQSKPLVVICRSGNRSMM
    IARFLEQNGFGELYNLNGGMTAWSREIDPSVPIY

    >gi|296135522|ref|YP_003642764.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Thiomonas intermedia K12]
    MDLSNASPVSVAADIIETDAVIIGAGPVGLFQVFELGLLEIKAHVIDTLAHPGGQCVELYPDKPIYDIPAVPVCTGQELT
    DNLLKQIEPFGATLHLGQEVTVLERQADGRFLVETTKSTRLLTKTVFIAAGVGSFQPRTLKVDGLDKFEGSQLFYRVRNP
    AQFANKNLVIVGGGDSALDWALHFVQSSENKPESVTLIHRRDGFRAAPASVAQMHALCEQHEMQFLVGQVSGYEENAEGH
    LHMIKVTGNDGITRRLPLDMLLVFFGLSPKLGPIAEWGLEIERKQLVVDTEKFQTSIPGIFAVGDINTYPGKKKLILSGF
    HEAALAAFGAAPFIFPEKKIHLQYTTTSPKLHKVLGVETPVFD

    >gi|296135525|ref|YP_003642767.1| protein of unknown function DUF395 YeeE/YedE [Thiomonas intermedia K12]
    MFSIDWAHFTPGTAILGGALIGAAAGAMALGGGKIAGISGIFGGAINEALQAKRPTPWRLWFLGGLIAASFIWVMFRPVP
    GAHYGESWPVIAIGGLIVGFGTRLGSG
    CASGHGVCGLSRFSPRSMAAVGTFIGMGMATTFVMRHILGGA

    >gi|296135533|ref|YP_003642775.1| electron transport protein SCO1/SenC [Thiomonas intermedia K12]
    MTLPPILSQSRFLSRRLVLLGALALPLAGCGHHNNQTWQLSNITGVMPNLEFNLTNDLGQKVTAENYKGKVVLLYFGYTH
    CPDVCPTTMQLMSNVVQQLGPQGKDVRILFVSVDPKRDSNTILKAYTAAFSPNAVGLTGTIKQIDDLTRRYRVAFSYGKP
    DAQGNYVVDHSAGVYIFGRSGRIHLLGSDTNPPAAFVHDLKQLIADEG

    >gi|296135536|ref|YP_003642778.1| selenide, water dikinase [Thiomonas intermedia K12]
    MNSAPNTPAATAAPRLTSLSHGGGCGCKIAPGVLSEILRKHAPLLPRPEALLVGNESADDAAVYLLNPEQALIATTDFFM
    PIVDDPFDFGRIAATNAISDIYAMGGTPIMALALVGMPIGVVPLDIVGDILRGGETVCAQAGIPIAGGHSIDSVEAIYGL
    VVMGLAHPSHIRRNDSARPGDVIVLGKPLGVGIQSAALKSEALDAAGYARMIANTTQLNTPGKKLALLPGVHALTDVTGF
    GLLGHLLEVCRGSGLRADVRFADVPLIEGVVELANAGQITGASRRNWASYGGEVALADDLPLLAQTLLTDPQTSGGLLVS
    CAPEQVDEVLRVFRNEGFAQAAVIGLLKAGTPGIDVRA

    >gi|296135541|ref|YP_003642783.1| iron-sulfur cluster assembly protein IscA [Thiomonas intermedia K12]
    MSVTLTERAAEQVQRHLAKRGAGLGVRLGIKTTGCSGMAYKLEFVDQASEEDQVFDSHGVKILVDPKSLAYVDGTELDFV
    RQGLNEGFQFNNPNEKDRCGCGESFRV

    >gi|296135550|ref|YP_003642792.1| heavy metal translocating P-type ATPase [Thiomonas intermedia K12]
    MVIMSSSILPLSSAPNQMPKHPAEATGCYHCSLPLGDAPVRMELDGQWRSFCCQGCAAAAEIIVQGGLCAYYDRRTAGEG
    ALAALPREEIDKLHQQWMALADPAFLSAYATSLGEGRWSTQIAVDGIH
    CGACVWLIEQRLRAIPGVLAATVNYSTRRVAL
    QWDANTVQLAQVFQALAEVGYRPLPNARHQSELNHRRARRLAILRTLVAWLAMMQVMMFAWPGYLDAEGLNAAEQGIFQW
    GSLALTLPALLFSGWPFLMGALRDVRNRRLGMDVPVTLGLWSAFAASVWSVLHGQSHVYFDSVVMFLALLLTARLSEDGL
    RQRSLNAAEELMEQLPAAVRVRASGEEDWRSVAITQVRAGDEVELPSGSAAAVDGVVISGASLVDEALLTGESHAVPKQA
    GDAILAGSMNRQSPLIVRATQTGAGTRIAQMVELMQHALASKPRSAQLADVAAQWFTLGLLAVAALTVLLWWWLDPARIV
    PTLVAVLVVSCPCALSLAVPAALAASTAQLSRHGVLLARGHALDRAPQVDLWLFDKTGTLTTAEPVVSAVRLLDPSYSRE
    QVLALARALEQGVQHPLARAFMASAAQGDAVEAVQDLRAVPHGGMQGLWQGQTLRLGHAAFSGVAQAQPPEASDIPLTRL
    GLSLDGRALAVFDIAETLRPGAQEALQSLQAAGAEVAVLSGDAVRTVQAWATRLGVARAEGGLSPEDKLERVRQWRAQGR
    VVAMVGDGVNDAPVLAAADLSVSFAGAAPIARAGADVILHHPDMRALPRLVATGRRTVGVMRQNLIWAVVYNLLAIPLAV
    AGFITPVWAAVGMSTSSLLVVLNAARLARRDRAAPNL

    >gi|296135821|ref|YP_003643063.1| dihydrolipoamide dehydrogenase [Thiomonas intermedia K12]
    MSSEFDLIVIGAGPGGYIAAIRAAQLGLNVACIDAWRNAQGGPAPGGTCTNIGCIPSKALLQSSEHFEQAGHDFAAHGIG
    VSGLSIDVPVMQQRKAQVVKQNNEGILYLFKKNKVTFFHGTAALKGGNADAGWQVAVTGKDAEQVLSAKQIIVATGSVPR
    SLPGLDFDEQRVLSNDGALSIDAVPKTLGVIGAGVIGLEMGSVWRRLGAQVTLLEAMPDFLAAADAQVAKEALKQFTKQG
    LAIHLGAKITATKVLKNGVTVDWTNAKGEAQTLKVERLIVSVGRKPNTDSLGAQTIGLQLDERGFIQVDADCRTNLPGIW
    AVGDVVRGPMLAHKAEEEGVAVAERIAGQKPHVDFNTVPWVIYTAPEIAWVGQTEQQLKAAGRAYKAGSFPFMANGRARA
    LGDTTGFVKMLADVQTDEILGVHIIGPMASELIAEAAVAMEFKAASEDIARICHAHPTLSESLKEAALGIAGRTLNF

    >gi|296135963|ref|YP_003643205.1| methylated-DNA/protein-cysteine methyltransferase [Thiomonas intermedia K12]
    MPLTQNPAHPDAVIALPFGRMGLFCTDDVVLHLEYLPPETPLTPPSTPLCRAVAAQLSAYGDDPAYRFDLPLAAAGTEFQ
    RRVWALLQQIPPGQTRTYGDAALELHSAARAVGQACAANPFAPVVP
    CHRMVAQGGLGGFAHSTAQDGYLLGIKRWLLQHE
    GSSRSARRHA

    >gi|296135964|ref|YP_003643206.1| protein of unknown function UPF0061 [Thiomonas intermedia K12]
    MTSAALDFPAPAPPASRPWPPLAQQFAALGDAFSVPVAVSPLPDPVLVASSADAAALVGLTAPTTPQDEQDWARAFGGHV
    AAISGGSRATVYAGHQFGNWAGQLGDGRALLLGDWPDASGGRHSGGYARWEVQFKGSGRTPFSRMGDGWAVLRSSIREFL
    CSEAMAALGIPTTRALCLVGSSRPVRRERIETAAMVTRLSPSFVRFGHFEHFSYSGQTEQLRALTDWVIAQYCPDCANAP
    QPALALLQWVVARTARLIARWQAVGFIHGVMNTDNMSILGWTIDYGPFAFLDAYDPLHTPNTTDRGGRYAYGRQPAVAHW
    NLLALGQALLPLIDKPESALAAVDQFRPQYVQAMQQQLAAKLGLTAPQPNDGDLFQDLLDTMAANRSDWTLSFRHLAQLA
    ADAHAPIPPALAAQFAREPQRFGDWVARYRERLRAEGRDDAARAVAMNAVNPLVVLRHHLAQAAIAQAEVGDFSEVHRLL
    HALTRPFDAHAAPPHYAEPPPEHAPPACLS
    CSS

    >gi|296135965|ref|YP_003643207.1| methionine-R-sulfoxide reductase [Thiomonas intermedia K12]
    MSKPTPEDTNDALWRSKLSEEQYRVTRCSATEPPFTGLYWDHHGDGVYRCVCCGTPLFDSHTKFESGSGWPSFWQPTSQA
    VIREVRDLSHGMVRTEVQCGQCGAHLGHVFPDGPNPTGLRY
    CINSAALDFSERQAGGEEGEEGATERS

    >gi|296136067|ref|YP_003643309.1| Mercuric transport protein MerT [Thiomonas intermedia K12]
    MSQSRPPHAPTGRGALFAGGLAAILASTCCLGPLILLSLGISGAWIGNLTLLEPYRPIFIGAALIALFFAWRRLFRAPAA
    CKPGEVCAIPQVNATYRLLFWIVAALIVVALSFPYVAPLFY

    >gi|296136068|ref|YP_003643310.1| mercuric transport protein periplasmic component [Thiomonas intermedia K12]
    MNKLLTAIAAACVFSAPAWAAEQTVTLAVPGMTCGVCPITVHKALTAVPGVEKVSVDEMKKDAVVTFDNAKTNVKTLIKA
    TTDAGYPSTVVQ

    >gi|296136069|ref|YP_003643311.1| mercuric reductase [Thiomonas intermedia K12]
    MEILSISGMTCNACAAHVKSTLESLPGVKSAQVSYPLGTAEVVADDSISFDAMAAAVAKAGYAAKQADRAPTPSYGSTDL
    ARSTHPARGDASGLRIAVIGSGGAAMAAAIKAADSGARVTLIERGVIGGT
    CVNVGCVPSKIMIRAAHIAQLRRRSPFDAG
    IPPTSPAILRDKLLAQQQARVDELRHAKYESILDGQPAIATLRGAARFQDARTLAVTLHDGSSRQVSFDRCLIATGASPS
    IPPIAGLKGTPYWTSTEALEADTIPPRLAVIGSSVVALELAQAYSRLGSQVTLVARNTLLSRDDPAIGEALTAALREEGL
    TVLTHAQVGAVAYADGCFALTTNQGEIRAERLLVATGRAPNTAALDLHAAGVQCDARGAIVVDDHLRTNVPHIYAAGDCT
    DQPQFVYVAAAGGTRAAVNMTGGEATLDLSAMPSVVFTDPQVATVGLSEAQAQRQGIQTDSRTLSLDNVPRALANFDTRG
    FIKLVAEAQSGRLLGVQAVAAEAGELIQTAALAIRNRMTVQQLADQLFPYLTMVEGLKLAAQTFTKDVTQLSCCAG

    >gi|296136076|ref|YP_003643318.1| Disulfide bond formation protein DsbB [Thiomonas intermedia K12]
    MNQRQGGALPALAAATALGTLGGALWLQRMGFAPCPLCILQRMAYLGVLIFSLSAISLIRSNARLAARVVLGFGVLSGLV
    GLGFAARHIWLVLHPGQL
    CGLDPLAAVINHWPVTQWAPWMFRADGLCADTPSVFGLALPFWSAAGFVLASALLLAAMWRR
    ASPPTR

    >gi|296136080|ref|YP_003643322.1| Rhodanese domain protein [Thiomonas intermedia K12]
    MSSHYTTLITASELASLQDAFIVDCSHDLAQPEAGQQAYDQAHIPGAIFLHLDRDLSSPKSGHNGRHPLPDADAFAARLA
    QLGLRQNQQVVAYDRTGGSFAVRLWWMLRWLGHDAVAVLDGGWQAWTAAGGASEGTAPAARAPGDFSRRPALVGAVPARG
    VLDNLHSGKHLVLDARAPERYAGEVEPIDPVGGHIPGAKNRFFQTNLQPDGTFKSREQLREEFTALLEDWDPRDVIHH
    CG
    SGVTGCHNLLAMTYAGMDGSLLYPGSWSEWCADPARPVATGRTPGKV

    >gi|296136156|ref|YP_003643398.1| fumarate hydratase, class II [Thiomonas intermedia K12]
    MNRNGNTTQQLTEPSEGNRIETDSFGPIEVSEAHLWGAQTQRSLQHFAISTEQMPREFIRALALVKRACAGVNAELGKLD
    LRTAQAIIEAADEVIAERYPDEFPLAVWQTGSGTQSNMNMNEVLANRASVLLGGGVGLARSVHPNDQVNMGQSSNDIFPT
    AMHVAAAAQTVQYLLPALIALRTTLQTKAESFADIVKIGRTHLQDATPLTLGQEFSGYVAQLDLARRAVDAALGPVYALA
    VGGTAVGTGLNTHASFGVRVATELARQTGLPFTSAENKFAALAGHEALVFLHGALKTLATALMKIANDVRWLASGPRSGL
    GEIRIPENEPGSSIMPGKVNPTQCEALTMV
    CAQVFGNDVAINIGGASGNFELNVFKPLIAHNVLQSLRLLADAMNSFDHH
    LARGIEADRARITELMQRSLMLVTALAPHIGYDQAASIAKSAHHSGSTLREAALASGLVSAEDYDRWVRPQDMVRTS

    >gi|296136199|ref|YP_003643441.1| thioredoxin [Thiomonas intermedia K12]
    MASELIKHTNDADFEQDVLKSGVPVLVDFWAEWCGPCRMIAPTLDEMASEYQGKLAIMKVNVDENRSIPAKFGIRGIPTL
    LLFKNGELAGNKVGAASKSQLTAFVDAHL

    >gi|296136265|ref|YP_003643507.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Thiomonas intermedia K12]
    MALEFSTPLTALSDDVDVLVLGAGGAGYPGAFFLAKAGRSVLMVDPIGNLGGDCLAEGCVPSKAVREAALVRGLADKFDG
    FGLRGSKPTVDWGAVLAHKDRVQNTRYEQHAREIAAGGVAFVQGRGVIVAPDRARIDAGDGSGSREVRFRQLILGTGSAP
    ARLPILGADLALTSHDLFRLGADLPLPQHLVIIGGGYIGVETASMLQALGAQCSILEYAPQVLPGFDAELASFLHASLSQ
    RVRIECSAQVLSIARDGDGYHVRYKQGGGERSLQGDAVLMATGRVAVLPEGVEHLGLAMERGHVKVDDTLRTSNPQVWAP
    GDINGRSMLFHSAVRQSLVAAHCIAAGGQAVDRMPFHAVPMTVFTEPELAHAGQTAAQAEAALGADAVAVMRYDYAEDSR
    AQIYAETQGFIKLVFNRHDARLLGAQIAGMDAAQLIAPLALALEQGLGAKALADTVFPHPMLSEGINKAARAFKL

    >gi|296136279|ref|YP_003643521.1| alkylhydroperoxidase like protein, AhpD family [Thiomonas intermedia K12]
    MTESPMRERLHEVESLLSTLGKSHPNEVQAFMNFMGKAESGPALSGKQKELVNVALSVAAQCEWCIAFHVKQAAHAGAKR
    DELIEAGFLAVLMHGGPAMMYMTPLLKALDEFGLPAAVQV

    >gi|296136528|ref|YP_003643770.1| Rhodanese domain protein [Thiomonas intermedia K12]
    MKLKHLIGMSIIAVAAAQTAGAATLPGPLVTPQWLNANKDAVTIIDIRDEPKTFTEAPKFEVDPKTKVKTLVKTGGHIEG
    AIPVDFGKIRQERTVDGVKIKAQLPTAEYFTKVMDDSGLNKTDKPIVIVPTGESVDSMDMATRLYFQLRYFGEPRDKLAI
    LNGGVNAWIQAGYPVSTDKVTPTKGDWAAGAEDKAILASMQQVKEGLQGGKDQFIDARPTAQFLGIVKKPINKTAGHLPG
    ARSFPTDAIVKPVGAAHEFMSADDYKKIYAEFNIQPDAQTITY
    CNTGHLASGAWFVSHEILGNKNSKLYTGSMIEWTNLG
    NPTVGLPQ

    >gi|296136554|ref|YP_003643796.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thiomonas intermedia K12]
    MALVLNKVVPDFEAAATSGVQFSPKNYLGKKIVLYFYPKDMTPGCTTESMHFRDNFEAFEQANAVIFGISRDNLLSHEKF
    KEHLELPFDLIADTEEKLCHMFGVVKNKIMYGKKVKGIERSTFVIDADGVLRQEWRGIKVAGHVDEVLDVIQKL

    >gi|296136629|ref|YP_003643871.1| alkylhydroperoxidase like protein, AhpD family [Thiomonas intermedia K12]
    MNDSVHNGMDVSMRDFKMGMGMMNREAASTMKAFGAFMGEALGDGVLDAKTKELIALGMAITARCVYCIGIHVEKSLRAG
    VSHAEIVEVCKVAIVMGGGPAMTYIAEVKKALDLFEQVHA

    >gi|296136634|ref|YP_003643876.1| Glutathione S-transferase domain protein [Thiomonas intermedia K12]
    MMVLYSGTTCPFSQRCRFVLFEKGMDFEIRDVDLFNKPEDVSVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PGDPVARARVRLFLFNFEKELFVHVTTLESRATKSNEKALEKARSAIRDRLTQLAPVFLKNKYMLGEDFSMLDVAIAPLL
    WRLDHYGIDLPKSALPLAKYAERIFQRPAYIEALTPSEKIMRK

    >gi|296136742|ref|YP_003643984.1| dihydrolipoamide dehydrogenase [Thiomonas intermedia K12]
    MAIIEVKVPDIGDFKDVEVIEVLVKAGDQIAVDQSLVTVESDKASMEIPSSAAGVVKALRVKLGDKVSEGTVLLELDAAG
    AQASAETTPAPPAPAAAPTNTAPRTSPAPQAAAAFSGKVDVECDVLVLGAGPGGYSAAFRAADLGLKVVLVERYAALGGV
    CLNVGCIPSKALLHVAAVMDEAAHFADLGVEFDAPKVDRAKLAAHKAKVVGKLTGGLAAMAKMRKVTVVRGYGAFIDAHH
    VQVELTEGEGQNKTGATQTVGFQRAIIAAGSQAVRLPFLPDDPRIVDSTGALTLEQAPKNMLIVGGGIIGLEMGTVYSTL
    GARLDVVEMLDGLMPGADRDLVKVWQKLNAKRFDRMMLKTKTVAAQAKPDGIWVTFEGEGAPTEPQRYDLVLQAVGRAPN
    GRKIAADKAGVAVNERGFIPVDAQLRTNVPHIHAIGDIVGQPMLAHKAVHEGHVAAEVCAGELKGDDALAKSAFDARVIP
    SVAYTDPEIAWVGLTEDAAKAQGIAVTKGLFPWTASGRAIANGRDEGFTKLLFDKATHRIVGGGIVGTHAGDLISEIALA
    IEMGADAVDIGRTIHPHPTLGESVGLAAEAAEGSCTDLPPPRR

    >gi|296136749|ref|YP_003643991.1| glutaredoxin [Thiomonas intermedia K12]
    MKRLTKRTSRHALVFSAALALGLTAGTPAWAIYKIVGPDGSVTFSDVPPSSTQGKAVQSLSANGNAKPSSFVGFPAALRE
    AARKYPVTLYTAPQ
    CEACDAARDYLQQRGIPFAEKTITTNADIKAYKALSNGSDQLPLVIIGSTKLSTGFSSSNWDIALD
    AAGYPKKSELPRDYVRPQPVALVPPPAQKASAPEQKRVPTEPSVLPPPNPNAPKGFQF

    >gi|296136786|ref|YP_003644028.1| arsenate reductase-like protein [Thiomonas intermedia K12]
    MNTSPVLTVYGLNQCDTVKRARQWLQAQCVDFQFVDFKKTPPSAAQISAWAEAVGWEALLNKRGTTWRKLDAATQARVVD
    ATSAVAVLAEHPSAIKRPVVETGGQLLVGFDEADWRAALSPFLPPFS

    >gi|296136788|ref|YP_003644030.1| alkyl hydroperoxide reductase, F subunit [Thiomonas intermedia K12]
    MLDDTLLSQLKAYLERVSQPFTLVASLDDSENAAQMRTLLEQIASLSDKISVRFDGTDARRPSFALERVSGPAQHLRFAA
    IPLGHEFTSLVLALLWTGGHPPKVEAETLEAIRQLDGDYRFEVYMSLS
    CHNCPDVVQALSLMAVFNPRVQTVVIDGALYQ
    SEVESRQIMAVPTVYLNGELFGSGRMDVEEIVAKLDSGSAQRDAAKLNAKAPYDVLIVGGGPAGAAAAVYAARKGIRVGL
    AAERFGGQVNDTLAIENYISVLETDGPKFGMALEAHVRQYGVEILNQQRAEKLIPAEHQGGLIGVQFAHGGRLQARSVIL
    CTGARWRNVNVPGEAEYRNKGVAY
    CPHCDGPLFKGKRVSVIGGGNSGVEAAIDLAGLVAHVTLLEFAPELRADAVLVSKL
    RSLPNVTIHTNAQTTEITGDGSKVNGLTYTDRASGASHHLELEGVFVQIGLVPNTEWLKGVVELSRFGEIVVDAKGQTSV
    PGVMAAGDVTTVPYKQIVIAAGDGAKAALSAFDYLIRTPAAQMAEAVAA

    >gi|296136789|ref|YP_003644031.1| peroxiredoxin [Thiomonas intermedia K12]
    MSLINTEVKPFKATAFQNGKFFDVTEASLKGKWSVVVFYPADFTFVCPTELEDLADNYDTFKALGVEIYSVSTDTHFAHK
    AWHDTSEAIKKVNYPMIGDPTGALTRNFDVMIEEEGLALRGTFLINPEGVIKLCEIHDNGIGRDAKELLRKVQAAQYVAS
    HPGEVCPAKWKQGAATLKPSLDLVGKI

    >gi|296136805|ref|YP_003644047.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thiomonas intermedia K12]
    MNKVNIWISAAIILLIAAVLGNAWFQRERSVPIAVENNAVKSFFADKLDDLQGKSIDLSQYRGKPLVINFWASWCPPCIA
    EMPDFSKFYQQNKDKGIEMVGIALDNPTAVRNFLKEHPVSYPILLGGMNGIALSTSLGNKQGGLPFTVVLDGKGDVVFQK
    LGKTSLDELKEAVPSGH

    >gi|296136833|ref|YP_003644075.1| protein of unknown function DUF395 YeeE/YedE [Thiomonas intermedia K12]
    MNSIAQWFPLGWEPFLYGGIFIGLGVSVLFWLTGLIGGVSTAYTAVWSLVSRHPFFQHEKFISTRNWRLMYGLGLIVGAV
    VFTYTLGHGEGFVTQVPLWQLFLGGIVGGFGARMGGG
    CTSGHGICGVGSGQLPSILAVIIFLCTAVITAHVVRALGGF

    >gi|296136854|ref|YP_003644096.1| thioredoxin reductase [Thiomonas intermedia K12]
    MTSKHAKVLILGSGPAGYSAAVYAARANLNPLLITGLAQGGQLMTTTEVDNWPADVDGVQGPDLMARFQAHAERFNTEIV
    FDHIHTAHLREKPIRLEGDSGVYTCDTLIIATGASAKYLGLPTEEAFMGKGVSG
    CATCDGFFYRNQPVCVVGGGNTAVEE
    ALYLANIASKVTVIHRRDKFRAEPILVDKLMARAAEGKVELKLWSELKEVLGDASGVTGVRIHNSQTGADEDIALNGCFI
    AIGHQPNTEIFKGQLDMKDGYIITRSGNEGMATATSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRYLENAES

    >gi|296136889|ref|YP_003644131.1| protein of unknown function DUF395 YeeE/YedE [Thiomonas intermedia K12]
    MSSASVPAINATVLWAGFALSLVFGAIMQRTRFCTMGSVSDIVNMGSWMRMRMWVLAIATATIGFNLLAATGQIDSAQTI
    YTTSRVLWLSALVGGVLFGFGMVLASG
    CGSKTLVRIGEGNLKAVVVFVMIAIFAYITLRGITAEVRVRVFDKVAFNLSGP
    QDLPAIFAHATGLPLADLQLVLGLGVGLLLGVWALSAREFRTANNLLAGFGLGAVIVAVWFVSGKLGFLAEDPQTLQAAY
    IGSQNNKMESLSFVAPLAYTLFWFMMYSDASNVLTLGIVSVFGVIAGSAGMALITRQFRWEGFRGAEDTANHLVGGALMG
    IGGVTALG
    CTIGQGMSGVSTLSITSWIAFLSIVGGAVLGVKYQAWRVERTA

    >gi|296136894|ref|YP_003644136.1| alkylhydroperoxidase like protein, AhpD family [Thiomonas intermedia K12]
    MSTSPVYPQADRELTQMRQNHAPNQFAAFQQFSQQAFAKGALDVRTKQLIAVAVAHVTQCPYCIRGHTKAALKAGASREQ
    IMEAVWVAAEMRAGAAYAHSLLALDTMREEDAKADSA

    >gi|296136930|ref|YP_003644172.1| glutathione peroxidase [Thiomonas intermedia K12]
    MHRTTLNPISRFAAAALLALGAQLFSPSASAAQSAPAASATCPALLNQTFPRLQDDKPESLCQYAGKVILVVNTASYCGF
    TPQYKGLEALYREYGKQGLVVLGFPSNDFHQEMDNNAKIAAFCKDTYNVQFPMFAPSHVTEPKPNALFEQLILATGDQPK
    WNFYKYLIGRDGKVVGVYPSLVSPDNKDFVAKIKTLLAQKP

    >gi|296136943|ref|YP_003644185.1| protein of unknown function DUF255 [Thiomonas intermedia K12]
    MVSQHHPSGRSGWIAWLRGAALCFLFAVGVAAQAASPRTNHLADSHDPYLLEHAHDPVDWYPWGAQALEKARRENKPIYL
    SIGYSA
    CYWCHMAQRELYRNPQIAALMNRWFVNVLVDREQRPDIDHIYMLARQIMTRDSGWPNNVFLTPDLQPFYIGSYF
    PSKATAQQEGFPTLLATLHKNWTQHPAEVKRIAAQIAQAMQAAAIAGDASAPIDPAAWTQTAQAEALHRFDALDGGFASA
    TAAARFPQPPLLAWLLARGGTGEPKATHAVVFTLQAMAQGGLMDQLGGGFRRYAVDPGWSVPHFEMMLSDNAQLLSVYAR
    AYAQTRRPDLRWTAQRTAGFLLRDLRLPQGVFATAIAAETGGVEGATDLWTTAQIDGVLGPWQAQAWFALYALTPVHPGS
    ESGVLRQRRDVAEHLLRQGQWVARLEQLAPQRRALLAARNHRPQPRRDDKIVTADNAMAIRALAQAGMVLDDRALTEAAV
    RAADWEWQHAWKAHQRLLVHQWAGGHVGNPGFLDDYAELARAYLTLASVQHDARWSQRASDLAAAMLQRFAAPDGSLRSA
    PTSDALPFPTPLQGDVHRPSGQSAAIAALLELAQRTGQAHWADAARRALRPLALQVQARPLDWPDLLQTLGSAAGRAVFA
    SPQQTARIRPADCAGLPQGACSSDRVQVKWLASDRMQLHIAPGFHINANPASEPNLIAATVLVGGQPLPGVRYPPPQQFR
    LTFAPRGIAVWQGRVTLDLPALSPAQRAALALRVQACNATTCLAPSVMPISAPTSSPPQPSPQVGRE

    >gi|296137035|ref|YP_003644277.1| Protein-disulfide reductase [Thiomonas intermedia K12]
    MRHSIPSTSRAPRFWAGLSRALLGFFLLWAGVLQPVAHAQQADFLPPDEAFQFTAKVQDAKTVLLQFKAHDGYYLYQERF
    HFESQTPGVELGKPEFPPAHKIFDKNLGHEVFHYRGLVPIPLPVLKAPATFKMLVTYQGCADAGLCYPPIEKLATVSLSG
    FGGNGTVSISEPDDDSGSAPAASGSGASGLVQGLMAGASAAQPAAASASATTAPAPAATASAVAAPAAAAAVAQGGDSSR
    IGQALASGSLLSIIPMFLVFGLLLAFTPCVLPMIPILSSIIVGQGDKVSRGRGFALAVAYSLGMAIVYTAFGVAAGLLGQ
    GLAASLQNPWVLSIFALLLVVLSLSMFGFYELQVPSSLQSKLSSTSDKMQGGHFAGVFIMGGISALIVGPCVAAPLAGAL
    LYISQTGNALIGGVALFSLAAGMSVPLLLVGLGAGTLLPKAGGWMDGVKAFFGVLLIATALYMIAPVLPTWLLMVLWALL
    LLISASFLRVFDRLPDEVSGWKRVFKGFGVALAVAGAALIVGLAAGNRNLLQPLAGLGGGAAGAVSAAPSVQFQRIHTVA
    DLDRVVASSSKPVMLDFYADW
    CVSCKEMEHFTFTDPAVAQQLAGFTLIQADVTNNTADDKALLKRFQLFGPPGIIFFKSG
    KEVGRVVGFEDAKTFLASMKRAGV

    >gi|296137060|ref|YP_003644302.1| glutaredoxin-like protein [Thiomonas intermedia K12]
    MSSVQEQIDQIVKNNDVVLFMKGSPQFPMCGFSGRAVQLLKSCGVSQIKAVDVLQDEGIRQGIKEYANWPTIPQLYVKGE
    FVGGSDIMAEMAQSGELQALLGSLK

    >gi|296137076|ref|YP_003644318.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Thiomonas intermedia K12]
    MKHHVIIGNGPAGVVAAETLRKHSATEDTITLIGDEEGPPYSRMAIPYLLHGDITERGTWLRKDPQHFRQIGVSQRHARV
    KSLDAARKTLTLESGETLSFDTLLIATGSTPTLPRIPGIHAQRVHT
    CWTLEDARAITQFAVPGARVIQLGAGFIGCIIME
    SLVRRRVQLTVVEMGDRMVPRMMGETAGGMIRDWVQDKGVTVHTGARIESIESNPSDMAAPLAVRLSTGERLPADLVISA
    AGVKPNIGFLEGSGVHCLQGVLTDEHLQTNVPGIFAAGDCAEAFDMLYGKPMVSAIQPNAVDQAYVAAMNMAGRRTQLRG
    VTQINVLDTLGLISSSFGQWQGVKGGQGVELTDRAGYKHLSLQFEGDVMVGSNSIGTTQHIGVLRGLVEGRVKLGAWKDR
    LLADPTRLMEAYLASAQAQDRRGDTVHH

    >gi|296137129|ref|YP_003644371.1| Disulfide bond isomerase, DsbC/G-like protein [Thiomonas intermedia K12]
    MNSSLSRSVARVLRGVALSAAFLSLPVMAQTLAETRAALEKAMPGLPASAKIIKTPYAGLYEVDVGSKIFYTDAKATFLF
    AGEIFDTKTQTNVTKARIDDLRRVNWKDLPFKDSFKLVFGNGKRQIAIFEDPY
    CPYCHKMEATLEKMSNVTLHVFVVPII
    RRESMQQARDIWCAPNRSKAWLDWMNKQVQPPAAAATCVDPLKANVELAEKLGISSTPTLIFTDGDRMEGALPQEEVEKK
    LAAVK

    >gi|296137177|ref|YP_003644419.1| DSBA oxidoreductase [Thiomonas intermedia K12]
    MFQRWLTVVFMVFSMGFLAAGAQAQTPAKSSPFNEGFAYNRLAVPQPVSPSDKIVVYEFFWYDCPHCADFDPLLEAWQKK
    LPAGVVLERVPVAFSPQFVPQQHLYYALKALGKLDDAMQAKIFNAIHKQHIPLGTADQMANWLAQQGIPKKAFLDAYNSF
    GVNAQVRQATQMVTDYQISGVPTMAVQGTYTTSAALPEANNNKKVLEVVDYLIKKVQAEKK

    >gi|296137195|ref|YP_003644437.1| Redoxin domain protein [Thiomonas intermedia K12]
    MATTHLQGNPVPTSGELPAKGSKAPDFRLTDKDLADRTLADFAGKRKVLNIFPSIDTPTCAQSVRTFNARASDKVDTVVL
    CISADLPFAQARFCGAEGLDKVVNLSEMRDRSFAQAYGVGIAGGPLAGLCARAVVVLDKDNTVLHTELVNEIAHEPNYDA
    ALAAL

    >gi|296137222|ref|YP_003644464.1| Redoxin domain protein [Thiomonas intermedia K12]
    MKPLSKSLIAVIVLAVLAVGGYLGWSALDQKPDAPNASFSLLDGKTVDLSAYRGKVVLVNFWATSCTTCVGEMPELVKTY
    DQLNPKGFDLVAVAMSYDNPEFVRNFVQQRQLPFTVAFDASGQTAKSFKDVRLTPTSFLIDKSGHIVKQYVGTPNFAELH
    QLIDNLLARQA

    >gi|296137254|ref|YP_003644496.1| Peroxiredoxin [Thiomonas intermedia K12]
    MEQTTENFGLPRLNEPAPNFNAVTTHGPRTLADYKGKWLILFSHPADFTPVCTTEFMGFAREAETFKSMNCELLGLSIDS
    IFAHLAWVRSIKQHFGVDIPFPIIEDLKMEVARAYGMIHPGAADTQAVRATFFIDPNGILRAMVYYPMSNGRSINEFVRL
    LQALQTSDKHGVATPEAWCPGDKVIVPPPKTSAAAEERVSKGAAQGMEVTDWYFSKKTL

    >gi|296137259|ref|YP_003644501.1| Rhodanese domain protein [Thiomonas intermedia K12]
    MRCMNTPPPAPSSLHPPRRSAWSRLCRICALGWLLAAWALQQGVSAAPSAPGTAQTFGPLISAQALATQPTQVRIIDLRD
    DAAAANVAHIPGALPAPYADWRGPSSNPGQLLPLPRFTALVRRLGLNAETPVVLVASGDDPSDFGAPARVYWTLKWLGLK
    HLAILNGGMTAWQAAALPLTRQPTPAPTPSAFTPQLDDALLATQPEVAHDLGHPSTLLLDARPKAFYLGREKAPAASRPG
    TLPGALDFDNLLWFEPGSGALPAVSTLQRIAAQLPQQPGAVQTVSF
    CNTGHWAATNWFVLSEVLHRPHVALYPGSMVDWS
    RADAPMAHVPTRWQQLWQQLEQTWQAL

    >gi|296137260|ref|YP_003644502.1| protein of unknown function DUF395 YeeE/YedE [Thiomonas intermedia K12]
    MASTLNSALHTTAAQTINQGQRRLGRSLLMLGGLAGFAAITWLVGWRQGLLWLIGLGYGVLLSTAAFGFTTGWRVWITRR
    DPVGLWAQFVGIAVAMLISVPLLAAQPALQGADGPLSISLLIGAFVFGAAMQVADG
    CGSGTLYKAGLGHPVSLAVLPAFV
    FGSFLGAAQLPAWLTLGALPPVNLVHRLGAAETLIVQLAALALLAALLWRFRGTQPSRWHGPAVWWAAIGLGLLAAANLV
    VAGQPWGIVYGLGLWGAKIVQALGFDLSHNAFWGLPAQQAQLHATVLADNTSVTDLGLLLGALIAASWRGKASPAVSLPA
    RQWLASVVAGLLLGYSSRLAFG
    CNVGAYFSGIATGSLHGWVWFACAFVGSLVGVRVRHRLGMAD

    >gi|296137318|ref|YP_003644560.1| Redoxin domain protein [Thiomonas intermedia K12]
    MQSLTVFLRRVGAAIVFCAACAPASWAAGFTFTPYPTAHKLPLSQVTFENAQGKHMTLADFKGKVVLLNIWATWCPPCVH
    EMPTLDKLQKLLGSKNFAVVPLSVDKGGIYTVKSFYDDNFISHLPIYVDPTTQVLDTLSILGTPTTILINKQGEEIARTM
    GPEDWDKPAVIAQIKHYMAAPAGSEAKPPQQARTVEIRDTRVATAATPTVAAPQ

    >gi|296137388|ref|YP_003644630.1| Rhodanese domain protein [Thiomonas intermedia K12]
    MKLAKTLIAAAIGMGAAHAAFAMNVPGPLVTPQWLKAHQSEVTVIDIRGGGSMKAYDEEPVMGKDHFVKKSGGHIAGADL
    VNFNDIREERTVDGVKLKAMMPTAEYFTKVMDAAGVNSGKPYVIVPTGNAVFAMDRGTRLYFQMRYFGVPADQIAILNGG
    TNAWINAGYPVSIKPAPKKMGDWKATGEDKALLAGLNDVKEGEKSGTEQFIDARPTAQYLGIAKKPINKTAGHLAGAKSF
    PIDAIVKDDHGAAMFMSAADYKKIFHDFNISDTAPTTTY
    CNTGHLASGAWFVVHEILGNKNSKLYAGSMNEWTNLGNPTV
    GLPG

    >gi|296137451|ref|YP_003644693.1| thiol-disulfide isomerase and thioredoxins family protein [Thiomonas intermedia K12]
    MINIKILGTGCASCKSTQRLVEEVVAAKGVQAQVEKVEDIPSIMQYGVMRTPGVVIDGKVVHAGGVPNRAMVESWISA

    >gi|296137468|ref|YP_003644710.1| Rhodanese domain protein [Thiomonas intermedia K12]
    MPLSQSFAAYLRRFDYAERQAMKIGVAEALDLYATGKAQLVDIRFAEEYAAWHLGFGLHIPLDALPDRLHELDRSKLIIT
    L
    CPHYDRAEIARLFLTLEGFQSRYLNEGMLGLVDALRGDKARDLMRRLSGQS

    >gi|296137564|ref|YP_003644806.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thiomonas intermedia K12]
    MTAWSRRALLQRGAYLGLSLLGMGSRTARAAGLHVGQPAPVAVLQTLDGQTISTAALRGEVVILTFWATWCDPCRAELPV
    LSRFAADHAAQGLRVLGFCLDGPERLAQVRAVAATLSFPVGLLPSPWMPGYGRIWRIPVSFVIDRDGRLADNGWNDPHPA
    WTQERLQQVVGPLLV

    >gi|296137592|ref|YP_003644834.1| thioredoxin [Thiomonas intermedia K12]
    MLIVCPHCATLNRVPDDRLKDAPVCGQCGQEILPAAPVTLTDANFERFIAKSELPVLVDFWAEWCGPCKMMAPQFAQAAI
    QLQGRAVLAKVDTDANPQVSVRSRIRSIPTLALYRGGQEVKRQSGVMPAQELVRWVGA

    >gi|296137628|ref|YP_003644869.1| heavy metal translocating P-type ATPase [Thiomonas intermedia K12]
    MSECASKGCGCSTGPIIQPTAQAPLATGSAQAVYRIENMDCPTEEALIRGKLAGLAGVVGLEFNLMQRTLAVRHELPSLS
    PVEQALAAIGMQAVRMDQASTEKTTKLSIAKMD
    CPTEEALIRNKLGTVAGVADLDFNLMQRTLSVRHADQVLPNVLAALQ
    ALGFEAQVMDTAESASPSASPVITPTNWWPLGISLLTALAAEAVYWLHNGNHWSVVVLALVSVFTGGLSTYKKGWIALKN
    LNLNMNALMSIAVTGAMLIGHWPEAAMVMVLFALAEVIEAKSLDRARNAIRGLLDMTPEQATVQQADGTWREVSAKQIAI
    GSRVRVKPGERIALDGEVLEGRSTVNQAPITGESLPVEKSPGDPVFAGTINESGSFEYRVTAVASNSTLARIIHAVEAAQ
    GSRAPTQRFVDQFARWYTPIVFALAIAVALLPPLFMGAAWLDWIYRALVLLVVACPCALVISTPVSIVSGLAAAARHGIL
    IKGGVYLEEGRKLRWLALDKTGTITHGKPAQTDFVTWGNALASDSRSIAASLAARSDHPVSKAVAQAAQTDGVALLDVAE
    FNALPGRGVQGQIDGETYYLGNHRMLEELGQCTPELEQRIAALETVGKTVVMLVGAKGVHALFAVADTIKDSSRRAIAEL
    HALGINTVMLTGDNPHTAQAIAAQAGIDRAQGNQLPDDKLREVEQLSRNGKVGMVGDGINDAPALARADIGFAMGAAGTD
    TAIETADVALMDDDLRKIPTFVRLSRATAQVLMQNIVLALGIKAVFLVLTFTGHATMWMAVFADMGASLLVVGNGLRLLR
    R

    >gi|296137654|ref|YP_003644895.1| DSBA oxidoreductase [Thiomonas intermedia K12]
    MNPSQPLTIEIVSDVVCPWCFIGLRRLDLALEAVRRRHPDIRCIKRWCPFFLNPSVSPEGEPYLPHLVKKFGGPERVQAA
    FQHVRDAGAAYGLDYRFEDIKVLVNTFQAHRLIHWAQQSGDAQILVERLLIGQFQRGENLGDEAVLAKIAVECSYRETAI
    VEYLNSDEDNQLVQEQERESRAWGVTAVPTFIVGRKLMLAGAEDPMLFAEAIERVLVMGS

    >gi|296137663|ref|YP_003644903.1| DSBA oxidoreductase [Thiomonas intermedia K12]
    MNPSQPLTIEIVSDVVCPWCFIGLRRLDLALEAVRRRHPDIRCIKRWCPFFLNPSVSPEGEPYLPHLVKKFGGPERVQAA
    FQHVRDAGAAYGLDYRFEDIKVLVNTFQAHRLIHWAQQSGDAQILVERLLIGQFQRGENLGDEAVLAKIAVECSYRETAI
    VEYLNSDEDNQLVQEQERESRAWGVTAVPTFIVGRKLMLAGAEDPMLFAEAIERVLVMGS

    >gi|296134565|ref|YP_003641807.1| OsmC family protein [Thiomonas intermedia K12]
    MDDKQPPSVTLKQIDAYQFDLHFADDRPAILTDEPPPLGTGAGPSPSHLLLAAVGNCMSSSLYFALSKFKLDPKGLTTTA
    TGEIGRNEAGRLRVLSITVDIRMGAAAQGMERLDRVLMQFEQF
    CTVGESVRQGIPVTVSVFDGTGQKLK

    >gi|296137014|ref|YP_003644256.1| electron transport protein SCO1/SenC [Thiomonas intermedia K12]
    MPARFSAARRSLVLSAAFAPLAPLVLAACSKPYVFHGVDITGVPYADGFSLTDFNGKTRTLADFAGKVVVMYFGYTQCPD
    ICPASMQVVAQAMDDLGEKARDVQFLFVTVDPERDTPEILKAYVTHFNPTFLALTGTPAQIALTAKDFKVYYKKVPGKTP
    GSYTMDHTAGFYVFDPKGKIRLFEREGVSAKDLAQDINALIEGH

    >gi|296137454|ref|YP_003644696.1| Carboxymuconolactone decarboxylase [Thiomonas intermedia K12]
    MTTPTQPSAQELLAKMRAGMGRVPAAIEKSTVVDDGLIQEHMRSRMYAMPADGALDEQTRTLIYLAAALAGSSPACVRAM
    ADKVVQQGIPKAKVLETVHIARFAMATKMIGDAEPVFDALVGAQK