Thiomicrospira crunogena XCL 2 uid58183

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|78484383|ref|YP_390308.1| rubredoxin-type Fe(Cys)4 protein [Thiomicrospira crunogena XCL-2]
    MSEDFKKYICKTCGLIYDEELGDPDSGLAPGTRFEDIPEDWYCPLCLVSKSDFIPLDQAKVKSSPDGSPKRKASTHADVL
    IIGAGYAGWQAAENIRAALPEAEISLLTA
    CDGTVYPKPSLSMALSQGRTPDDLKEMTAEAKAAELNMGVKTRTKVMSINT
    KRKKVMTTSGSFQYDKLILATGAKAMVPQVEGNAAHDIMTINDLSAYRRFYKALVGKQSVTLIGGGLIATELAEDLSSQD
    IEVNMVVRGAHLMSQILPEAISNSLETKLKENGVHLYKNSELKEINESENGYVLQTDQGEFLETNIVIAAIGLAPNLDLA
    KKAKLETNRGICINGACQTSDPDIFAIGDCAEAGGVLQAYLEPIRRQAKAIAAHLKGEDTDQFQVLPSLIKTKTPSLSIM
    ISPPLHATHGQWEQTIMVGDNQRLLYKEGEGVSGFALSGDLVTSANALYQELFSA

    >gi|78484385|ref|YP_390310.1| OsmC-like protein [Thiomicrospira crunogena XCL-2]
    MTEVYVPSCLRPIDTDGLNKLAEAGKAAPDTIKTLKSKTVLEGQFKNFNYVRDLDPVVVDEPPVLLGEDTAPNPSEMALL
    SLGS
    CLSVGVQANASARGINLNKLEIDLEGDINITAVWGTGDVDPNKKLGVTEVRAFFTIEAPGSSQEDLEALVQHAIKW
    SPVANTYMNAVDLSGKLVS

    >gi|78484396|ref|YP_390321.1| DSBA oxidoreductase [Thiomicrospira crunogena XCL-2]
    MLRKFFITSLLILSFGIQPALSNESFGIAEGVEYKKIPTPQSTAPHEKKVVEVFYYGCPHCYELENSVHQWLKNKPKEVH
    FERMPAVLNNPNWVFMARVFYTAKFLGIEQPFHTKYFDAIQRDRKPIYNVDALAKFVEPMGIKPDAYKQMFNSFQVTSAV
    SRAKQMTQNYGIDGVPAVIVNGKYLTDVPMASSRQALWKVVNQLLNK

    >gi|78484437|ref|YP_390362.1| rhodanese-like protein [Thiomicrospira crunogena XCL-2]
    MEELSQLSGLSVANTSRHLQQLKQAGLVSTRKQGKNRFYQLAGEDVVNLVKQLRQTAESHLAEVDRLVTSLMPQKEETQA
    ITSEALAHQMQHNQFIVLDVRPAKEFEQGHIKGAVNVIPEKIDETIKTLPNNKTIVAY
    CRGPYCVYSYQMVEHLRQNGRD
    ALRLDEGFPEWKAAGLPYETTLSH

    >gi|78484447|ref|YP_390372.1| thioredoxin [Thiomicrospira crunogena XCL-2]
    MIIMCPHCGGLNRIPDEKLNDHPNCGKCQSALFTGQPIEMNSEQFLRALHKTDQPLVVDFWASWCGPCKMFAPTFSQAAA
    QLEPHAKFIKINTETEQQIAAQFNIRSIPTLAIFKNGQEIARQSGAMDLGSFTNWVKSTI

    >gi|78484472|ref|YP_390397.1| thioredoxin [Thiomicrospira crunogena XCL-2]
    MSDNMIATSDANFDSEVLQSDVPVLVDFWAEWCGPCKMIAPILDEVAGEYAGKIKVAKLNIDENPATPPKYGVRGIPTLV
    LFKNGEVDATQVGALSKSQLCAFLDGNL

    >gi|78484484|ref|YP_390409.1| glutaredoxin-like region [Thiomicrospira crunogena XCL-2]
    MSQALENKEGQTVPSVVWPTRQNNEWVNVKSDDIFKGRTVVVFSLPGAFTPTCSSSHLPRYNELAPVFFENGVDEIVCLS
    VNDTFVMNEWAKDQECTNVTLIPDGNGEFTDGMGMLVDKSDLGFGKRSWRYSMLVKDGVVEKMFIEPNVPGDPFEVSDAD
    TMLKYINPNAQPKKVATIFTKPG
    CPFCAKAKAALEDAGIEYEEITVSHADVTSRTLRAVANADTVPQVFIEGQHIGGSDD
    LEAYLAK

    >gi|78484485|ref|YP_390410.1| glutathione reductase [Thiomicrospira crunogena XCL-2]
    MQYDYDLIAIGAGSGGLSVVERAVEYGKKCAVVEAKKMGGTCVNIGCVPKKVMWFGAHIAESLRDAPDFGFHVERKGFDW
    SELVKRREQYISNITTWYGGYFKELGIDVLEGWGSFVDEHTVSVDGKLVTAETIVIAPGGTPFIPNETENADLGITSDGF
    FALTEQPNKVAVIGSGYIAVEIAGVLQALGTQTTLISRKDLVLRGFDDMVRETLTDAMIESGIHKEYHFKVKKLMKADDG
    TLIIESEDGQHLEGFDEVIWAVGRETLTEPLALDKVGITPNGRGYIDVNDYHQTQVPNIYAIGDVTGQAQLTPVAIRAGR
    YLAERLYNNQPELKMDLSKVPTVVFSHPPVGVIGLAEHDARKEYGHDNVQVYSSVFTPMRYAFTEHQIKTALKLVCVGEE
    QKVVGIHIVGDGADEMLQGFAVAVQMGATKADLDATIAIHPSSSEELVTMRPMILK

    >gi|78484516|ref|YP_390441.1| YeeE/YedE [Thiomicrospira crunogena XCL-2]
    MEVIVWSAWVAGIAMGLFVIFHFWLMGKPAGCSTGYGNFCGMMFKKVEYFRTGEYKNINNSRLWFLLGIPIGGLISALGS
    PEPWHFSFDMGMYNDILPQTLAGKAIWLIFGGALLGFGARLAGA
    CTTGHALVGGAMLNPPSLLAGAIFFMSAFLTTHLLF
    GT

    >gi|78484579|ref|YP_390504.1| hypothetical protein Tcr_0234 [Thiomicrospira crunogena XCL-2]
    MKSIKNINVFLKGDIMVSLTTPICDFGQPAIEFDLPGVDGQNWTLEKAKGPNGLLVMFICNHCPYVKAIQERLANDARIL
    RDNYGVNSIAIMSNDPSEYEEDSFENMKKVAETYVFPFPYVMDEMQEVAKAYGAVCTPDFFGYNADLKLQYRGRLDASRK
    ETAPEDVRRDLLEAMKQVAETGYGPKEQIPSMGCSIKWSE

    >gi|78484620|ref|YP_390545.1| OsmC-like protein [Thiomicrospira crunogena XCL-2]
    MATIIKWQGGMAFEGTTESGHSVLMDAAPEVGGENKGARPMEMVLLGLGGCTSIDVIMMLQKSKQAVDDCQVEITAERSD
    SIPKVFTKIHVHFKITGQDLNLKKVERAVNLSAEKY
    CSVSKMLEHSVEMSHDFEIVAP

    >gi|78484692|ref|YP_390617.1| glutathione S-transferase-like protein [Thiomicrospira crunogena XCL-2]
    MSESHPVLYSYRRCPYAMRARMGLYLSGVQVEQREIEFWDKPASMLQASPKGTVPVLVLPDGRVVEESFDIMLWALSQRD
    TYQWLDSKGELPVEQTALVTQCDYEFKTHLDHYKYADRFPEKPAKDYRAQGEIFLQQLEDRLQANRNQAEGEYLFGADIS
    LADIALFPFIRQFAHVDKEWFATADYPALRQWLRQQMEADYFKAIMKNRPKWEAGHVPLWLDEPELMTKDQFRKKAQDMD
    GESKSH

    >gi|78484694|ref|YP_390619.1| HesB/YadR/YfhF [Thiomicrospira crunogena XCL-2]
    MSEMPTPVNFTEAAASKVSGLIQDEGNPELKLRVYITGGGCSGFQYGFTFDESQAEDDTVVEKDGVKLMIDPMSFQYLMG
    AKIDYLEDLQGARFVIENPNASTTCGCGSSFGV

    >gi|78484728|ref|YP_390653.1| heavy metal transport/detoxification protein [Thiomicrospira crunogena XCL-2]
    MHYSIQVENIKCGGCANSIQSSLNRIDEISQVDVDVEAGLVNFAAQTDLAAEAVKTQLLKMGYPEVGSTEGLNAMGAKAK
    SFVSCAVGKMSADSDTKS

    >gi|78484732|ref|YP_390657.1| UBA/THIF-type NAD/FAD binding fold protein [Thiomicrospira crunogena XCL-2]
    MLMNTLKTELNDEELSRYSRQILLSEIDYAGQLKLAQSHAVIFGLGGLGSPASLYLASAGVGTLTLVDFDEVDDSNLQRQ
    VIHREANIGQPKVLSAKENLQALNHHIDIHTVNHKLDETELEALIQSADIVLDCTDNFESRFALNRVCLKQKKPLVSGAA
    IRWEGQLTTYDFRQEDSPCYQCLYKEGQGQELT
    CSQNGVVAPMVGMVGSMQAMEAIKALIGLPTLVGKLMIMDGVTMQIR
    TLKLSKDPDCKTCHPPH

    >gi|78484764|ref|YP_390689.1| YeeE/YedE [Thiomicrospira crunogena XCL-2]
    MNRILFFYPLQKSFALILLMPLLAMSLVLAQTNVALFLVGALLGASLNYFQFGFRTCSHQLLTQGRTLGIRAVLWMLALS
    SVLFFVLLSIGSINGQPMTGFVQPLSLSVVAGAFMFGVGMQLANGCTSGTFNKLGQLQPLSLSSFIFLLIGGTLAAYHNE
    FWRSVPTLPPVSVLEQFGLLSGLVIQLGFIALLYWLAIIKEQNNFTEVSQLTHSSFWKISDWHPWLKAGLLLAALNALLL
    LLSGQPWSIANVFPYWGLKISDGLNLPVDWQFWPYGISHANRLESAVLQDTVSLTTLGLIFGALLVTLLAKNTQQEATQF
    TIKPHLFAVVGGFIMGYGSVIAFG
    CNIGAFFSGIGSGSLHGWLWAIAALAGNGVGIALKKQWEKH

    >gi|78484791|ref|YP_390716.1| protein-disulfide reductase [Thiomicrospira crunogena XCL-2]
    MRNTSFFKYLLTILLFLTLHSASASDELLDVDQAFSLQPVKVENGQVKISWKIADGYYLYKKRISIESDDLELSPPHFPK
    AITKNDPIFGQTDVFKHQLTVTQPYSGAATKADLTIKYQGCAEKLGVCYPPQTQSVTIELPAAADTNGNTLADLNSLIVD
    SSGADLLPADEAFQLQVTPNNNNQLILDFRVADGYHLYKDKIKTLLKQGNATLGTLELPEAIQTNDPVFGDVQVYHGDFQ
    AILPIETIADTAEIEIQYQGCSSESGVCYPPAKKLMTVQASDFSQTSTSLPPTSGTKTPETLSETDQITSTLQNSSVWIV
    IGTFFLFGLLLSLTPCVFPMIPILSSIIVGQGDQLTTRKAFVMSLVYVLAMSVTYTVAGVLAGIFGENLQVLFQNPWIIG
    SFALIFIALAFSMFGFYELQLPSGLQSKITNLSNKQEGGTLTGVAIMGFLSALIVGPCVAPPLAGALIYIGQTGDALLGG
    TALFAMSMGMGVPLLLLGTSAGKLLPRAGAWMDNVKAIFGVLMIGVAIWMAERILPEWTILFAWAALLIGSAVYLGALEP
    VGDKSGWHKLAKSIGVIFLIYGVVMLIGLAGGSKNVLQPLTVFQSSATSSSSQTEHLNFKTIRTLAELEQEVAKGNPVML
    DFYADW
    CISCKEMEKFTFSDPSVQSALANVTLLKADVTANNANDKELMKAFNIIGPPAILFFNHQQEQKAQRVVGFKKAA
    DFKQNIDQAFQ

    >gi|78484868|ref|YP_390793.1| hypothetical protein Tcr_0523 [Thiomicrospira crunogena XCL-2]
    MKKWALTLGLLGSLLFSVNATAADFFDETFGNLQEELETAKEEGKQGIFIFFHMEECPFCDRMKKTILNQPEVIAFYKKH
    FLTYQVDIEGANQMVDFDGTEATAQTISEKKYRVRATPVMMIFDLDGKPIVRYTGPTRTQKEFMLLGQFVLDGSYKTTSF
    TRYKRAHK

    >gi|78484941|ref|YP_390866.1| glutaredoxin-like protein [Thiomicrospira crunogena XCL-2]
    MDNQEKETLDRIHEQVTNNPVVIYMKGTPQMPSCGFSSRTAQAMVETGEKFAFVNVLADPLIFEYLPKYQDWPTFPQVYI
    GGELQGGCDITLELAESGELKTLMAKANEAVSEEA

    >gi|78484963|ref|YP_390888.1| HesB/YadR/YfhF [Thiomicrospira crunogena XCL-2]
    MAVTLTQAAADRVNSMLEKRGHGIGLRVGTKVSGCAGFSYVVDYADEITDNDEVFESFGVKVVVNQKSLEQIDGMELDYV
    KESLLNEGFEFNNPRVKDSCGCGESFTV

    >gi|78484997|ref|YP_390922.1| thiol:disulfide interchange protein DsbC [Thiomicrospira crunogena XCL-2]
    MNPVSVVKRLGLSMMVLAASNQVAADEAAIQKKLNQLIPNAAAANIKESVIPNLYEVSLGAKIIYMSGDGQYIVNGHIIN
    LDTRENVTEQALNQTRKTELDKLSASTMIVYPAKGEKKRTITVFSDID
    CPYCRKLHKEIPALNQAGIEVRYMAYPRAGVG
    SDAYKKAVSVWCAKDSATAMNDAMTTGQVALKTCQNPVKQHMQQAENFGVTGTPNIIFDSGKMIPGYAPANELIKLLIHK
    SS

    >gi|78485108|ref|YP_391033.1| thioredoxin reductase [Thiomicrospira crunogena XCL-2]
    MSTKHCKLLILGSGPAGYTAAVYAARANLEPVMVTGMQQGGQLTTTTEVDNWPGDVEGLTGPDLMVRMQKHAERFGTEIL
    FDHIHTAELNQRPFKLIGDSAEYTCDALIIATGASAKYLGLESEEAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVEE
    ALYLSNIASEVTVIHRRDSFSSEKILSKQLLEKAENGNINIEFNSALEEVLGDKMGVNGLRIKNNQTNESKEIDVAGVFI
    AIGHTPNTGIFDGQLDMDHGYLKVQSGLQGNATQTSIPGIFAAGDVMDQVYKQAITSAGAGCMAALDAEKFLDQLEAQG

    >gi|78485128|ref|YP_391053.1| peptide methionine sulfoxide reductase [Thiomicrospira crunogena XCL-2]
    MLSKLLTIFILSTSLILTACAKEPAMNPSPSSSDKTDYIVLGMGCFWGAEKRMGEVPGVITVESGYAGGDQKNAGYYDVL
    GLEKEIRYGKSDLRNHAEVVKVTFDPQKTDLKTVLIKFWESHDPTQGDRQGNDIGTNYRSAIYTHSEAQTAIAKKTETVY
    QKALDKAGFGKITTEIAPLRNYITAEEYHQDYLKKNPNGYCGLGGTGVKYPAASPDDASAMPEEAPVAKRLLGRDLSAER
    QLVVFEAEDCAFCKKFKAEVLSTWQSEVPIVTTLNPNVPEGWHLEKALFATPTIVLFEQGKEVSRYTGYNGDKERFWKWL
    GFRLLTPEQRRIAFEQGTEYAFTGSHLDEKRSGTFVDPITGAALFRSDTKFESGSGWPSFFNPVEGAITEHKDTSHGMTR
    IEVRSASSGIHLGHVFNDGPPPTHKRY
    CINGNVLKFVPDEKAEQ

    >gi|118139513|ref|YP_391054.2| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thiomicrospira crunogena XCL-2]
    MAFYHSIYFQPRVEKDIDTMLRTLTLFALTFVTLSAQANPLSIGTPAPDFALYNQHHERIQLSDQQGKWVVLYFYPKNDT
    PG
    CTTEACSFRDNVNKLIQKKAIILGVSLDSLDSHQAFAQKYQLPFSLLSDPDGKVAQKYDALSDFIVFKFAKRHSFIID
    PSGHIAKIYRDVDPQKHVGVVLNDLTMLQQGHN

    >gi|78485231|ref|YP_391156.1| thiol-disulfide isomerase and thioredoxins [Thiomicrospira crunogena XCL-2]
    MQDITSLEMLENLKREEDALLVLFGGRACNVCHSIKPKLIELIEAQYPKIKMVYVDCHDVTDVCAQEGVFTLPTLQIFFT
    GQRFIEEVRSFSLQKVMQEIERPYQLLFEG

    >gi|78485261|ref|YP_391186.1| rhodanese-like protein [Thiomicrospira crunogena XCL-2]
    MFTACEDVKRLIKEKNAQFVDVRTPEEYAMSKLPGAVNIPLQDIDRVGDSMLNKDLPVIVFCRSGQRSHMAMQILLSLGF
    DEVYNMGPYQAWYQCPDE

    >gi|78485309|ref|YP_391234.1| rhodanese-like protein [Thiomicrospira crunogena XCL-2]
    MRVLPLFLCLLFSASVWAKLPVFVSADWVHQHQENLKLIDLSSRDQFQKFHLPNAIWVNYAWLIKPQNGLQLSGGPDYMA
    KVLSQLGITPKDQVILYDNQGNLDASRLYWELKKLNHENVALLDGGSVQWVLKGYPVTQKMPKIKPANYPTPSSSSTDQL
    TANKQEVIAAIHNKQVALLDTRTKEEYLGSPKEKRTGHLPGAQLFPWQAAVDFRNGYQQRSAQQLKTFLEQVGITDKNQE
    IILY
    CNTAHRAARLFPMLKSLGFEQVRLYDGSTQEWSQDKSLPLTTGAIQ

    >gi|78485347|ref|YP_391272.1| dihydrolipoamide dehydrogenase [Thiomicrospira crunogena XCL-2]
    MSKIVDILIPDIGDFAEVDVIEVLVSAGEEIIQDDSLLTLESDKATMEIPAPYAGRVVEMNVDVGDKVKEGSVVGKIEIA
    DVETVSSNVEESVTPEPTPEKTDQKTTETPAPKAVSAADLPDADMQCDVLVLGSGPGGYTAAFRAADLGKKVVMIERYES
    IGGV
    CLNVGCIPSKALLHMSVVLNETREMGAHGIEFAEPKIDTNKMRAFKDSVIGKLTGGLSGLAKARNVDVVQGYGKFS
    SANTVTVDLADGGTKTIAFENAIIAAGSRVVKLPFIPHDDPRVMDSTDALELEEVPKRMLVIGGGIIGLEMAQVYDSLGS
    NITVVELGDTIIPGADKDISKPLLRRIKKKYENIYLKSKVTNVEAKEEGLVVTFEGKDCPETDTFDRILVAVGRAPNGKL
    IDAEKAGVAVNDWGFIEVDERQKTNVDHIYAIGDIVGQPMLAHKAVHEGKVAAEVINGMPSAFTPMGIPSVAYTDPEVAW
    AGKTEDELKAEGIEYEKGAFPWAASGRSLSLGRDEGLTKALFCAETHRLLGCGIVGPNAGELVAEAMLAIEMGADMQDIG
    LTIHPHPTLSETLCFAAEMAEGTITDLMPPKKKK

    >gi|78485366|ref|YP_391291.1| selenide, water dikinase [Thiomicrospira crunogena XCL-2]
    MTPVQKSSANTIQLTQYSHGAGCGCKISPKLLETLLETHSNSTVYPNLLVGNSTNDDAAAYDLGNGTSVLSTTDFFMPIV
    DDPFTFGQIAATNAISDIYAMGGRPLMAIAIFGWPIDKLPADVGRDVIEGGRATCEAAGIPLAGGHSIDAPEPIFGLAVT
    GLVDNQYLKRNASAEAGCELFLTKSIGIGILTTAQKQQKIQPDHLQVAIEAMTTLNRIGTELAMLEGVTALTDVTGFGLL
    GHLIEMCEGSGIAAQLDFAKVPLLPHALDYLAQGCTPGGTQRNFDSFGDKATGLFGSALTPDQRAILCDPQTSGGLLVAI
    KPEAVSKFRDIAKQYGLALHSFGRTVESSSQTHVVEVIV

    >gi|78485375|ref|YP_391300.1| SoxR-reducing system protein RsxE [Thiomicrospira crunogena XCL-2]
    MSNSSDNVLTHKWTEYQKIARNGLWNNNQALVALLGLCPLLAVTNNTVNGIGLGLATMAVLIVSNVLVSLIRDHVSDEVR
    IPVFIAIIASAVTVIDLLMEAYLHTLHGILGIFIPLIVTN
    CAILGRAEAYASKNSVDKSLIDAFFMGLGFALVLIVLGAL
    REIIGNGTLFDQMDLMFGDSAKTLTIHLWEDYHPVLLAILPPGAFIGLGLLVALKNAIEQRKAAKAQNVLGVQVSVNPLR
    APE

    >gi|78485379|ref|YP_391304.1| electron transport complex, RnfABCDGE type, B subunit [Thiomicrospira crunogena XCL-2]
    MISAILIFLALAIIFGILLGYASVRFKVEGNPVAEQIDNVLPQTQCGQCGFPGCKPYAEALAKGESEVNLCVPGGHEVMI
    QISEITHREPKEMEAEPEDIAQKIVAKIDEDICIGCVHCIKACPVDAILGATKMMHTVIESECTGCEKCIPVCPVDCIDM
    IPQEVTPQTWGWPEPTPQEAPLIQTFPPKD

    >gi|78485380|ref|YP_391305.1| electron transport complex, RnfABCDGE type, A subunit [Thiomicrospira crunogena XCL-2]
    MMEYILIIISTVLVNNFVLVKFLGLCPFMGVSKKTDAALGMGMATTFVMTLSSVLSYLINTYLLVPFGLEFLQTIGFILA
    IAAVVGFTEMAIHKTSPVLYQVLGIYIPLITTN
    CAVLGVALLNVGERHDFIESAFYGFGAALGFTLVMILFASIRERIAY
    ADVPKPFQGAPIALITAGLMSVAFMGFGGLVK

    >gi|78485393|ref|YP_391318.1| thioredoxin [Thiomicrospira crunogena XCL-2]
    MTQSSLQAKLIQSFLAIVLVVGSFAAQAAVDFEFKTLKGETVKLSDFRGKWVVVNYWATWCPPCRVEMPELGFFHDAHKN
    NNAVVLGVNYEDVDADVVQTFLDQEMIKFPIVRQLGKPDGKNTYFGPLRGLPTTYMVSPEGNVVAARTGMVDQKMLEDFI
    KKFNNTK

    >gi|78485551|ref|YP_391476.1| arsenate reductase [Thiomicrospira crunogena XCL-2]
    MKQATIYHNPRCSKSRQTLQILQDNGININEVRYLESPPSIDELDALCQAMNIAPQELIRTGESLFKELELSLNDDRSRK
    EWLVILTDNPKLIERPIVKVGHQVVIGRPPENVLTIL

    >gi|78485634|ref|YP_391559.1| hypothetical protein Tcr_1290 [Thiomicrospira crunogena XCL-2]
    MNKLFGISNCDTVRKAKKWLEANQIDFEYIDFRKNQFSKEHIDDWLKKVNFEDIVNQRSQAWKALTDAQKHDLIENKQLA
    LLLETPTLIKRPVLQTSEAVLFGFKEAQYQAQFA

    >gi|78485653|ref|YP_391578.1| glutathione S-transferase-like protein [Thiomicrospira crunogena XCL-2]
    MAKKMELISFKLCPFVQRAVIVLKKKNIDFDITYIDLGNPPDWFKDVSPLGKVPVLKVGNEVLFESSVIQEYVDEVTPPS
    LHPDDPLLKAKNRAWMSFGDELNVAMFKMGHAKSESAFEEIRDGMLKKLHQLEAVHSGKAFFNGADFCLIDAAYAPFFMR
    LDLMSLACGFSFLDGLPKMKRWSDNLLAEECVKSSVVTELPQMYVGMLKNIDGSYLSTLCQ

    >gi|78485693|ref|YP_391618.1| aminomethyltransferase [Thiomicrospira crunogena XCL-2]
    MKLRLEKQPLEWIDRSKQITFEVEGKFIPAFKGDVISSALWSEGHKVLGRSFKYHRRRGLLTMANHDVNALFQSKDRPNV
    RGDVVSAKEGIKLTSVNTFGNLERDAGSFVELISRFLPVGFYYRAFYSPKFLFPKWESLIRHMAGLGKVDTNWTQERKHK
    RYHYCDVAVIGAGPAGMSAAIKAAEGGVDVCLIDENPFIGGSLDYQYVNDPLLESTRENVKKKIAEMPNITVISSAYVAG
    YYGDNWLAVNTENGLIKLSAQSVVVATGVFEQPAVFRNNDLPGVMNASAAQRLMARYGVAP
    CREAVILTSNPEGYQAALD
    LCKAGVQVLAVLDTGRPSNPWYEQVYDLGIPVYKEIQGIEAHGKKELSAVTFQINGLSHTLNCDGLLMSVGWAPVGAPIY
    QAGGLFSYDENLHQLLPKKLPEGLFACGRINGIFDIHNQLQDGEQAGLNAAEYAKGLNLTPFNYLKSTTAHSHPYPVWDH
    PKGKAFVDFDEDVQLKDLKAAIAQGFDNIELMKRFSTIGMGPSQGKHSNMNGIRILAKLTGKTIDQTGSTTARPMFHPTP
    VSHLAGMRFRPERQTALHALHVSAKAKFMEAGNWLRPEYYQTESDRKTCIYAEALAVRQSVGLIDVSTLGKLEIFGEDAA
    ALMDRLYTMTMSNMKVGASRYALMVDDTGVIIDDGVSVRYSEDHFYVTTTTTSSDSAYRMIQKKIIEWGLDATVLNRTGQ
    LAAMNLAGPNSRKVLAKLTDLDLSNDAFPYLAMRQTQVLGFDATLIRVGFVGELGYEIHLHDKDATPVWQALMVEGAEFG
    IRPFGVEAQRLLRLEKGHIIVGQDTDGLMNPFEAGMPWAVHLKKPSFIGKPSLAKLKTMQKRKLIGFELLVELYDEPVLE
    SNLIIESGDIAGRVTSVAFSPSLNKTIGLADVSMEYSQLDEVIHIKLTSGALINAKVVPLPFYDPEGERQRPEEQTEGET
    S

    >gi|78485729|ref|YP_391654.1| thioredoxin [Thiomicrospira crunogena XCL-2]
    MSVIDLKVEDFESTIENNDIVILDFWAEWCGPCKQFAPTFEAVSEKHPDIVFAKVNVEEQQDLAGMFQVRSIPTLVFMRE
    KIVVFSNPGVIPESNFEEGIAQLKELDMEKVRQDLAKAQEENA

    >gi|78485731|ref|YP_391656.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thiomicrospira crunogena XCL-2]
    MSVLVTKKAPDFTSAAVLADGTIVDDFNLKSHIDGKYAVVFFYPLDFTFVCPSEILAFDHRVEKFKELGTEVIGVSVDSQ
    FTHNAWRNTPVNEGGLGPVKFPLVADLGGSIMDAYGIVHPGNVALRGAFLIDKEGVVRHQVVNDLPLGRNVDEMVRMVEA
    LQFHEENGEVCPAGWNKGDEGMKDSPEGVADYLSKHGEEL

    >gi|78485832|ref|YP_391757.1| dihydrolipoamide dehydrogenase [Thiomicrospira crunogena XCL-2]
    MRRVKYIILGAGSSGLTALGRIRRETDDFVMINGGAFGTTCARVGCMPSKALIHCAEHFHARKHFYDFGIDGADGLTIDH
    AAVMKRVRTFRDRFTSGVQAGSTDTLEADQLIKGYAKFVAPDTVEVNGQQIQGDRIIIATGSRPIVPEEWRSLEDKLITS
    DELFELERLPKRIAVIGLGIIGLEIGQALSRLGVEVIGFEMSNTLGGLQSPKASRQAIKLISKEFPIYLGEAATVEPTGE
    GVKITVSSGTFEVDAVFASLGRRPNLDSIDLEKLGVELDETGMPPFDIHTMQVANLPVFIAGDVNGFRPILHEAGHEGKI
    AVNNAMDYPEVTSYKRKTPLGIAFVDPQIGFFGVGYESLDLDKTVVVDFKLERNNGRAIVMGEDKGVISLYADKASKQLI
    GGELMMPHAEHFTHLLTWAVEQQLEVLELLRMPYYHPVLEEAIESAISMLAEALYTADEIEALDTLPSK

    >gi|78485894|ref|YP_391819.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thiomicrospira crunogena XCL-2]
    MTTTPSLQIGQKIPSFSLEATNGHTVSEKDLTGHYTVVYFYPKDDTPGCTTEGQDFTQAYPDFKTENTVIYGVSKDSIKK
    HENFKSKFDFPFELISDPDETLCKLFDVIKLKKNYGREYMGIERSTFLINPEGELIQEWRKVKVPDHVTEVLEAVKNVKN


    >gi|78485906|ref|YP_391831.1| electron transport protein SCO1/SenC [Thiomicrospira crunogena XCL-2]
    MKKHIFLILVTSVIIGLSIIVWLTPPSQFLVSGDAKMKTAALSQKPKGGDFTLMSSSGPVSLSDYKGKLVLIYFGYTFCP
    DICPTNLGNLAMAYQQLTPKERDQLQILFISVDPDRDTPNRLKQYADYFKSGIVGLTGKKTIIDDITHRYGVVYAIHREK
    PDETTYSVDHSAFTYIINAKGELVKQLPHATSPDIFTQQIRHFMTQHP

    >gi|78485910|ref|YP_391835.1| putative thioredoxin [Thiomicrospira crunogena XCL-2]
    MNNIGSKLFGILVLVLLGTLLYLTVFSEGLGKAPDITVKTAQGESIQLNKSMKPVLVNFWATTCPGCIAEMPHLAQMKRK
    FGDKFELVAVSMNYDPAEQVQKFIAKNPYPFSFVQDSDGKIAEAFGGVLLTPTSFLIAPNGNIVYQKIGEVDFDIVTERI
    KKMTPDL

    >gi|78485936|ref|YP_391861.1| thioredoxin [Thiomicrospira crunogena XCL-2]
    MEAMIIDVTQDNFDEMVLNNSMHVPVLVDFWAPWCGPCKQVMPMLEKLAHDLAGRFILAKVNTEEQEALATQYQIRSIPS
    FKIFHQGQMVQELQGAQSASDFREALEPYLKPDLSEDLRQQAQQAFNAGEYDQAVKLLGDASEANPNNFRIHLDLAKMYF
    QSGHLDKAESLMEKLPDEAKQSKEGKSLQALFKFTQIVANADDIETVQKTLQNDPNNAEALYHLSGYLMLHNHPDKAMSC
    LLKLFSVAPDYQDGVAKKTLIETFEMLQDERPELVNTYRRQLQNLLF

    >gi|78486009|ref|YP_391934.1| rhodanese-like protein [Thiomicrospira crunogena XCL-2]
    MLNKVLVLSTVIFFSLQASVAIAEEPSVKITENLAEVTVKHNGQPVTIKRNQDQDNRIDDEFALTSRPCPPFCLQPMNLV
    PGVKTIGELEMLDFLKRKAAGDDSILIIDSRTPDWVAKGTIPSAINIPWTKLFPQSSSFEPLEVEGILTLQFGASVVDTI
    WDFTHAKTLVMFCNGPW
    CGQSPTNIKALVSMGYPANKIYWYRGGIQAWHAAGLTTVSP

    >gi|78486100|ref|YP_392025.1| thioredoxin, putative [Thiomicrospira crunogena XCL-2]
    MKKPSSPPNPPEKDNPETKETQPLLQRNWVKNVLTAVFFIALYLAIRPFMQGDVAEGMAPQLTTESITGKEIHLKDYQGK
    PVVVHFWATW
    CPICEFERDGIENIAQDYAVINIATQSNDDEGLLTYANVHKMNADIIVNDFDGTLMKQFGARAVPATFII
    GPTGKIEFVEVGYSTSIGLKARLWWLSQ

    >gi|78486208|ref|YP_392133.1| hypothetical protein Tcr_1869 [Thiomicrospira crunogena XCL-2]
    MKGNLMVRMMTFMVLLSIGLAHGFGQVNLWEVNWLWLAIFAALMGFQATFTGLCPSNLVGKLSKTGECCPAGSCSTTSQT
    EKTQKATSQTNCCTADSDSKDNSNGCCGSQTGVVIKVLGTG
    CASCENTMKLIQSIADQKKIAVQIVKVEDISEIASYGVM
    STPAIVINEEVIHSGSLPSKDKVAEWLESLASS

    >gi|78486218|ref|YP_392143.1| thioredoxin-related [Thiomicrospira crunogena XCL-2]
    MSQPEIYNFEVSKNNFNNIVLTNSYKLPVFVLFMNPTLGTCVQMENSLSDLAETFAGQFIAARVDTDMEVDLREMYDIVN
    VPSLKVFKDGEIVHNEVGLMSEDELRVVLKNFGIFRESDDMREQARQKHIEGDTPSAIQLLTEAIQKDPANVMVVMDMIQ
    VMLDIGLLEQATELFNKLPDKEKDTETGRALVGQITFKGLANKTAGKEALQGQVEANPTDFDARFDLSICYIADHQYMEA
    MDQLFTILDTQPDYKDGAAQEMTVSVIQMLAPNDPEQANEFRRILGNLVA

    >gi|78486294|ref|YP_392219.1| rhodanese-like protein [Thiomicrospira crunogena XCL-2]
    MFIEFVEEQIFLFIALGVIVVMLVFSYFGDKVSGYRSVNADEAVRLYNSGAWVLDVRTDAEYKTGYIGEAENISSTEIAK
    KPDAVAKHKDEDVLVY
    CQSGMRSASVAKALVKQGFTKVHNLSGGVMSWKNAGLPLNKPVSKKKLRKEKK

    >gi|78486299|ref|YP_392224.1| heavy metal translocating P-type ATPase [Thiomicrospira crunogena XCL-2]
    MNQSCYHCGQGINQGALVLREINQVEKEFCCHGCAGVCEAIHEAGLESFYRRTPEGELFSPPPPPNKDIEFFDYDEVQSQ
    YVNELDQKREITLISEAIH
    CAACIWLIEHTLAKLDGVQMAKVNFTNKQIKLRWDNDQIKLSEIIQELNRVGYDANPYDAS
    SSEEAFRKANRDLLYRLGFAGFAMMNVMWFSVALYAGADEDAEFRHYFHWIEFIIATITLAYSGKPFLAGAMTSLKSRSV
    GMDVSISLGILTTYFYSFWVTIDPLHPGNVYYDTMIDFMFLLLIGRYLEAISKNKAIDSTRRLMDLQPKVARLKISDGIE
    VVPVRKLKTGDVVLVKPGDQVPVDGEVVEGTGNVNESMLSGESREVFKASGSSVSAGTLNLDGALSIKVTSILQDTLLGK
    IVHMVEDAQGSKAPIQCTAEKIMPWFVSVVIALATLSFVYWIVSADLETAMIAATSVLIITCPCAFGLATPMATAVASGV
    SAQNGILIKNGAVLEILNSIDHFVFDKTGTLTKGQMQLKDYSLYDVENEYELLKDLVKVEFHSEHSLGKAIVQSLQDQHP
    EFKTLDMTTTYFQAHPGKGVEAKVQDRHYQIGTSLWLEGFKLAIPDRLRALEMEKAQLGQTSVWVAQNNRIVAILFLEDE
    IRDDAAEMIQRLKQRGKKVTLLSGDRQLVAETVADRLGGMALQAEVLPEQKHLAIQNFQKDGQRVAMVGDGINDAPAMAR
    ADVSIALGSGTDVSMDCADIVLLNNELLSVDTAIDLSERTLKTIKENIASSIIYNITLVPLAMAAMLTPLIAAITMPLSS
    LVVIGNAARIRSFYSKKAIAKRHQKPLE

    >gi|78486314|ref|YP_392239.1| hypothetical protein Tcr_1975 [Thiomicrospira crunogena XCL-2]
    MVLSASLFLFACLLFPFSLFAQPESASRNALSQHASPYLAMHGQDPVNWQLWQPSVLKTAQQNNQLIFLSSGYFSCHWCH
    VMQQENYQDSTVASYLNQHFLSVKIDRELSPDIDQYLIQFAQKAAGHAGWPQHVILTPDGLPFFAFVYQPKAQLLTTLKR
    VVALWQSSPDQIKQAALKAISKPTPAQQRPLNLTPQDFIQQFNQQLSYQADELSGGLKASNKFPNAAILQTALDQKNRPD
    AITDWIQLTLDQMQSQHLFDHVNGGFYRYTVDPEWQTPHFEKMLYTQALLAKLYYQAGQEWQKEDYIETARHTLRYAETH
    LWNPKTQLFRGSQSAIDQNHVEGGNYLWTQEALKKKLPPKAYEQVKKEWQLDQPAPYDAGWHPKPTQQYWPIIQTRLQSH
    PDTIPTDTKSILGWNGLMLSAYVAAFQFDPTHSKQMKQKAQRLAQRLIKAFQADPPRALSLENKPMGEANIQDYAFVIQG
    LKDWYGLTKQPSLQATLLTLQQQAQVIFLSPQGWHYSDAPPLPGQHGTWAMEDDALPSPTAILDCGNSTHLAHSQNELQR
    YPLAYASYAAAWNCHSLTERTD

    >gi|78486358|ref|YP_392283.1| hypothetical protein Tcr_2019 [Thiomicrospira crunogena XCL-2]
    MQQSAFLELPKNFYELVLPEPQQNARLVTVNHSLMDELNCDLSDKQLLALASGNLTDESLINFNLIPLAQKYTGHQFGYY
    NPDLGDGRGLLLGQWHDKNNQAWEFHLKGAGRTPFSRRGDGRAVLRSVIREYLASEALHGLGVPTTRALAIASSQEQVQR
    EIFEPRASLIRVTPTHIRFGHFEWAASLGKDALDALIAFVIQHHYPELAELPENEQAGALLKAVCGRTATLMAKWQAVGF
    NHGVMNSDNMSIIGETFDFGPYAFFDDFQIEYICNHSDVEGRYAYNQQPKIGVWNCQVLAAAFGQSVTEAEQTAALDHFV
    QTYNQQYVSEMNAKLGLATQQETDKDLIGDLLVLMDKQRVDFSLFFRRLAKLGHADENDLRRLLSQPEEFEPWFERYHQR
    VAQEALSEDKRQQRILNNNPSIILRNYIAQQIIEAAEVGNFQPLNDWVKALHSPFENHPGLAEFQQPPTPEQKGLQLS
    CS
    S

    >gi|78486377|ref|YP_392302.1| hydrogenase (NiFe) small subunit (hydA) [Thiomicrospira crunogena XCL-2]
    MRIVIIGGGIAADYLANQILEKDSATEVLILSKESYAPYDRIHLCDLVSGTSCIQDITLELNPNVKVMLNQEVTAINRQA
    KQVITEQSQFEYDYLIIASGSQPKTLFDIEHIDNAVTFRSADDSFKIAKNLQDRNVVIVGAGPIGLELLDTLMDMPAPKR
    IYLIVRDESLYSGDLDPSSVALMQKTFEEDPRIVLSFNDEIVDKTIEKGHMTALQTKQHKIDDPLLIFGIGIRPNIDFAR
    SSLECDRGVLVDRTMRTSDLFIYAVGEAAQIDESGFSAGHAKECRLEADVAVSNIFKTEVAEFRREVAIDGLKVGAFEFI
    DVVSPHYNMHDEDNEVVLLRSKKEGRIDQYILNNEKLMRFIGVNSNVDALYLKQLIIENENVDASYLYNNRHENERGRLV
    CSCTGSYQKDLIDIIETQAVTSFAELKPYSEAGRVCGRCKKDVANLIAHAHVDKDEVERKRAEREEAAKAAQIEKVEKRL
    EKFNRLHPSNQIDMADFEAALQSFDKAQDFNGWVSMMTLNLQLPPEYDNLVCRSIQHLNKVPVIWLELADCTGNSEAFIK
    TVNPTIDELILKFISLDYHELLMAASGPHSETRLDQLIEEDQGDYILIVEGAVPLGMGGNFLRIGPQGETGEALLKRVAQ
    HASAVMAVGSCAFDGGVVAAAPNPTGAVGVSEALGRDDIINLPGCPVNPINVVGTLLHYIMFAEMPELGDNNKPVWAYAP
    RVHDNCERRGHYDAGEFVKEWGDEGAKKGWCLFEMGCKGPYADMNCAQMKFNEGTSWPVQVGHGCIACGKGKVAFDEFAN
    NRKVINVPKELTS

    >gi|78486384|ref|YP_392309.1| hypothetical protein Tcr_2045 [Thiomicrospira crunogena XCL-2]
    MRQRYLMTLIQQACLMVLLTLGLSLNANADEWRLNAIDDFAQLGQQAKKDHLPIAIYFNRVLCGACEKLKEAAILPMIEN
    GLLDGYVHMVEIRVDAKGIKTRDFYGEQVANSFFAQLYNVTTFPSIVFVNGDGDEIGQRMENSGAYDYVPYRLKKLINRA
    LADMGNDKRMQ

    >gi|78486385|ref|YP_392310.1| Thiol-disulfide isomerase and thioredoxins-like [Thiomicrospira crunogena XCL-2]
    MLNNTLRIGLILGWFCINAFHVAVAEVPHEHTLEGALESEVYTATTPIANVLWVPSEHGVLKQEQALAEQLAESGFTVTM
    PNLFESYFLPVASSSLRKIPSNIIEREIARLHASDLPLFVISSNEGAALVIKALASFQQTSTSMVGVVLLNPNLYIETPQ
    AGQKAEYWPTVSQVNAPVYIIQSELSPWRWHLPQLQQQLSLSGSDVFIRLMPKVRDRYYFRPDALPVEQKQAQTLASDLM
    QAMKTLAPYLPVFRESALAKNASPEERRNGVAVTQSRSQSTDKTGLQPYSGTQQRYLKLNDINNQSHSLDAYQGKVVLLN
    FWASW
    CPPCVHEIPSMTRLKTVLKDQPFEILAANLAEEKSDIQAFLKQHPVNFPILLDPKGSAVQAWQVFAYPSSYLIDG
    NGKIRYALFGGHEWDDPLTVQKIQSLIHKTTTSTKTP

    >gi|78486386|ref|YP_392311.1| rhodanese-like protein [Thiomicrospira crunogena XCL-2]
    MSWWTKQLVIIVFCLCSLPAHAQSLLLPPEQLKNALTDKTVTILDARSSSLYEQGHIQGARNFPVNWTYEHKSINGKIIS
    PDRIQIILRQLGLDRDTPVIIYDDGALVDAARLFWTLEVYGFNRVKVLNAGYDYWAAQNYPISEEQPKVDESAYIPVINH
    KRLATKFSTQIAIQNPNQIVIDARPEPAYLGLKSHAKRFGHIPKAINIPASHNIDASNHFAKISSVAQLKRVYSDIPKDK
    KIVLY
    CAIGRISATNYLALRELGYDVANYDASWLEWGNDFSLPIVNPSQSQMKP

    >gi|78486439|ref|YP_392364.1| ArsR family transcriptional regulator [Thiomicrospira crunogena XCL-2]
    MILDILSQSECDVDTLHRKLGLSVANVSKHLQNLKQAGLVKSRRDGLRIIYKLSDESVFRLIVSLREVAETQLEEMQELL
    VEHLKPNTPLEPVSLQVLKKMERNHQSYTLLDVRPYDEFSSGHLPSAINIPIDELPKNLSLLKLDKPLIIY
    CRGPYCMWS
    HEAAEMLQQKGYNAKRLIEGYPEWRATQE

    >gi|78486537|ref|YP_392462.1| methylated-DNA--protein-cysteine methyltransferase [Thiomicrospira crunogena XCL-2]
    MTALSFNEQCYALLEQVPAGKVTTYKALAEALGTRAYQAVGRAMNQNPNPVVVPCHRVVNHNGELGGYAFGMARKIELLT
    QEGIEIRENKVVDFKNKMITWQPSAPP

    >gi|78485834|ref|YP_391759.1| thiamine biosynthesis protein ThiI [Thiomicrospira crunogena XCL-2]
    MKFIIKLFPEIMVKGNAVKKKMVNQLHFNLKTLLSRKLSDIETKRYWDKIEVFCTKEQGSQVRDILLKTPGIEQVLEVEQ
    SHAKTLEDIAEKVAEYAVPKIEGKTFVIRAKRTGTHDFSSFDMERFVGAYCFQKGNPKGVNLHYPDIKIELEYHQDQLNI
    VQNRYPGLGGFPLGSQGEVLSLMSGGFDSTVASYLTIKRGLKTHFIFFNLGGAAHEIGVKQVAFYLWEQFSASHRVEFIT
    VPFEEVVAEIFRSTHESYMGVTLKRLMLQAAEEIADQKGIDALVTGESVAQVSSQTLRNLALIDQVTNKLVLRPLSVMSK
    PDIMAIADQIGTREFAENMPEYCGVISQNPITHGSFKRMERESKKFDYAVLQQAIATAEFIPVDAIIANVNDAQAVEVIH
    EVDDQIVIDIRKEEQAASDPLNMEGALAIPFHKLNHEFKHLDPSKEYLLY
    CQKGVMSQLHAQYLQDAGFHNVKVYRPL

    >gi|78484456|ref|YP_390381.1| hypothetical protein Tcr_0111 [Thiomicrospira crunogena XCL-2]
    MRQLLSLLLASLMLLGGCEQLANADSYQPSKLKELTNLQTLAKQSREQNLPIMLTVGAEWCDFCHQLREEVLDPMALGGD
    YEGRYMFMRYLSIDDHTPIPGVDGSPIIKNKLAYRLNADLTPTVVFIDGNGNEVADKIIGIANIELYTTLIHKRLNQAYQ
    NMNNPLRIDAMPTSISEP