Thiobacillus denitrificans ATCC 25259 uid58189

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|74316026|ref|YP_313766.1| rhodanese-like protein [Thiobacillus denitrificans ATCC 25259]
    MRFTLLPLVLVSALAQAEPLTLGVVLDQNESISDTQTNQRYRAFVRDVERAVGQPVRMQYYTRGFSAIKHAKDGTLDMVF
    GPAQVIANIGKFKFEPILKSGETAAAAFVAGPAYKGQLAARSGARLGVPDYESLMGGMARSEINSRGLSKRDFSEIKFHR
    MAEAPLYGLKLGRYDLAVASAEEAKAWTASNGGRIVFTTAAVPLRALSVQPERVDAGMRQKLAAGLTKNNSLQLALAGAS
    KADFKSVASMLNTTPTVLPGAKVIGAAQTRELMAQGVPVYDVRVGEEYAVAHVPGAISVPYKEGSAKEVGFDAADDQFAL
    NKLPKDKNAPFIMY
    CDGTICWKSYKSAVMAIQAGWKNVYWFRGGFPEWKEAGMPVIARKE

    >gi|74316054|ref|YP_313794.1| thioredoxin [Thiobacillus denitrificans ATCC 25259]
    MSEHVHYISDDSFEQEVLQAGVPVLVDYWADWCGPCKMISPILDEVAKEYAGKLKVCKLNIDENQATPPKFGIRGIPTLM
    IFKNGNVEATKVGALSKSQLTAFVDSNI

    >gi|74316174|ref|YP_313914.1| hypothetical protein Tbd_0156 [Thiobacillus denitrificans ATCC 25259]
    MVSLTTPVCDFGWKAPDFSLPGVDGMAWTPLDAMGPKGLLVMFICNHCPYVKAIRPRLVRDLAELKRDHGIHAIAIMSND
    PAEYPEDSFENMKQVARDFDFPFPYVIDETQQVAKAYGAVCTPDFFGFNRSFELQYRGRFDASRKETAPEDARRDLFEAM
    KEVAATQRGPAEQIPSMGCSIKWKEA

    >gi|74316192|ref|YP_313932.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Thiobacillus denitrificans ATCC 25259]
    MAVTLGGNPIDIAGSFPKVGDTAPDFKLVNKDLADVSLADFAGKKKILNIVPSLDTPVCATSTKKFNDAAVGNAVVLIIS
    ADLPFAMSRFCGVENTDKVVTLSTMRGAEFMKNYGVAITSGPLAGVTARAVVVLDEANKVLHAELVPEIKQEPNYEAALA
    ALK

    >gi|74316202|ref|YP_313942.1| thioredoxin family protein, putative [Thiobacillus denitrificans ATCC 25259]
    MRSPWRYAIPLALAAGAWVAQRQFAPRPASLPLAQLWQQSFPDAEGRPQALAQWRDKVLVLNFWASWCAPCREEMPEFDA
    LRTRYAQRGVEFVGIAVDQPAAVARFLARQPVAYPILVGEGAAHSLARELGNASGALPYTLVFGRKGEVVLQHLGRLPRE
    TLEEALLRTGT

    >gi|74316241|ref|YP_313981.1| thioredoxin [Thiobacillus denitrificans ATCC 25259]
    MAVIELTKDNFETTINGNDVVIVDFWAPWCGPCRGFAPIFEAASEKHPNIVFAKVNTEVEQDLAGYFQIRSIPTLMVFRE
    QVILYSEAGSLPANALDSLIEQVMGLDMAQVHKDIADQQSQQGEA

    >gi|74316290|ref|YP_314030.1| thioredoxin family protein [Thiobacillus denitrificans ATCC 25259]
    MTLRNPLAASFAVLGLTVLGLAPPATAADLPPLAHSLTMQAPKPAPALKLTDLDGKPHDLAKLRGKVVLVNFWATWCPPC
    RREMPSMERLKQALAGEPFVVLAVDVGEDADTIEAFTSQLGAVPSFPILLDTTSRAMQAWKVAGLPTTYLVDPRGRIVAR
    AIGGREFDHPDLVRVIRDQLRK

    >gi|74316474|ref|YP_314214.1| HesB-like protein [Thiobacillus denitrificans ATCC 25259]
    MNATTEMESPLVFTDSAASKVKSLIDEEGNPDLKLRVFVSGGGCSGFQYGFTFDEAQNADDTVMVKNGVTLLVDSMSFQY
    LVGAEIDYSEGLEGAQFVIKNPNATTTCGCGSSFSA

    >gi|74316503|ref|YP_314243.1| hypothetical protein Tbd_0485 [Thiobacillus denitrificans ATCC 25259]
    MSILDTVTPDNATGEVAEIYGQIRQAWGHVPAAIQVFSANPFLLRHQWEYYGSIMQHPTLSLPLTACIRMLVSQAGSCDY
    CIDMNAGMLINVAGWTPDEVAATRADFNDSPLSAPEKLLLGLVLKATRDARSVSTADLAMARGAGWSDSDILDAVNHGAR
    MVAGDIVISGFKVERDF

    >gi|74316537|ref|YP_314277.1| thioredoxin [Thiobacillus denitrificans ATCC 25259]
    MSEHALDVGLADFTQWVLEESKRRPVVVDFWAPWCGPCKSLKPVLEKLAAEYGGKFLLAKVNSDDNQELAARYGVRGIPS
    VKAFIDGQQVDEFSGALPEGEVRAFLDRLIPSPAEALREQAADARARGDSAAALERLAEASRLDPAHLGVRLDAAENMLD
    LGEADEASRLLASVPDDADPRVAQLKARLRFTGAAGEDENALRARLAANENDHGARLQLANLLVAAGQYEAGMDALLEIV
    RRDRSFEDDVGRKTLLSVFNLLGPGELVSRYRRLLASALN

    >gi|74316591|ref|YP_314331.1| rhodanese-like protein [Thiobacillus denitrificans ATCC 25259]
    MVGLSGFKEVDSAYVAELAAKGAHLIDVRTEAEVAQGVIDGAIHIPLHLLPLRAADIPQDKPVVIYCRSGARSAQACAFM
    ASKGYGNMHNLAGGIIAWARAGQAIRPAG

    >gi|74316604|ref|YP_314344.1| alkyl hydroperoxide reductase [Thiobacillus denitrificans ATCC 25259]
    MLKTGDRAPDFSNPDADMNEVELSQFRGKNLVLYFYVRDDTPGCTTEAIEFSELEKEFAKLQTSVVGVSRDDCIKHGEFR
    DKHGIGVRLLADKDETTSKAYGVLQDKEVDGVKRRSATRSTFIIDKQGVIRHALYGVSSRGHAAEVLQLVKELK

    >gi|74316670|ref|YP_314410.1| dihydrolipoamide dehydrogenase [Thiobacillus denitrificans ATCC 25259]
    MNHYAITMPQLSDTMTEGVVVTWEKQPGDRVERGDIVATVETDKAIMDVEVFKAGYLAGPLADVGATIAVGAALGYITDT
    AGDVAIAADEVVAEQAQTEMIPHHAGTPIVMPQLSDTMTEGVVVTWEKQPGEAIKRGDIVATVETDKAIMDVEVFQEGFL
    SGPIADIGSVVEVGHPMAFIVDDAAKANDTGVTISADHKVKDTHKVAPPAADKPAHLPIPKTAPSQVAAAGNAVPVPRPQ
    GRQASPYARKVAAQLGVNLTGLAGSGPSGVLVAADVARARPSMQEVAHALPQVDVPGQGRPMTSMEKAVSHAMTASLTLP
    TFNVTVNIDTAALTAATKAKKVSVTVAIAKACSVAMAKFPRMNWAYQPVDKLVERANHDFGVAVMSNDGGLVVPILHGVE
    KKSLEALQGDWTGLVERARVRKLAPPEYSNPTFTISNMGMLGVSHFTAIPTPGISAILAIAANGPQGTPFTITGDHRVLN
    GADVALYLTTLKQTIEAPDAWLSGGTAAETAGAAATTSAPVSPIPEGNWDVQVVVVGGGPGGEDCARDLADHGVKVMMVN
    NEPFPGGE
    CLWRGCIPSKAWRAAADNIRNRAHDAEMGVDGTANPKLNWAQVEKHRRWVQTSRGEMALKADKGMKIDVREG
    YGEFVDAHTLKITPPEGEAYTVSFGAAVIATGAPAFVPPIPGARENLATGGVVTSDTIWNLANPPKKLGIVGGGVIGVEM
    AQIFRDFGTEVLMLERHDRILAEIEEEIGKVLIASLEKEITVVTSADIREVGGKPGKMTLRYADKEGAESTFDCDVVLMA
    TGKRPDTSRLNLDKVGVALDGAAIKVDARCCTSTPNIYAVGDVIGGYMLAHTAATQGRVAASNLLGHASEYDQDRDCGVT
    FSRPQAGFVGLSVAQAKAKGIDAVEAKMPMSIDAKAMITGETEGMIKLVADKTTGRIIGVHYLADHTDTLIGTGVMMVAG
    EMTLTQVAKAIFPHPTQTELFGELARRLLNRLRRTAKK

    >gi|74316701|ref|YP_314441.1| hypothetical protein Tbd_0683 [Thiobacillus denitrificans ATCC 25259]
    MSIVNISCYKFVTLNDREALKADLGARCLQLGLRGTILLAPEGINVFLAGTRAAIDAIVAGLRADPRFADLEPKLSLSAE
    APFTRMRVRLKKEIITMKMPVVRPEEGRAPAVAAATLKRWLDQGCDDEGRPVVMLDTRNDYEVAAGSFENAVDYGIGVFS
    EFPPQLQRRRDDYAGKTVVSF
    CTGGIRCEKAAIHMQEIGVERVYQLEGGILKYFEEVGGAHYRGGCFVFDAREAVGADLQ
    PLGGRVHC

    >gi|74316819|ref|YP_314559.1| hypothetical protein Tbd_0801 [Thiobacillus denitrificans ATCC 25259]
    MGGRPERKRDSTSGASAVRAFERLTEGDFHHRIARTAGIAVVLFTAPHCGACRRWRQLLPSVLDETVDALYEVDVSEATG
    VARYFEIFHLPTIYLYRDGRFHAELQCPPQAALIRAATRALLDAPAQDEPG

    >gi|74316865|ref|YP_314605.1| methionine sulfoxide reductase A [Thiobacillus denitrificans ATCC 25259]
    MAHEIATLAGGCFWCIETVFNRLQGVESAVSGYMGGHTETPSYEAVCNGDTGHAEVVQITFDPDVISYRDLLDVFFTIHD
    PTQLNRQGNDVGTQYRSAIFWHTPAQKAEAEAAIAALDASKQYGSPVVTEVAEATTFYPAETYHQRYYEANPRQPYCQYV
    VAPKVAKAEQKFADRLK

    >gi|74316904|ref|YP_314644.1| putative thioredoxin protein [Thiobacillus denitrificans ATCC 25259]
    MTLSPHVFDATADNFNRLVLENSHKGPVLVHFWTPKAGPCFVLMPRLVRLAAEYGGKFLLVMLNAEELPQLAQRFAVNSV
    PTVKFFWRGEVAHTIHGAEPDSTFREALDRFIAGDANRAHALGVAAWQAGKLSEARMLLANAAMAEPDNLDIPRDLAKLL
    WAEGDGDQALKLLESLPPEARKDARIAPLHAHLRLAETARQAPALATLDEHIASQPDDIETHYQRAAVLLAGDDYAGAMD
    ELLFIARTDRDFGQDIGRISLLALFDLLGSADPLTLKYRRLLSESLH

    >gi|74317017|ref|YP_314757.1| bacterioferritin comigratory protein [Thiobacillus denitrificans ATCC 25259]
    MNEPEIQDFELPTTGNTPFKLSGQRGKNVVVYFYPKDNTSGCTLEGQEFRDLYPEFTKANTIVVGVSRDSLKSHEGFKAA
    HGFPFELLADTDEKVCELFGVMKLKNMYGKQVRGVERSTFVFDVNGKLVKSWRGLKAPGHAAEVLGFVQGL

    >gi|74317019|ref|YP_314759.1| thioredoxin reductase [Thiobacillus denitrificans ATCC 25259]
    MEMPLPVLVRISHCPIPPLGSQRTRAMSTQHHKLVILGSGPAGYSAAVYAARANLSPVVITGMQQGGQLMTTTEVDNWPA
    DVDGVQGPELMDRFQRHAERFQTEIIFDQIHTAKLSEKPFTLIGDSATYTCDALIIATGASAMYLGLPSEQAFMGKGVSG
    CATCDGFFYKGQDVAVIGGGNSAVEEALYLANIARHVTLVHRRDTFKAEKILINNLMDKVKEGKITLALDSTLDEVLGDK
    TGVTGMRIKSTKDGATRDIALTGVFIAIGHKPNTGIFEGQLELEGGYIVTRGGNKGNATATSVEGVFAAGDVQDHIYRQA
    VTSAGTGCMAALDAERYLDALGKTK

    >gi|74317037|ref|YP_314777.1| hypothetical protein Tbd_1019 [Thiobacillus denitrificans ATCC 25259]
    MATLESLTFDNGFARLPETYYARVCPTPVPDPYLVCYSPEALSLLDLDATELKRPETIETLAGNRLLPGMDAIAALYAGH
    QFGHYVPQLGDGRAILLGEVRNRAGEGWEIQLKGAGRTPYSRGGDGRAVLRSSIREFLCSEAMHALDIPTTRALAVVGSD
    HPVYREDEETAALVTRLAPSFVRFGSFEVFYYRNQVEPIRHLADYVIARYYPELKTLADPYPEFLRQVSLRTAELMAQWQ
    AVGFSHGVMNTDNMSILGLTLDYGPFGFLDAFDPGFVCNHSDTGGRYAFDQQPDVAAWNLTKLAQALVPLMSVETASQAI
    SEYPQAFGRAYLARMAAKFGLAPGDDTVPLITDALQLLAGNRVDYTIFLRKLCAFDSQADAGNAPLRDLFLDRAAFDAWA
    VRYGAALRQHGQPDAERAATMRTRNPKYILRNYLAENAIRRAADLRDYSEVERLHRLLARPFDEQPAFEAYAAEPPDWAK
    RIEVS
    CSS

    >gi|74317039|ref|YP_314779.1| selenophosphate synthetase [Thiobacillus denitrificans ATCC 25259]
    MNDTTALPIRLTQFSHGGGCGCKIAPAVLRDILADTPFSSHVAAAYPDLLVGIEHGDDAAVYKLNDEQAIVATTDFFMPI
    VDDPFEFGRIAATNALSDVYAMGGRPLFALAIVGMPIGRLPNEVIRQILAGGEAVCKAAGVPIAGGHSIDAPEPIYGLVG
    IGVVNPRRVKQNAGGRAGDSLVLGKPLGVGVYSAALKKGLLSDAQYAAMIAATTQLNTPGGELADAAGVHAMTDITGFGL
    LGHLLEITRASGLSAEVELGRLPLLPGVGELAQGGHVTGASARNWASYGGEVVLPDAMPEWQRALLTDPQTSGGLLVSCD
    PAARDTVLDIFHRHGFADAAEIGRLGAGSRVTVRP

    >gi|74317068|ref|YP_314808.1| glutathione S-transferase family protein [Thiobacillus denitrificans ATCC 25259]
    MTRPTVYHIPVCPFCQRVEILLSLKGRREDVDFRMIDITAPRPDWLLQKTRGTTALPVLETADGRVIKESLVILRYFEDI
    YREPQIAQTDPYRRAVENMLTTMDRDFVAAGYGWLMNQDPKQRDALRENMLKQYAQLDDFLLEHGAPGPFLFETFGWAET
    VFTPFFQRFWFLEYYEDFELPTASRYARVREWIDACVAHPAAQQTTREEVIKLYYDYACGAGNGALLPGRSRSSFALEPD
    WRARPWPPRSKYRQPAGDTELGL

    >gi|74317123|ref|YP_314863.1| methionine sulfoxide reductase B [Thiobacillus denitrificans ATCC 25259]
    MSTDEPKTDAQWRAELSPEQYRILREQGTERAFTGEYWDHHANGEYRCAACGAPLFSSSAKFDSGTGWPSFYEALNAQAV
    RERTDTTHGMVRTEALCSRCNSHLGHVFPDGPPPTGLRY
    CINSASLSFHPKD

    >gi|74317144|ref|YP_314884.1| glutaredoxin 3 [Thiobacillus denitrificans ATCC 25259]
    MNAVKVYSTGTCPICVKAKAFLDKRGIGYDEVRIDLDREAMKEFSVVTNGARTVPQIVVDGTCIGGFTELTELDMDGGLD
    HLHPASPGGQGG

    >gi|74317184|ref|YP_314924.1| Iron-sulphur cluster assembly protein IscA [Thiobacillus denitrificans ATCC 25259]
    MAVTLSERAAQHVTNFLAKRGKGVGIRLGVRTSGCSGMAYKLEFADETPEGDEVFTSHGVTVFVDPKSLPYIDGTELDYT
    REGLNEGFKFNNPNVKDACGCGESFNV

    >gi|74317290|ref|YP_315030.1| hypothetical protein Tbd_1272 [Thiobacillus denitrificans ATCC 25259]
    MKLYGIPNCTTVKKARAWLAGRGLDVPFHDFRKLGVDPAWLRTVSADAGWKNLMNTRGTTWRTLSDAERAAAVDEAGALA
    LMQAHPSVIKRPVLERDGRYHLGFSEDYYRNLFGA

    >gi|74317357|ref|YP_315097.1| putative mercuric transport protein [Thiobacillus denitrificans ATCC 25259]
    MSQGKTGRLPLIGGAIAAVAASLCCVGPLVLVMLGIGGAWVANLAVLEPFRPYFLGAAVIALFFAWKKIYRAPAAACTPA
    SLCAMPQTNRVYKMMFWVVAALVALALIFPDLAPLFY

    >gi|74317358|ref|YP_315098.1| mercuric transport protein periplasmic protein [Thiobacillus denitrificans ATCC 25259]
    MKTLVLAQVKKFILASILVFAFAGAAFAAVRTVTLSVPGMYCEVCPITVRKALEKVPGVSRVNVSFEKKEALVTFDDAST
    SIKALEDATFEAGYESTVKAPAKGGQAK

    >gi|74317359|ref|YP_315099.1| putative mercuric reductase [Thiobacillus denitrificans ATCC 25259]
    MSEQILRVTGMTCDHCAASVKQALLRVAGVTRADVSCPDAMARVEVGVDTPVAALLNAVRARGYGAEVGGDATSKASTKL
    NVTIIGAGSAGFAAAIRAAEEGAEVTVIEASTIGGT
    CVNVGCVPSKILIRAAHVAHLQARHPFPGLVRHAPLLDRTALVA
    QQQARVEELRHAKYERILETNPGIKLLRGFARFEDAKTLVVRQPDDTEKRLTPDRILIAPGRSPRIPDVPGLAGTPFWTS
    SEALIATETPAHLIVHGGSVVALELAQAFLRLGSRVTLVARGKLLSREDPAIGEGLNAVLEEEGMRVLTDTDVKAVRFDG
    TTFELETSAGTLSGDRLLVATGRKPNTAGLALDRTGVTTDTSGAIVVDDHLRTSVPHIYAAGDCTNAPQFVYVAAAAGTR
    AAINMTGGDAALDLSVVPAVVFTDPQVATVGLTEAQANKLGMETDSRTLTLDNVPRALANFDTRGFIKLVSEKKTGRLLG
    AQVLAGEGGEIIQTAALAIQNRMTVADLAGQLFPYITMGEGLKLCAQTFTTDVKQLSCCAG

    >gi|74317446|ref|YP_315186.1| arsenite S-adenosylmethyltransferase [Thiobacillus denitrificans ATCC 25259]
    MSAHEHDQIRQQVRDAYGAVARAESAGCCAPSTGCCAPSDENVAELLSRGIGYSAEETAAVPEGANLGLGCGNPQAIAAL
    QSGETVLDLGSGAGFDAFLAARQVGAEGSVIGVDMTPDMVTKARANAVKGGYANVDFRLGEIEHLPVADATVDAIISNCV
    INLSPDKVQVFREAFRVLKPGGRLAFSDIVTTAELPEAMQREVALYTA
    CVAGAASVDELTAMLADAGFADIRIAPKDASR
    EFIRNWAPGRGVEAYIASATIEAVKPAA

    >gi|74317447|ref|YP_315187.1| thiol-disulfide isomerase/thioredoxin [Thiobacillus denitrificans ATCC 25259]
    MKDIKVLGSGCANCKTTLKLIEEVAQARGVAINLEKVDDMAAILGYGVMSTPGVVIDGKVVHAGGVPDRRKVEAWLA

    >gi|74317490|ref|YP_315230.1| mercuric reductase [Thiobacillus denitrificans ATCC 25259]
    MGSETDHDNFDAVIVGAGQAAAPLAVALGAAGWRTAVVERRHVGGSCINFGCTPTKAMAASARVAALARRAAEFGLRAGT
    VEVDFPAVMQRARAIVARFRRRLEASLAGADNVELIFGDAIFQDARTLIVRRPDGESRTLAAAHVFINTGTRAALPPIPG
    LERLPLLHDDALLALETLPPHLLVIGGGYVGLEFAQMFRRFGSEVSLIQRDEQLAPREDPDVAEALREMLVEDGVKVYLE
    AKILDADRGRSSDGDSIALNLKTPTGPLRLLGSHLLVATGRRPNSDDLDLAAAGVETGADGYIRVNDRLETSAAGIYALG
    DVKGGPAFTHIAYDDARVLKTNLLGDGGASVADRPVPYTVFTDPQLGRIGLSEREARQSGRRVLRAHLQMAQVARAIETG
    EARGFVKALIDADSGEILGAAALGADGGELMAMLQLAMMGRIPYSRLHDAVFAHPTLAESLNALFAAPQPLPR

    >gi|74317666|ref|YP_315406.1| heterodisulfide reductase, subunit A [Thiobacillus denitrificans ATCC 25259]
    MTEHVATNETILVVGGGISGMTAALEAAETGKNVVLIEKNPALGGRTSQLYRYFPKLCHPVCGLEINTRRLKNNPRVRVM
    TLAEVTGIEGSTGNYTVSVKVKPRYVNENCTACGECGRAVETLVDDPFNYNLGQHKAAYLPNAMAYPQRYVIDPAIIGTA
    DAERAKAACKYGAVDLDMKEETIQVKAGAVVWATGWQPYDAAKIQPYGYDRFKNVITSVEFERLADIHGPTGGKILRPSD
    GKEAKNIAFIQCAGSRDENHLRHCSRICCMASLKQTHYVREAYPQDGKSTIYYIDIRAIDRFEDFYQKVQADPSVTFVKS
    KVAKITEDEQGNPICWGVNTEGYKRYTTTHDLVVLAVGMEPSVKGINIPGHIVADSSGFIEADPANGAVFGAGCASNALD
    VNRAVQSATAAALRAIQVVNKVAKAEA

    >gi|74317668|ref|YP_315408.1| rhodanese-like protein [Thiobacillus denitrificans ATCC 25259]
    MKLRPLLVASALFTAVALSAPAVALDVKITADLPSVDVMHGGQKVTIMRNQDEKNTINPDFAKTSRKCPPFCIQPGQLAP
    GVDTIGEVELIHYIKKMSDGDKSIMVVDSRTPDWVEKGTIPGAVNIPWDKLNIGKSDPMTVQDILEKHFGVRNQDGFYMF
    DNAKTVVMFCNGPW
    CGQSPTNIKGLLKIGYPADKIKWYRGGMQDWEVLGLTTVKPVN

    >gi|74317677|ref|YP_315417.1| copper ion binding protein [Thiobacillus denitrificans ATCC 25259]
    MNRGAGMNEIVLPVNGMTCGGCVSSVQKVLSALPGVASVEVSLTPGQARVVYDAAKVDRAAMAQAVVDAGFSVGE

    >gi|74317999|ref|YP_315739.1| rhodanese-like protein [Thiobacillus denitrificans ATCC 25259]
    MYDTFKPAQPLGLMDFVRAAKSCVKEIPPQVLLDKLNAREDLLLIDVREHGEYEAGHIKGAHLVPRGILEAAADPAYPKH
    LPELAAARERQVVVY
    CATSGRSAMAAAVLQMMGFTNVLNMDGGYTRWVSDGLPQEHEATY

    >gi|74318024|ref|YP_315764.1| peroxiredoxin-like protein [Thiobacillus denitrificans ATCC 25259]
    MLTLTLGLLAGLLLLASAVMWMRRPRGQAVEGGAAPDFALRDQNGLTRSLGDYAGRWLVLYFYPRDDTPHCTREACAFRD
    ARATLEERGASVLGISVDTSARHADFARKHDLTFPLLADTEGGIARAYGSALDLGFTRLARRKTFIIAPDGRIAARFDAV
    DVATHADEVTRTLDALRRAWSYPTAPPAR

    >gi|74318033|ref|YP_315773.1| electron transport complex, RnfABCDGE type, A subunit [Thiobacillus denitrificans ATCC 25259]
    METYILILISTVFVNNIVMAKILGLCPFMGVSKKLETAIGMGLATTFVLTLASGSSYLINEYLLGTDLFYLRTLSFIVVI
    AGIVQFTEMFIHKTSPVLYQVLGIYLPLITTN
    CAVLGIPLLNVQAQNGFVESLFFGAGGAIGFTLVLILFAGIRERLDTC
    DVPAPFKGTSIAMVTAGLMSLAFMGFSGLVK

    >gi|74318038|ref|YP_315778.1| SoxR-reducing system protein RsxE [Thiobacillus denitrificans ATCC 25259]
    MMTLSEFRSLFHNGLVKQNTGLVQLLGLCPLLAISNTVVNALSLGLATMLVMAASSGAVSAARNFVPNEIRIPVFVLIIA
    ALVTVIDLAMNAFVHPLYLVLGIFIPLITTN
    CIVLARADAFAAKNRPLHSVVDAVAMGLGLTLVLIVLGAMRELVGQGTL
    FSGIDLVFGEDAKQFVLHVLPDYRGFLLAVLPPGAFIALGLLIAAHNWNKARAEQRAQLTVPATA

    >gi|74318053|ref|YP_315793.1| sulfide dehydrogenase (flavocytochrome), flavoprotein subunit [Thiobacillus denitrificans ATCC 25259]
    MHLDRRDFLKLSAATALAALPGCASLSGTARPRVVVVGAGFGGATCAKYLRRWGPALDVTLIEPNERFVSCPISNWVLGG
    LRSMDDITHGYGGLARHGITLIRDSVVAIDPDTRTLRTAQGLQIGYERLVLAPGVELLTDSVRGFADAEAAGRVVHAWKA
    GAQTALLRRQLEAMPDGGTFIVSIPAAPYRCPPGPYERACLVAHYFKQRKPRSKIIVLDANPDIVSKKPLFTDAWNTLYP
    GMIDYRPNSPALVVDAAKMTVSTDFEDVRGDVLNIVPRQRAAAVCDLVGARNDGNKTWCTVDFATFESTAAPGVHIIGDS
    MASPLPRSGHMATNQAKVCAGAIVDLLADRAPDPAPVIANTCYSATSDSTAGYVAHVYRLVPGKGYVAAPEGGATTTGDA
    RNFRYAASWAKNIWAEMLS

    >gi|74318062|ref|YP_315802.1| heavy metal translocating P-type ATPase [Thiobacillus denitrificans ATCC 25259]
    MSSSPLLTDAPVFSEGCFHCGLPVPAGARYPIEFEGQTKDACCRGCQAVAQTIIDSGQSAYYHHRTALPATAREAEAELA
    QLGLYDLPEIQESFVRVEAENVREAALILENIV
    CAACIWLNERHIAALPGVLSVEINYATRRARVRWDNSRIQLSAILKA
    VSDIGYIAHPFDPGRSDDLYKRERNTAIKRLAIAGLGMMQVMMYALPTYTATDMTEDIRLLMRWASLVLTIPVVVYSAWP
    FFIGAWRDLKRRALGMDVPVALGVGTAFVASVYSTFSSEGEVYYDSVTMFIFLLLTGRFLEMNARRRAGAAVEELVKLIP
    AATTRLPAWPARDEEKVPVARLTVGDHVLVRPGETLPADGVVVEGESAVSEAMLTGESQPIAKRVDAKVVGGSLNEASPL
    VVRVEKLGADTRLASIVRLLDRAQSEKPRIGQLADRAAGWFVGLLLVITAAVGLAWYAIDPSKVLWIVVSILVVTCPCAL
    GLATPAALTTATGRLTRLGLLTTRGHALETLARATDLVLDKTGTLTHGSLSVARVVTLGHRTEAEVRGLAAALEAGSEHP
    ISRALREGADAGLRADAIRNTPGRGVEGTVAGRAYRLGSPRFTAESDTPPRPPATDTGEHPNGHESWVALAEDGALIAWF
    ALADTPRADAATALAALQAQGLHLHLVSGDAEPAVKALAQALGITSWRAGALPEDKLAYVKALQQQGRIVAMVGDGINDA
    PVLAGAEISIAMGEGADVAQAAADMVMLGSRLTTLSEGVALARKTQRIIRENLGWALGYNLIAIPAAALGYVTPWIAGIG
    MSASSLLVVLNALRLSDFKQSTADAPRAAEAALR

    >gi|74318108|ref|YP_315848.1| hypothetical protein Tbd_2090 [Thiobacillus denitrificans ATCC 25259]
    MSKTLTLYTRAGCPLCEEMAGAAAAALSGTGHRIAPRDVDADPALKARYGWDVPLLFDGEAELCRHELDVAAVRDWLRLN
    P

    >gi|74318135|ref|YP_315875.1| hypothetical protein Tbd_2117 [Thiobacillus denitrificans ATCC 25259]
    MRQLFLAFVLLLAAPAWAETRDPASHFFQAKFGDFQAELDAAREQGKKGIFLFFEMDECPFCERMRTTILNQSDVQDAYR
    AQFLVYSIDVNGDTSMTDFKGKATTEKDFAFAHRVRATPTLLFFDLDGKLIARHTGPTKDKAEFLLLARYVVDGAYANQP
    FTRYKQGK

    >gi|74318136|ref|YP_315876.1| thioredoxin [Thiobacillus denitrificans ATCC 25259]
    MQTLQRTRFYPMWFGALLLALAASVAQAAGFKVTDTNGKTHTLDGYKGKWVLVNYWATWCPPCLEEIPDLIALHGDKKNN
    LVVIGIALDYRNAKQVTDFTEGLLVDYPIVLGNHQIVSQIGPVRGLPTTYLFNPEGKMVAQQVGAVTREAVESYLKGKGA
    RPAK

    >gi|74318160|ref|YP_315900.1| thioredoxin-related protein [Thiobacillus denitrificans ATCC 25259]
    MRLTRILLMVGLLWSGASFADPPRGYPFLGYDAGLKAARESGKPIFLYFGRYGCAWCDHTNKKTFSDAALKKLYMQNYVL
    VYVDAESGKRLTLPSGERITEAELGVRLQAFATPLFVYLTPAGDKIVQIPGFKTVQDFRDYDRYVRGGHYKDQTLMEFLG
    AKS

    >gi|74318219|ref|YP_315959.1| transmembrane protein [Thiobacillus denitrificans ATCC 25259]
    MTYEDFASAQSFLLWSTFAVALVMGAVVNKTNFCTMGAVSDWVNMGDTGRMRAWVLAIAVGVLGVMGLEAAGLVNVTNTF
    PPYRQNNFPWLENLLGGALFGIGMVLASG
    CGNKTLVRIGGGNLKSVMVFLVIAVIAYFMINPFPGSDKTLYSTLFYGWTN
    PTAVSLTTNQDLGAMLFAENADTGRMVMGAVIGGLLLIWAFKSAEFRSSFDNILGGLVVGLAVLAAWYITSNVMVDADGE
    IMSLQTYVQDWDLYAPADAVRPAAAGPLASQSFTFINPMGQSLGYATNGFDRTLLTFGIMALAGVVAGSLLWALISRSFR
    FEWFASVRDFFNHLVGAVLMGFGGVLAMG
    CTIGQGVTGFSTLAIGSILTFVAIVLGSAVTMKVQYYKMVYESEATFLKAF
    VTALADLRLLPAGMRKLEAV

    >gi|74318284|ref|YP_316024.1| heavy metal translocating P-type ATPase [Thiobacillus denitrificans ATCC 25259]
    MASSHSIGIEGMTCASCATRVEKALRQLPGVTDACVNLATETATVTGDADLAAVQQAIEKTGFSVPTESLTLAITGMTCA
    SCSARVEKALARVPGVVGASVNLATEQATVDVARGTSPAALIAAVERAGYGAQLPQQAAAAPAPAAALPDWWPVALAMAL
    SAPLVAPMLASLAGAHWMLPGWLQLALATPVQFWLGARFYRAGWKALRAGSGNMDLLVAVGTSAAWGLSVYLLLTRDDPM
    HLYFEASAVVISLVLLGKWLEARAKRQTTEAIRALQALRPATARVRVDGVDRDVPIEAIRVGDLVVIRPGERVPVDGEVI
    EGTSQVDESLLTGESLPVDKQPGAGLTGGAINAHGVLVARTTAVGAETTLARIIRLVENAQAAKAPIQRLVDKVSAVFVP
    VVMVIALVTFIGWWAWGGSAEQAILNAVAVLVIACPCALGLATPTAIMAGTGVAARHGILIKDAEALELAHSIDTVVFDK
    TGTLTDGTPHLAAHVAAPGEDANRLLALAAGLQRGSEHPLARAVLAASDAAGLAPLPAEAQQALPGRGIAGKVEGTGYWL
    GNRRLMQDQQVDTSALDPAAREHEAAGRSVSWLARADERRLLGLLAFADAVKPSAAQAVAKLKAQGVETAMLTGDNRGAA
    AYAAQALGVENVFAEVLPEDKAGHVGALKGRGRTVAMVGDGVNDAPALAAADVGIAMSSGSDVAMHTAGVTLMRGDPALV
    ADAIDISKRTYAKIRQNLFWAFVYNVVGIPLAAAGLLSPVIAGAAMAFSSVSVVTNALTLKRWRPAEDRR

    >gi|74318349|ref|YP_316089.1| thiol:disulfide interchange protein DsbC [Thiobacillus denitrificans ATCC 25259]
    MKFTSLALAASLMFAAAAHADEKLIRKTLAQQFPGAKVSSVKPTPYSGLFEVYLDGQLVYVDAKAKYVFAGDVIDLKNRT
    NLTQARLNQLQAVSWDVFPLNNALKTVKGNGARKLVLFSDVD
    CPYCRKFEAELTKVDNITVYTFLYPIAGLHPKAVQTSK
    QIWCAPDRNKAWDAYITRGTVPDNDGKCANPVDATIALGNRLKVNGTPTLFFANGVRVPGMVPAAQLERLLAANAK

    >gi|74318395|ref|YP_316135.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Thiobacillus denitrificans ATCC 25259]
    MPAYDAVLPAPMCRLGARFTGDALTRLDFLPADAEVSSGIDSRARELSVQLEAYWQDPGHVFDLFYVPLGTPFQLRVWHA
    LMRIPAGRPTTYGSLAARLGTAPRAVGQACGANPLPILIP
    CHRVVAARGVGGFMHADSGMPLDVKLSLLAHERRAD

    >gi|74318408|ref|YP_316148.1| adenylyltransferase [Thiobacillus denitrificans ATCC 25259]
    MELNDDLLLRYSRHILLPELGVTGQMQISAASVLVVGAGGLGCPVALYLGAAGVGRLVLADGDRVDLSNLQRQIGHGSAA
    IGENKAESLARSVQAINPTIEVDARGEALAGAALEAAVAQVDVVVDASDNFATRHAVNAACVRFGKPLVSGAAIGFSGQL
    AVFAPGRAGSPCYHCLFPDEAGEPELR
    CAEAGVFSPLVGVIGAMQASEVLKLLAGVGDPLVGRLLLWDGLRSDARVMKLR
    RDPLCPVCRSR

    >gi|74318417|ref|YP_316157.1| rhodanese-like protein [Thiobacillus denitrificans ATCC 25259]
    MDMQFLQDNWMLVALALISGAMLVWSFVGGSLSGVEQADTLKATRLFNDDALVLDVREDKEYAAGHIPKAKHIPLGQLQS
    RLSELDKHKNKPVLVT
    CRSGNRSAHACRILKKAGFESVYNQAGGILAWERANLPVTQK

    >gi|74318418|ref|YP_316158.1| glutaredoxin, GrxC [Thiobacillus denitrificans ATCC 25259]
    MAKVVMYCTAVCPYCVAAERLLKSRGVAEIEKIRVDLDPSRMDEMIERSGGRRTVPQVFIGDTHVGGFDDTSALDAAGEL
    LPLLARD

    >gi|74318419|ref|YP_316159.1| thioredoxin [Thiobacillus denitrificans ATCC 25259]
    MELACPHCLAVNRVPDERLAESPKCGKCGAVLLPAKPLDLTADSFDRFIARAGLPVLVDFWAEWCGPCKMMAPVFQQVAA
    EMATRVRFAKVDTEAEPQVSMRHHIKGIPSLILFRNGAEAARTSGAMDGHALKRWLAAQGIR

    >gi|74318444|ref|YP_316184.1| hypothetical protein Tbd_2426 [Thiobacillus denitrificans ATCC 25259]
    MMEAARAWRPSPPTLILLGLIAYLWVRPPAEVSDENRIAPPWHVALTEVRVLTSEAREGRVVLVDFRATGCPYCRKEKPV
    IERFWPDHRDPGFEVVSISVDDLADRIAACTTRVSVS

    >gi|74318449|ref|YP_316189.1| putative thioredoxin [Thiobacillus denitrificans ATCC 25259]
    MKFAKPVLFLVAALAIVAALAYALVDKPTAPASTFTTLEGRQIALDDLRGKVVLVNFWATSCPGCIKEMPGMVETYNAYK
    DRGFEIVAVAMSYDPPNYVANYVQTRQLPFPVALDVNGEHARAFGNVQLTPTSFIIGKNGDILEQKLGELDFDKLKALLE
    RELS

    >gi|74318452|ref|YP_316192.1| hypothetical protein Tbd_2434 [Thiobacillus denitrificans ATCC 25259]
    MKAGILALTAALVAGSAPLGAAGLYEWKDAQGRKVYSDLAPPIDARNAQQKRFTGSVVEGGESYATKTAREKHPITLYAN
    A
    CGIPCDQARQLLAERGVPFNSKDPQASPEGQAELQKLTGRLSVPVLVVGTERVDGFESGRWHTALDRAGYPSSAIPGRK
    LAPPAAPASEPTPAPAPGE

    >gi|74318501|ref|YP_316241.1| DsrE protein [Thiobacillus denitrificans ATCC 25259]
    MQFGILVNEGPYNHQASDSAYLFARTAIEKGHKVPRIFFYHDGVNNSTRMGEPPQDDRNVTTRWSKLAEEHGIDLVVCVA
    AALRRGIKDELLAPGFRISGLGQLVEMGIQYDRLVTFGD

    >gi|74318507|ref|YP_316247.1| 3-mercaptopyruvate sulfurtransferase [Thiobacillus denitrificans ATCC 25259]
    MFSNTLVSTEDLAAHLDDPNWVVLDCRFTLTDPGAGREAYEKAHVPGARYVHLDEDLSAPPGEKTGRHPLPDAELLNEKL
    CRWGVGVNKQVVVYDDSFGSMAVRLWWLMRWLGHPGVALLDGGYPKWTREKRPVSADVPAPHKAACACLPEPSQVVTADE
    ILRASQTGEQLILDARPDRRFSGEYEPLDPVAGHVPGAINRPFEDNLDLDGTFQPPEALREEYQALLKGRAPWQVLHM
    CG
    SGVTACHNVLAMEIAGLPGSRLYPGSWSEWITDPSRPVATGE

    >gi|74318517|ref|YP_316257.1| glutaredoxin-like protein [Thiobacillus denitrificans ATCC 25259]
    MTPLDRIREQVTNNAIVLYMKGTPQFPQCGFSSRAAQVLQACGVKDFLAVNVLADPEIFENLKYYANWPTFPQLYVKGEL
    IGGSDIMIEMYQKGEIQKLLEEAQTA

    >gi|74318577|ref|YP_316317.1| thiol:disulfide interchange protein DsbD [Thiobacillus denitrificans ATCC 25259]
    MIKWTRLLGAIPLLWAALVHLPGAQAEEFLDPEVAFKFSARALDADTLEARWQIADGYYMYRDKFRFELEGATLGEARLP
    PAKVKEDEYFGRVETYTKDVRIALPIKAAPGTKTVTLKTVSQGCADAGLCYTPQTVSAKVELPAPPVAAPASLAPVATAQ
    AASGGLGSLMGDGGAPQLLPPDEAFLVKATMPTATTVRFDYTLTADTYLYRDKFVYTVKAPAGVSVSKNELPPGEVKDDP
    TFGRTEVYHRDLSANLTLSRALAAGETLVVEAGWQGCNEKVGVCYPPIKREFSLSASGGKADAAPSGTGAGESDTSRIER
    VLKSGSSWAVVATFFGFGLLLAFTPCVFPMIPILSGIIAGQKKTLTKANGFLLSLAYVLGMAITYALAGVAAALSGTLLS
    NALQNPWALGIGAGIFVLLALSMFGFFEIQLPSALQSKFSDASNRMKGGNFLGVFVMGALSAVIVGPCVAPPLAAALAFI
    AQTGNTTLGGVALFVLALGMGVPLLLVGVSAGALLPRAGGWMNAVKYFFGVLMLAIAIYLISPIIPSWIHMLLWALLLIA
    AAIYLHALDPLPQHASGWSRLWKGLGVVLLIGGLAMLLGMLAGSRDVLQPLDVFKRGAPGAGGSAAAAVPAGLRFEKVKD
    VAELDARLAAAKAEGRPVMLDFYADW
    CVSCKEMERFTFSDPKVQARLADVVLLKADVTANNAADKALLKRFGLFGPPGLI
    FWNSAGVQSDYKVIGFEKAEKFLASVDAALGT

    >gi|74318624|ref|YP_316364.1| putative thioredoxin-like protein [Thiobacillus denitrificans ATCC 25259]
    MRQNSAFFRLRTAMTDLDAGSARPPIFDTDLARFDRDVIDASQHQPILVDFWADWCPPCRALTPVLERVIAQQAGKLQLA
    KIEVDDGDNMKLAGRYGLRGFPTVLLFVRGEIVGRFSSAKTEPWVREFLSEHIELA

    >gi|74318649|ref|YP_316389.1| methionine sulfoxide reductase B [Thiobacillus denitrificans ATCC 25259]
    MERRNFLILAGGAVLAWSSRAAAAPRVEKLVLSDAEWKKRLTPAAYHILREEGTEAPFSSPLDREKRSGLFVCAACALPL
    FPSRFKFDSGTGWPSFYDVLPGHVETEIDRKLFVPRTEYHCARCGGHHGHVLKDGPKPTGLRY
    CNNGLALRFIPDPA

    >gi|74318650|ref|YP_316390.1| methionine sulfoxide reductase A [Thiobacillus denitrificans ATCC 25259]
    MKRPIAAVLVRRVAAAAAFALVAAPGAAGATSLPDPAVDIPLAKTGGTATAVLAGGCFWGVEGVFEHVKGVKRVVSGYSG
    GEAGTARYERVSSGDTGHAEAVRVEYDPARISYGQLLKVFFSVAHDPSQRDRQGPDIGRQYRSAIFYATPEQRRVAEHYV
    SQLQKADAFSRPLATELVPLRAFYDAEAYHQDYLVRHPTQPYIVIHDLPKIAELKRRFPTLYEDD

    >gi|74318714|ref|YP_316454.1| rhodanese-like protein [Thiobacillus denitrificans ATCC 25259]
    MRQLRPSELAAYLEAGHAPTLLDVRERWEWNLCRLPDAILIPMGELAARVAELDRDAETVVICHHGVRSFHAARFLEAAG
    FSNVVNLSGGVAAWADEVDPAMARY

    >gi|74318745|ref|YP_316485.1| hypothetical protein Tbd_2727 [Thiobacillus denitrificans ATCC 25259]
    MPNRLASEQSPYLLQHADNPVDWYPWGDEALEKARREDKPILLSIGYSACHWCHVMAHDCFEDAEVGAVMNRLFVNIKVD
    REERPDLDQIYQTAHQLLAQRGGGWPLTVFLTPDQTPFFAGTYFPKTARYQLPGFPELMENVAHAWHARRGEVLAQNDAV
    RAALAQSQSQPAASASTPLTAAPLEQGVRDLAQAFDPVWGGFSRAPKFPRPGELFFLLRRAQGGDAKAREMALFTLRKMA
    SGGVVDQLGGGFCRYSVDEEWAIPHFEKMLYDNGPLLHLYADAWALRGETLFRETAEGIVAWLLREMRAPEGGFYSALDA
    DSEGHEGKFYVWSREEVKSLLTPDEYAVAAPFYGFDAPPNFENTSWNPLRARPLEEIAAALGLFPTDAEARVAAARRKLF
    AARESRIRPGRDDKQLTSWNALMIGGLAHAGRVMARPEWVAEAHAAIDFLRRNLWRDGRLRATFKRGEARLNAYLDDYAF
    LVDALLETMQAAYREADMAWAQELADALLAHFEDREAGGFFFTSHDHEALLTRPKPGYDNATPSGNGVAAFALQRLGHLL
    GETRYLDASARCLRLFLPQVVQQPIAHPTLLAVLDEALRPPRVIVLRGPDTPVQEWAANLAPRLGARDMLLALPNGEGAP
    GALAKPEAPQPTAWICSGTACQPPITELAAVLA

    >gi|74318754|ref|YP_316494.1| ArsR family transcriptional regulator [Thiobacillus denitrificans ATCC 25259]
    MSPSMTPKKKLFEQFARVAKSLASSNRLELLEALAQGERSVDALAQATGMSVANTSHHLQILRDSGLAESRKEGLQVIYR
    LSDDQIPVLLGSISRIAEKHLAEVDRIVREHFDVRDTLTPVGRSELLARVKDGGAMVIDVRPAAEYQAGHIPGAVNIPID
    ELPHHLEALPQGQEIVAY
    CRGPYCMLAFDAVATLRQAGYQARRLEDGFPEWKAESFPVDTGTPDAEP

    >gi|74318757|ref|YP_316497.1| ArsR family transcriptional regulator [Thiobacillus denitrificans ATCC 25259]
    MQKRELKNLLYEQVARIGRAVSSPKRLELLEILAQGEKTVEVLASEAAIDVKLASAHLKVLKEARLVETRREGRFVAYRL
    SGDDVSALWVDLRTVAEEHLVELKVEMERIFAAPEKLDVETRRSLLAKARRGDVVVIDVRPAAEYATGHLPFARSMPLEE
    IRQRLKELPADRDIVAY
    CRGPFCMMSAEAVALLKEHGYRAHKIADGVPEWQAAGLPLAES

    >gi|74318786|ref|YP_316526.1| glutamate synthase subunit beta [Thiobacillus denitrificans ATCC 25259]
    MGDVFQFLKQSRRDGAKTPADVRKHEFREIYALMDPAHAQEQADRCLGCGNPYCEWKCPVHNYIPNWLKLVNEGRLFEAA
    ELSHQTNSLPEVCGRVCPQDRLCEGACTLNTDGFGEAVGGGPNTGGFGAVTIGQIERYISEEAFKAGWRPDLSNVVPSGR
    RVAVIGAGPAGLACADVLARNGVQAVVYDRYDAIGGLLTFGIPEFKMEKTVMTRRREVFEGMGIEFRLNTEVGRDVSMQT
    LLDEYDAVFMGMGTYTYMKGGFPGEDLPGVLEALPFLISNVRQ
    CLELAGPDEAFHDMKGKRVVVLGGGDTAMDCNRTSIR
    QGAASVVCAYRRDEKNMPGSKREVANAKEEGVQFLWNRQPVEIVGNGRVEGVKLVTTELGPPDARGRRTPVVIPGSEEII
    AADHVIVAFGFRPNPQPWFAEHAIATDPAGRVIASGQAHPYQTANPKVFAGGDMVRGSDLVVTAVWEGREAAKGILAYLE
    I

    >gi|74318802|ref|YP_316542.1| thiol:disulfide interchange protein DsbA [Thiobacillus denitrificans ATCC 25259]
    MFARALTLFVAAVFSVSSLAASGDAFEGHDYARVKNPQAVATGKKVEVLEFFWYRCPHCFQLEPSLAKWIKALPKDAQIR
    RVPAVFREDWMPGAKLYYTLEQMGLLERLHAKVFDAYHLQNLDLNDPAVLGKWIAKQGVDRKKFESTYKSFSTQSKATQG
    ARLAMTYGITGVPAFIVDGKYMTSVGMTGSEARLFEVLDELIAKARAERAGKKAAP

    >gi|74318805|ref|YP_316545.1| disulfide isomerase/thiol-disulfide oxidase [Thiobacillus denitrificans ATCC 25259]
    MSKPPYVLAILLALPAQALAAEAKNWPAPIMALQTEGVEVVGTFKAPGGLTGYAGRVGQQPLAIYLTSDGKYAIVGTMID
    GKGNNLSEKPVADLVNKPMTEQVWQQLGQSTWVGDGKPTAPRVVYAFTDPN
    CPYCNKFWNDARPWVKSGKVQLRHVMVAI
    LGPTSPGKAAAILAAKDPEAALTRHEQAHATGGVKPLGRIPQKTAAQLEANQKLMQQLGSSATPTIFYKDASGKVRKIQG
    APSTDLLTEVLGPR

    >gi|74318806|ref|YP_316546.1| putative thiol:disulfide interchange protein [Thiobacillus denitrificans ATCC 25259]
    MSLSPSFMGATRRGWNRLSKRTRTVLALLAWVLAAQGALIGLRALQDPTLSEVQVRMLDGEPTDLAALAAGKPLVVNLWA
    SW
    CPPCRREMPVLAAAQQQATWASFVFANQGESAATVRTYLAAGQLDLANVTLDPDTRLGYMAGSTALPLTLFYDAQGRL
    LDTHMGGLTTAALAAKLKQLRATQESSTPEQTIHE

    >gi|74318807|ref|YP_316547.1| thiol:disulfide interchange protein [Thiobacillus denitrificans ATCC 25259]
    MLSVNLGPLALPIGMAVLLAAGLAAAGAGHLAGRRCKVGIVDTLSEMLLAGVVVARIVFVILWFDTYRDAPWSMLDIRDG
    GFTIWAGSLAALAVALWRGVRQPALRRPLAVGLATGAVVWAALSGALRLTEKPQLPAVALTTLAGAPTDLATLAGGKPLV
    VNLWASW
    CPPCRREMPVLAAAQQRETGVSFVFVNQGEDAATVRRYLDAGRLGLANMLLDPGGELARAAGSGALPTTLFYD
    ARGRLVGTHLGELSAASLSSKLKQLSETR

    >gi|74318808|ref|YP_316548.1| thiol:disulfide interchange protein DsbD [Thiobacillus denitrificans ATCC 25259]
    MLRSFWSVVILVLLWAVPAHAEQSFLPVEEAFRLGVSEEGDGQVRLNWVISEGYYLYRKQVKVEGEPAGSVEAVSLPPGV
    VKNDEYFGPSEVYHDRLAVLVKAPAAQALTVSWQGCAEAGICYPPQTRRVTLAGSATSVEPTADAPRQGGAALGEDQDLA
    DRLSRANPGWMLAVFFGLGLLMTFTPCVLPMLPILSSLIAGSGAGPRRGFVLSLAFVLPMALTYAAVGAGAALAGANVQA
    TLQNPWVLGAFGLAFVGLALAMFGFYELQLPAVLRNRLNTASQSQRGGTLGGAAAMGVLSALLVGPCMTAPLAGALLYIG
    NTGDVVTGGLALFAMGLGMGVPLLLVGTLGARLLPRPGEWMNRVKAVFGFVLLATAIAFVARVLPAELTLGLWGAWLLAV
    ALSLFALIQKIASEKGRLMSRYLALLVGLWGGAMVLGAAGGATDPLRPLAFVAATAAPAQAAAADGFMARFTPAKTEQDL
    AARVADAGRRGQWTLVDYYADW
    CVSCKTIEHEVFADPRVQAALADMQLLRPDVTANDAADRALMRAHQVLGPPTLLLIGP
    DGEERRAQRIVGELTADAFLVRLAQARKS

    >gi|74316355|ref|YP_314095.1| putative SCO1/SenC family protein, [Thiobacillus denitrificans ATCC 25259]
    MTHWLRYALVAAVVVVAGCQPKPQAPAFQATDITGAEFARDFTLTDHNGQVRSLGDFRGKAVAVFFGYTHCPDVCPTTLS
    DFAAALSQLGPQAERVQVIFVTVDPLRDTPDLLKQFVPAFHPSFLGMYADGPTLERLAKEYKIVYQKTAEKAADDYLIDH
    SAGTYVYDPAGKLRLLVPYGSSPDAIAQDLKTLLSTS