Thermus thermophilus HB8 uid58223

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|55980133|ref|YP_143430.1| thiol:disulfide interchange protein [Thermus thermophilus HB8]
    MTKLWTLLVAGALSLALAVKPGEPLLDFLLLDPKGQPVTPATMSKPAVIVFWASWCTVCKAEFPGLHRVAEETGVPFYVI
    SREPRDTREVVLEYMKTYPRFIPLLASDRDRPHEVAARFKVLGQPWTFVVDREGKVVALFAGRAGREALLDALLLAGADL
    P

    >gi|55980202|ref|YP_143499.1| pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component [Thermus thermophilus HB8]
    MTPMKTYDLIVIGTGPGGYHAAIRAAQLGLKVLAVEAGEVGGVCLNVGCIPTKALLHAAETLHHLKVAEGFGLKAKPELD
    LKKLGGWRDQVVKKLTGGVGTLLKGNGVELLRGFARLVGPKEVEVGGERYGAKSLILATGSEPLELKGFPFGEDVWDSTR
    ALKVEEGLPKRLLVIGGGAVGLELGQVYRRLGAEVTLIEYMPEILPQGDPETAALLRRALEKEGIRVRTKTKAVGYEKKK
    DGLHVRLEPAEGGEGEEVVVDKVLVAVGRKPRTEGLGLEKAGVKVDERGFIRVNARMETSVPGVYAIGDAARPPLLAHKA
    MREGLIAAENAAGKDSAFDYQVPSVVYTSPEWAGVGLTEEEAKRAGYKVKVGKFPLAASGRALTLGGAEGMVKVVGDEET
    DLLLGVFIVGPQAGELIAEAALALEMGATLTDLALTVHPHPTLSESLMEAAEAFHKQAIHILNR

    >gi|55980256|ref|YP_143553.1| 2-oxoglutarate dehydrogenase E3 component (dihydrolipoamide dehydrogenase) [Thermus thermophilus HB8]
    MYDLLVIGAGPGGYVAAIRAAQLGMKVGVVEKEKALGGTCLRVGCIPSKALLETTERIYEAKKGLLGAKVKGVELDLPAL
    MAHKDKVVQANTQGVEFLFKKNGIARHQGTARFLSERKVLVEETGEELEARYILIATGSAPLIPPWAQVDYERVVTSTEA
    LSFPEVPKRLIVVGGGVIGLELGVVWHRLGAEVIVLEYMDRILPTMDLEVSRAAERVFKKQGLTIRTGVRVTAVVPEAKG
    ARVELEGGEVLEADRVLVAVGRRPYTEGLSLENAGLSTDERGRIPVDEHLRTRVPHIYAIGDVVRGPMLAHKASEEGIAA
    VEHMVRGFGHVDYQAIPSVVYTHPEIAAVGYTEEELKAQGIPYKVGKFPYSASGRARAMGETEGFIKVLAHAKTDRILGV
    HGIGARVGDVLAEAALALFFKASAEDLGRAPHAHPSLSEILKEAALAAWERPIHL

    >gi|55980562|ref|YP_143859.1| thiol-disulfide isomerase/thioredoxin [Thermus thermophilus HB8]
    MLQYPELPLESPLIDAELPDPRGGRYRLSQFHEPLLAVVFMCNHCPYVKGSIGELVALAERYRGKVAFVGINANDYEKYP
    EDAPEKMAAFAEEHGIFFPYLLDETQEVAKAYRALRTPEVFLFDERRLLRYHGRVNDNPKDPSKVQSHDLEAAIEALLRG
    EEPPLKEAPAIGCTIKWRPGNEPEVRIG

    >gi|55980579|ref|YP_143876.1| hypothetical protein TTHA0610 [Thermus thermophilus HB8]
    MKRLAVLLLGLGAAWAQIAAPLERFSPGPLPEGARIQTEARSGRLYAVRYEGPVNASLMGRILSAATGVPGHAQGFVAWY
    GKNQALLRRGPVELNVEGAFLLKLAVGAWAEMEVRPLLTEEALFGEDRHVLGEKGVVVRVFSDFQ
    CPYCQRLAREVLPAL
    KAMAREGRLRLAYRHFPLYEIHPEAVPAAVASECAAAQGAFWAYHDLLMAGSGWDYPALARRLGLDPKAFQACLEDPASR
    APVEADRALAERLGLPGTPSVFVGPFRLPNPFDLERYRDYLALAEAL

    >gi|55980675|ref|YP_143972.1| cation-transporting ATPase [Thermus thermophilus HB8]
    MKAPRVRVFRVEGMDCADCALKVEKALSEVPGVVQAQVSFASGKAYLHLEVPGAEKEAERVVSALGYRLKPEGDTTRGVL
    GPWRWALVSGGLLLAAFLASLFLPGLAPWGYRLAALIGVFPLARRAVAAFRQNPFSMQTLVTLATLGAMLIGAEAEAAVV
    VFLFLVGEVLEAYSVAQARRSLYALSELLPRRAYRLKEGGVEEVPLKALRVGDLVRVPPGERVPADGVVVSGQASVEEAA
    FTGEPLPRPKGIGDRVYGGSLVQEGSLVVKVERLPEEGFLAEMERLAEEALLKKSQAERVVDAFSRRYTPAVLALAGFVG
    LVLPLFRGDFLGHVYKALGLLLIACPCALVVSVPAAIAAGVGRGARAGVLFKSGAALERLAGVRYVALDKTGTLTLGKPT
    LVRVVTFGVSTEEALALAKGVAEGSSHPLARAVREALGPKALPSEEHRAVPGLGAFARVEGKEVGLVRPEAWDLPPEVEA
    QVKALAEEGFSLSLLVREGVPLALLAFQDTPRLEAREVLAELRRLGLKPLLLTGDRETSALALGTAIGLFPEEIRAGLSP
    VDKLRLVEELAGRGGVAMVGDGVNDAPALARATVGLAVAEGTEAALQSADVGLLSLAALPRAFRLSRLTLGVVRQNVALA
    VGLKGLFLLTTLVGLTGLWPAVLADNGALVLVTLNSLRLLRARV

    >gi|55980696|ref|YP_143993.1| hypothetical protein TTHA0727 [Thermus thermophilus HB8]
    MDRTHERVLQAMAENLGEGLPRAIPLLAEKAPGLLLEHGRSWTYAMPEKGALDEKTRTLILLGIALATGSEACVKAMAHR
    AKRLGLSKEALLETLKIARQAQANAVLGHAAPLLEVL

    >gi|55980792|ref|YP_144089.1| hypothetical protein TTHA0823 [Thermus thermophilus HB8]
    MPRAIVLVVLGLALLGLGWILWGPKGKAGLDPAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPRLKAEYIDTGK
    VRYLFRDFPFPGQANVIRASEAAACAAEQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVDLAGQIGLEEGAFAACLASGR
    HREEVLADQKLATDLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALAKAE

    >gi|55980805|ref|YP_144102.1| rhodanese-like domain-containing protein [Thermus thermophilus HB8]
    MYETQVQELSPEEAKRLYDQGVPFFDVREVEEYAQARIPGARLLPLSEFMARYGEIPKDTPVVLYCRTGNRSWQAAAWLS
    AQGYRVYNLEGGIVRWYRAGLPVDTTPMEAAYRATPYQEVGPEEAKALLEEAFVVDVREAWEYGEGHVPGAVNIPLSTLP
    QRLAELPKDRPILLV
    CNSGNRSGVAAEFLVAQGFDGERVYNLEGGTYAWASRGLPLER

    >gi|55980806|ref|YP_144103.1| metallo-beta-lactamase family protein [Thermus thermophilus HB8]
    MIFRQIHEEGLAQMSYLLGCAATGEALVVDPRRDVDVYLELAQSLGLRITAIAETHIHADYLSGARELARATGATLYLSD
    EGDENWKYKGLEGFPHVLLKDGDEFKVGNIRVRAVHTPGHTPEHLSFLVADGAVTDEPLLFLTGDFVFVGDVGRPDLLEE
    AAGIKGTAEPGARRMFRSLKEKFLTLPDHVQVWPGHGAGSACGKALGALPATTVGYERRHAWWAEYLERDDEEGFVKALL
    QGQPEAPTYFKEMKRLNRDGMAILGGLPHPGRLTPAQFERWLREGAILVDTRDKFAFAGGHIPGSINIPAGKNFSTWAGW
    LLPYDRPLVLLARPEEVEALTRALVRIGLDEVVGYIPGLEGYAQGELETVPQVTAKEAKELWEKGKAFVLDVRGRDEYLA
    GHIPGAQNIHAGRVLAHLDRLPKDRPLIVH
    CVGGDRSSTAISALLAHGFRNALNLTGGIKAWREAGFPVVQGEELVQA

    >gi|55980807|ref|YP_144104.1| glutaredoxin-like protein [Thermus thermophilus HB8]
    MALLGPKEQEIVRERLANLTRDVEMVLFTDSSTLIAPGKEPCLYCKETKQLLEELSALSDKLHLVVYDLATPEGREKAGA
    YKVEAAPTLILREKGSEAINLRYRGIPAGYEFASLLEDIEMLGRDGHGLPENVVQELNDLPEEVVLQVFVTPT
    CPYCPQA
    VRTAHRLAYASPKVWGEMIEANEFPALSDRYRIHGVPDTIINHGKERVLGAQPLSQFLQAIRKAVGVRA

    >gi|55980808|ref|YP_144105.1| phage shock protein E [Thermus thermophilus HB8]
    MTRRALFGPKVAPLIQAASLTLALLLFLAACGPKGSYENVGPEELYEALAAGAVVVDVRTPGEFAQGHVPGAINLPVEEV
    ARWADRIPKDRPVYLY
    CRSGNRSRKAAEYLARKGYTNLYNVEGGVLAIARAGYPLVR

    >gi|55980809|ref|YP_144106.1| thiol:disulfide interchange protein [Thermus thermophilus HB8]
    MDALQVGPLAIPWVRVQVALALLALVGVAELFARRVDRRLSSWGQGAVFVGLLGARLGFVLENASVYAKDPLAVLYVWQG
    GFDPWWGILAGGGYTLMALPKHLWRYALGAALAAALVAGVFLVRKAPAQEARLPDLTLTTLGGTEVRLSDFRGKPLVLNA
    WATW
    CPPCRRELPMMVRLAQENPEVRFAFVSQGEGPLVVKNFLEERGLSPEWVLLDPETRLAQALGIQGLPTTFFFDREG
    RLVARHLGELSEALLLGYLRVLR

    >gi|55980955|ref|YP_144252.1| hypothetical protein TTHA0986 [Thermus thermophilus HB8]
    MGNRLKAARSPYLLAHAEDPVDWYPFGEEAFRKAQAEDKPIFLSVGYASCHWCHVMHRESFQDEEVARLLNAHFVPVKVD
    REERPDVDAAYMRALVSLTGQGGWPMSLFLTPEGKPFFGGTYFPKEDRMGLPGFKRVLVAVAEAWAGKREAILEEAERLT
    RALWKSLSPPPGPLPEGAEEEALDHLERAFDPEWGGFLPAPKFPQGPLLLYLLARAWEGEERAARLLRPTLRAMALGGVY
    DQVGGGFHRYSVDRFWRLPHFEKMLYDNALLARVYLGAYKLFGEDLFLRVARETLDWLLSMQRREGGFHTALDAESEGEE
    GRYYTWTEAELREALGEDFPLARRYFALGEDLGERSVLTAWGEAEARKALGEGFFAWREGVRAKLQGARRRRMPPALDDK
    VLADWSALAVRALAEAGRLFGEERYLEAAKRGARFLLAHMYREGLLRHTWRGSLGEEAYLSDQAFAALAFLELYAATGEW
    PYLDWAQRLAEAGWRLFREGPSLPLPAKEVEEGALPSGESALAEALVRLGAVFGGDYRERAEEVLAEKARWLARYPHALP
    GALLAKALWERGTELALPLPSPLLEAARGAFLPLTQLVLGPAGALPALEGREAGKAYVCRRGVCLLPVDRWEEVEARVRG
    DD

    >gi|55980997|ref|YP_144294.1| thiosulfate sulfurtransferase [Thermus thermophilus HB8]
    MGYAHPEVLVSTDWVQEHLEDPKVRVLEVDEDILLYDTGHIPGAQKIDWQRDFWDPVVRDFISEEEFAKLMERLGISNDT
    TVVLYGDKNNWWAAYAFWFFKYNGHKDVRLMNGGRQKWVEEGRPLTTEVPSYPPGRYEVPYRDESIRAYRDDVLEHIIKV
    KEGKGALVDVRSPQEYRGELTHMPDYPQEGALRAGHIPGAKNIPWAKAVNPDGTFKSAEELRALYEPLGITKDKDIVVY
    C
    RIAERSSHSWFVLKYLLGYPHVKNYDGSWTEWGNLVGVPIAKGEE

    >gi|55981122|ref|YP_144419.1| mercuric reductase [Thermus thermophilus HB8]
    MTYDLLIVGSGSAGVAAALEASALGAKAAVVEAGVLGGTCVNVGCVPSKYLLRAADAFHRAGHPAFPGLRTEALGVDWKA
    LLAGKEGLIAALRKEKYQEVLEAAGVPVLRGRARFLDGERMEVEGREVLAGRYLLATGARPFLPPIPGLQESAPWTYLEA
    LSAPALPESLLVVGGGPIGLELAQAFARLGSRVTVLEALPEVLPQEDRELARLLRGYLEEEGLRVHTGVRVEAVAREGAF
    RVRTDRGVFEAERLLVATGRRPDLEGLGLERAGVERDERGFLRLDPSLRTTNPRVYAAGDAAGLPQFVYVAAQSGRVAAR
    NALGVKAPLDLAALPRVTFTDPALAAVGLTEEEARRRYGAGVRAATLPLSQVPKALTARDTRGAFKIVVDEEGTVLGLHV
    LAHEAGDVIQEGILAVKYGFGYRDLIDTFHPYLTLAEGIRLVAQALDADPKKLSC
    CA

    >gi|55981269|ref|YP_144566.1| bacterioferritin comigratory protein, thiol peroxidase, putative [Thermus thermophilus HB8]
    MPAMEVGTLAPDFALPDQEGRTHRLSDYRGRWVVLYFYPKDDTPGCTKEACGFRDQMGSLKALDAVVLGVSADDVESHKR
    FAEKYGLNFPLLADPERKVIGAYGAWGKKNLYGKEVEGVLRQTFLIDPEGRIAKVWRKVSPEGHALEVAEALKALRGA

    >gi|55981313|ref|YP_144610.1| molybdopterin biosynthesis protein MoeB [Thermus thermophilus HB8]
    MRWTKEELDRYHRQMILPQVGPEGQERLKRASVVVVGAGGLGVPVLQYLVAAGVGRVGVVEMDRVEVSNLHRQVLYTTED
    VGEPKALVAQKRLQALNPLVRVEAYPVRLTSENALEILRPYDLVVDASDNFPTRYLVNDAAVLLGKPLVFGAIYQFDGQV
    AVFHHPTLHGEMGPCYRCLFPKPPPPGAVPS
    CAEAGVFGVLPAVVGSLMAAEALKVLLGIGKPLAGHLLLYDALEAGFRK
    LTVRRNPRCPVCGDEPTQRELVDYEAFCGLG

    >gi|55981342|ref|YP_144639.1| hypothetical protein TTHA1373 [Thermus thermophilus HB8]
    MTKKVVVHQIVGHRFLGVNEQGDKVMIDGDQPSTGPRPMELLLMALGACTAYDVVDIMRKKKQPLARYRVEVEGERAETH
    PRRYTRITVTHIASGPGVTLEALERAVHLSHTKYCSVSATLNAEITTRVVLEPWEGEEGEG

    >gi|55981372|ref|YP_144669.1| cytochrome c biogenesis protein, thiol:disulfide interchange protein [Thermus thermophilus HB8]
    MRGWLWLLVVLALGGLFWWGMQRNPEELPSVLAKERRPAPDFTLPLLPPYRAEWGEAFRLADHLGKRPIVLNFWASWCYP
    A
    CYEEAPILEASWRRHREEVLFVGVNTQDKQEEALRFIAQFGLTFPQVYDPRGRVGVDYGMYGVPETFFIDREGRVLARH
    AGAIDEATLARYLEEALR

    >gi|55981383|ref|YP_144680.1| putative sulfurtransferase [Thermus thermophilus HB8]
    MRRRDLLALLPFLALARGQGGAGEDWTEAFGRFLKAVPPAGYLVYPTEASDLLLFEPFILDVRTEEERKKGYIPGSVHIY
    AGEVPDRLGELPRDKEALILVY
    CNSGSVSAVVAAFLQAKGYKNAKNIAHGFKGWLDAGLPVEGA

    >gi|55981391|ref|YP_144688.1| thioredoxin [Thermus thermophilus HB8]
    MSSWGTLAVYRMRKVYTLLLSALLLWAWALPDFGRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSR
    LLEARFVVASVSVDTPEGQELARRYRVPGTPTFVFLVPNAGAWEEVGRLFGSRPRAEFLKELRQVCAKGGACG

    >gi|55981450|ref|YP_144747.1| thioredoxin [Thermus thermophilus HB8]
    MVVTCPKCGAKNRLGTPPPGQVPVCGACKTPLPWVVEADEKGFAQEVAGAPLTLVDFFAPWCGPCRLVSPILEELARDHA
    GRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLEGR

    >gi|55981591|ref|YP_144888.1| thiosulfate sulfurtransferase [Thermus thermophilus HB8]
    MNLPEDAVLVDTRPRPAYEAGHLPGARHLDLSAPKLRLREEAELKALEGGLTELFQTLGLRSPVVLYDEGLTSRLCRTAF
    FLGLGGLEVQLWTEGWEPYATEKEEPKPERTEVVAKLRRDWLLTADEAARHPLLLDVRSPEEFQGKVHPPCCPRGGRIPG
    SKNAPLELFLSPEGLLERLGLQPGQEVGVY
    CHSGARSAVAFFVLRSLGVRARNYLGSMHEWLQEGLPTEP

    >gi|55981594|ref|YP_144891.1| osmotically inducible protein OsmC [Thermus thermophilus HB8]
    MPVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGCFSMALAASLEREGFPPKRVSTEA
    RVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAKEG
    CPVSRALAGVKEVVLTARLV

    >gi|55981604|ref|YP_144901.1| iron-sulfur cluster biosynthesis protein IscA [Thermus thermophilus HB8]
    MVETQEAVIRITPLAAEKAKEILARYGKEHAAIRVYIKSGGCSGFQYGMAVDERELPGDTFVEMHGVRLVVDRMSLPYLV
    GSEIDWVESLMGGGFTVHNPNAASTCGCGHSFRTKDQEGAPRTCGH

    >gi|55981687|ref|YP_144984.1| heavy metal binding protein [Thermus thermophilus HB8]
    MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA

    >gi|55981689|ref|YP_144986.1| cation-transporting ATPase [Thermus thermophilus HB8]
    MAQEIKVGVRGMTCAACVARVERALKRAEGVEEARVNLTTEEAFLRLQEGVDLKEVLRQVEEAGYEPVVARAEIPVKGMT
    CAACVARVERAIKRLPGVVSATVNLTAEKAFVEYLPDTVSLARIRQAIREAGYEPLEGTEEARKEAPTYRKDLLLALPFA
    LLTLLLAMGPMLLPLPHFPGFLQALAALPVLYAGRRFFRQALAEARHLAFGMSTLVALGAGSAYLYSFLVLLFPGLFPEE
    ARHLYFEAGAVILTLILLGKHLEEGAKSKASEAIRKLLALRPKTARVVQDGEEKEVPAEALIPGDVVRVLPGERIPADGV
    VLEGQSHVDESMLTGEPIPKAKGPGDEVVGGTVNGEGALLVRVSRVGEATFLAQMARMVEEAQGHKPKVQELADRIAGVF
    VPVVLGIALLTFLLWLFLGPGLAHAFVAALAVLLIACPCAMGLATPAAIAVATGRAAEMGLLFRKGTALEALARADTVVL
    DKTGTLTRGKPTLVRVLPFGLSQEEALRLAAALERGSEHPLAKAVLEAAESLPQAQAEEVRALPGEGVEGRVEGRRLHLG
    GPALMERLGVPLPEEAKALPEEGYTPLYLVEGTRLLAAFAVFDPPRPEAQEAVAALKALGLKLVLLTGDHPAPARRVAEA
    LGIPEVLAGVRPEGKVEAIRRLQAEGRKVVFVGDGINDAAALAQADVGLAMGSGTDIALEAGDVVLLTPDLRGVVNAVRL
    ARRTLRTIYLNFFWAYAYNVVLIPVAAGALYPFTGLLLNPMLAAAAMSLSSLFVLTNSLRLRAFRPQALPSLNPAASS

    >gi|55981697|ref|YP_144994.1| hypothetical protein TTHA1728 [Thermus thermophilus HB8]
    MRFGIVLALLVLVAGLFLFGLRRDPSLLPSVLAEKRKPAPDFTLPILPPYRKAWGETLRLSRLFGRPIVLNFWASWCPPC
    RREAPMLEAYWRRYQDQVLFIGVNFQDTEEAALAFIREFGLSFPSVADPRGRVGIDYGVYGLPETFFIDPEGRVQARHVG
    ELKPKDLEGYLRTLLP

    >gi|55981716|ref|YP_145013.1| thioredoxin [Thermus thermophilus HB8]
    MAKPIEVTDQNFDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILF
    KDGQPVEVLVGAQPKRNYQAKIEKHLPATA

    >gi|55981804|ref|YP_145101.1| NADH oxidase [Thermus thermophilus HB8]
    MGKRMVVVGGVAGGASAAAKAKRENPELEVVVYEKSGWVSYGACGLPYVLSGEIPRLERLVARTPEEFRKQGVLVRTRHE
    VVDVDYELRTLTVHDHAEGRTFQDRFDHLVLATGARPSLPPIPGTEQEGVYTLRTMEDGERLLKALPQARRAAILGAGYI
    GLEAAEAFRKRGLQVTLLEAKDRPLPHWDPEVGALLKEELERHGVEVWTGVKVEAFRGMGRVEAVETSEGVVPADLVLLA
    TGIRPNTELAQAMGVALGPTGAIATDERMRTNLEGVYAAGDVAESFHRVLKRPYWLPLGDVANKHGRTAGSVIAGREARF
    LGVVGTAIFKAFDLAVATTGLSLEGALKEGFWAKKVFIQSRDGAHYYPGSGPLWVELVYEEGTGRLLGGAVVARGHGALR
    IDVLAALLHREGSVEDLLALDLAYAPPFSPVWDPLLIAAQQAR

    >gi|55981889|ref|YP_145186.1| thioredoxin reductase [Thermus thermophilus HB8]
    MEFNLSALGSAPAAEETYDVVIIGGGPAGLTAGIYAGRAQLKTVIVEKGLPGGQIAQTDEVENYPGFPEGISGPELASRM
    VRQAEKFGARIVMDEVLGLEKAEGGYLVRGYERNYRARAVIVATGANPRRLGVPGEDKFYGRGVST
    CATCDGFFYRDKEV
    VVVGGGDAAVEEGIFLTKFARKVTLVHRRDELRANKVAQKRAFQNPKMHFLFSHVVTEILGEDQVTGVRLKNLKTGEEYV
    YPTDGVFVFIGHEPNTAFLKGVVELRPDGYIAVRDEVFTSEPGIFAAGDVADPIYRQLTTSVGAGTRAAMMAERYLAEEA
    EKVKG

    >gi|55978315|ref|YP_145371.1| methionine sulfoxide reductase A [Thermus thermophilus HB8]
    MPEEIATLAGGCFWCTEAAFKLLRGVLEVVPGYAGGHVPHPTYEEVCTGTTGHREAVQVRFDPGVLPYADLLRYFFAVHD
    PTSEDRQGPDVGPQYSPAIFYHSEEQKRVAEAVMRELAPLYPKPIATKLLPFTTFYPAEAYHRDYFARHPEAPYCRFVIA
    PKLEKARKAFKSLLRP

    >gi|55980352|ref|YP_143649.1| putative thioredoxin [Thermus thermophilus HB8]
    MLSAMELVFVTREGCGLCEKAERALWALGVPYVRRDVDRDPELFARYTFRVPVLLWGEEVLLEGAFGERELVEVAARLGG
    GTWTR