Thermus thermophilus HB27 uid58033

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|46198460|ref|YP_004127.1| hypothetical protein TTC0152 [Thermus thermophilus HB27]
    MKGTKKLAWLGLLLVLPVLAQATTVTYSALTVRELGNFLMNLPTGFYAIAPAAAKNMMDTVDVFILDVREPNEFAGERIQ
    GAVNIPIRDLPKRVGELPKGKPIIVY
    CKVGHRGSMAMMFLRGQGYNVQSISGGLDGWKNAGLPVVK

    >gi|46198532|ref|YP_004199.1| thiol-disulfide isomerase/thioredoxin [Thermus thermophilus HB27]
    MLQYPELPLESPLIDAELPDPRGGRYRLSQFQEPLLAVVFMCNHCPYVKGSIGELVALAERYRGKVAFVGINANDYEKYP
    EDAPEKMAAFAEEHGIFFPYLLDETQEVAKAYRALRTPEVFLFDERRLLRYHGRVNDNPKDPSKVQSHDLEAAIEALLRG
    EEPPLKEAPAIGCTIKWRPGNEPEVRIA

    >gi|46198553|ref|YP_004220.1| hypothetical protein TTC0245 [Thermus thermophilus HB27]
    MRRLAVLLLGLGAAWAQIAAPLERFSPGPLPEGARVQTEARSGRLYAVRYEGPVNASLMGRILSAATGVPGHAQGFVAWY
    GKNQALLRRGPVELNVEGAFLLKLAVGAWAEMEVRPLLTEEALFGEDRHVLGEKGVVVRVFSDFQ
    CPYCQRLAREVLPAL
    KAMAREGRLRLAYRHFPLYEIHPEAVPAAVASECAAAQGAFWAYHDLLMAGSGWDYPALARRLGLDPKAFQACLEDPASR
    APVEADRALAERLGLPGTPSVFVGPFRLPNPFDLERYRDYLALAEAL

    >gi|46198662|ref|YP_004329.1| cation-transporting ATPase [Thermus thermophilus HB27]
    MKAPRVRVFRVEGMDCADCARKVASALEEVPGVVGVQVNYASGKAYLVLEREEALREAEARLAPLGYRLLQAEGEGEGLP
    GPWPWALLSGGLLLLAWVWDAFFAGGGLPYALAALVGVLPLARKGLLGFRRNPFSIQVLVSLATFGALAIGAAQEAAVVV
    FLFLLGEVLEAYSVAQARRSLYALSELLPRRAYRLKEGGVEEVPLKALRVGDLVRVPPGERVPADGVVVSGQASVEEAAF
    TGEPLPRPKGIGDRVYGGSLVQEGSLVVKVERLPEEGFLAEMERLAEEALLKKSQAERVVDAFSRRYTPAVLALAGFVGL
    VLPLFRGDFLGHVYKALGLLLIACPCALVVSVPAAIAAGVGRGARAGVLFKSGAALERLAGVRYVALDKTGTLTLGKPTL
    VRVVTFGVSTEEALALAKGVAEGSSHPLARAVREALGPKALPSEEHRAVPGLGAFARVEGKEVGLVRPEAWDLPPEVEAQ
    VKALAEEGFSLSLLVREGVPLALLAFQDTPRLEAREVLAELRRLGLKPLLLTGDRETSALALGTAIGLFPEEIRAGLSPV
    DKLRLVEELAGRGGVAMVGDGVNDAPALARATVGLAVAEGTEAALQSADVGLLSLAALPRAFRLSRLTLGVVRQNVAFAV
    GLKGLFLLTTLMGYTGLWIAVLADSGALVLVTANSLRLLRSRV

    >gi|46198683|ref|YP_004350.1| hypothetical protein TTC0375 [Thermus thermophilus HB27]
    MDRTHERVLQAMAENLGEGLPRAIPLLAEKAPGLLLEHGRSWTYAMPEKGALDEKTRTLILLGIALATGSEACVKAMAHR
    AKRLGLSKEALLETLKIARQAQANAVLGHAAPLLEVL

    >gi|46198779|ref|YP_004446.1| thiol:disulfide interchange protein dsbA [Thermus thermophilus HB27]
    MPRAIVLVVLGLALLGLGWILWGPKGKAGLDPAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPRLKAEYIDTGK
    VRYLFRDFPFPGQANVIRASEAAACAAEQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVDLAGQIGLDEGAFAACLASGR
    HREEVLADQKLATDLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALAKAE

    >gi|46198792|ref|YP_004459.1| putative transferase/hydrolase [Thermus thermophilus HB27]
    MYETQVQELSPEEAKRLYDQGVPFFDVREVEEYAQARIPGARLLPLSEFMARYGEIPKDTPVVLYCRTGNRSWQAAAWLS
    AQGYRVYNLEGGIVRWYRAGLPVDTTPMEAAYRATPYQEVGPEEAKALLEEAFVVDVREAWEYGEGHVPGAVNIPLSTLP
    QRLAELPKDRPILLV
    CNSGNRSGVAAEFLVAQGFDGERVYNLEGGTYAWASRGLPLER

    >gi|46198793|ref|YP_004460.1| hydroxyacylglutathione hydrolase [Thermus thermophilus HB27]
    MIFRQIHEEGLAQMSYLLGCAATGEALVVDPRRDVDVYLELAQSLGLRITAIAETHIHADYLSGARELARATGATLYLSD
    EGDENWKYKGLEGFPHVLLKDGDEFKVGNIRVRAVHTPGHTPEHLSFLVADGAVTDEPLLFLTGDFVFVGDVGRPDLLEE
    AAGIKGTAEPGARRMFRSLKEKFLTLPDHVQVWPGHGAGSACGKALGALPATTVGYERRHAWWAEYLERDDEEGFVKALL
    QGQPEAPTYFREMKRLNRDGMAILGGLPHPGRLTQAQFERWLREGAILVDTRDKFAFAGGHIPGSINIPAGKNFSTWAGW
    LLPYDRPLVLLARPEEVEALTRALVRIGLDEVVGYIPGLEGYAQGELETVPQVTAKEAKELWEKGKAFVLDVRGRDEYLA
    GHIPGAQNIHAGRVLAHLDRLPKDRPLIVH
    CVGGDRSSTAISALLAHGFRNALNLTGGIKAWREAGFPVVQGEELVQA

    >gi|46198794|ref|YP_004461.1| glutaredoxin-like protein [Thermus thermophilus HB27]
    MALLGPKEQEIVRERLANLTRDVEMVLFTDSSTLIAPGKEPCLYCKETKQLLEELSALSDKLHLVVYDLATPEGKEKAGA
    YKVEAAPTLILREKGSEAINLRYRGIPAGYEFASLLEDIEMLGRDGHGLPENVVQELNDLPEEVVLQVFVTPT
    CPYCPQA
    VRTAHRLAYASPKVWGEMIEANEFPALSDRYHIHGVPDTIINHGKERVLGAQPLSQFLQAIRKAVGVRA

    >gi|46198795|ref|YP_004462.1| putative transferase/hydrolase [Thermus thermophilus HB27]
    MTRRALFGPKVAPLIQAASLTLALLLFLAACGPKGSYENVGPEELYEALAAGALVVDVRTPGEFAQGHVPGAINLPVEEV
    ARWADRIPKDRPVYLY
    CRSGNRSRKAAEYLARKGYTNLYNVEGGVLAIARAGYPLVR

    >gi|46198796|ref|YP_004463.1| thiol:disulfide interchange protein tlpA [Thermus thermophilus HB27]
    MDALQVGPLAIPWVRVQVALALLALVGVAELFARRVDRRLSSWGQGAVFVGLLGARLGFVLENASVYAKDPLAVLYVWQG
    GFDPWWGILAGGGYTLMALPKHLWRYALGAALAAALVAGVFLVRKAPAQEARLPDLTLTTLGGTEVRLSDFRGKPLVLNA
    WATW
    CPPCRRELPMMVRLAQENPEVRFAFVSQGEGPLVVKNFLEERGLSPEWVLLDPETRLAQALGIQGLPTTFFFDREG
    RLVARHLGELSEALLLGYLRVLR

    >gi|46198930|ref|YP_004597.1| hypothetical protein TTC0622 [Thermus thermophilus HB27]
    MGNRLKAARSPYLLAHAEDPVDWYPFGEEAFRKAQAEDKPIFLSVGYASCHWCHVMHRESFQDEEVARLLNAHFVPVKVD
    REERPDVDAAYMRALVSLTGQGGWPMSLFLTPEGKPFFGGTYFPKEDRMGLPGFKRVLVAVAEAWAGKREAILEEAERLT
    RALWKSLTPPPGPLPEGAEEEALDHLERAFDPEWGGFLPAPKFPQGPLLLYLLARAWEGEERAARLLRPTLRAMALGGVY
    DQVGGGFHRYSVDRFWRLPHFEKMLYDNALLARVYLGAYKLFGEDLFLRVARETLDWLLSMQRREGGFHTALDAESEGEE
    GRYYTWAEVELREALGEDFPLARRYFALGEDLGERSVLTAWGEAEARKVLGEGFFAWREGVRAKLQGARRRRMPPALDDK
    VLADWSALAVRALAEAGRLFGEERYLEAARRGARFLLAHMYREGLLRHTWRGSLGEEAYLSDQAFAALAFLELYAATGEW
    PYLDWAQRLAEAGWRLFREGPSLPLPAKEVEEGALPSGESALAEALVRLGAVFGGDYRERAEEVLAEKARWLARYPHALP
    GALLAKALWERGTELALPLPSPLLETARGAFLPLTQLVLGPAGALPALEGREAGKAYVCRRGVCLLPVDRWEEVEARVRG
    DD

    >gi|46198974|ref|YP_004641.1| thiosulfate sulfurtransferase [Thermus thermophilus HB27]
    MGYAHPEVLVSTDWVQEHLEDPKVRVLEVDEDILLYDTGHIPGAQKIDWQRDFWDPVVRDFISEEEFAKLMERLGISNDT
    TVVLYGDKNNWWAAYAFWFFKYNGHKDVRLMNGGRQKWVEEGRPLTTEVPSYPPGRYEVPYRDESIRAYRDDVLEHIIKV
    KEGKGALVDVRSPQEYRGELTHMPDYPQEGALRAGHIPGAKNIPWAKAVNPDGTFKSAEELRALYEPLGITKDKDIVVY
    C
    RIAERSSHSWFVLKYLLGYPHVKNYDGSWTEWGNLVGVPIAKGEE

    >gi|46199095|ref|YP_004762.1| mercuric reductase [Thermus thermophilus HB27]
    MTYDLLIVGSGSAGVAAALEASALGAKAAVVEAGVLGGTCVNVGCVPSKYLLRAADAFHRARHPAFPGLRTEALGVDWKA
    LLAGKEGLIAALRKEKYQEVLEAAGVPVLRGRARFLDGERMEVEGREVLAGRYLLATGARPFLPPIPGLRESAPWTYLEA
    LSAPALPESLLVVGGGPIGLELAQAFARLGSRVTVLEALPEVLPQEDRELARLLRGYLEEEGLRVHTGVRVEAVAREGAF
    RVRTDRGVFEAERLLVATGRRPDLEGLGLERAGVERDERGFLRLDPSLRTTNPRVYAAGDAAGLPQFVYVAAQSGRVAAR
    NALGVKAPLDLAALPRVTFTDPALAAVGLTEEEARRRYGAGVRAATLPLSQVPKALTVRDARGAFKIVVDEEGTVLGLHV
    LAHEAGDVIQEGILAVKYGLGYRDLIDTFHPYLTLAEGIRLVAQALDADPKKLSC
    CA

    >gi|46199237|ref|YP_004904.1| bacterioferritin comigratory protein [Thermus thermophilus HB27]
    MPAMEVGTLAPDFALPDQEGRTHRLSDYRGRWVVLYFYPKDDTPGCTKEACGFRDQMGSLKALDAVVLGVSADDVESHKR
    FAEKYGLNFPLLADPERKVIGAYGAWGKKNLYGKEVEGVLRQTFLIDPEGRIARVWRKVSPEGHALEVAEALKALRGA

    >gi|46199281|ref|YP_004948.1| molybdopterin biosynthesis moeB protein [Thermus thermophilus HB27]
    MRWTKEELDRYHRQMILPQVGPEGQERLKRASVVVVGAGGLGVPVLQYLVAAGVGRVGVVEMDRVEVSNLHRQVLYTTED
    VGEPKALVAQKRLQALNPLVRVEAYPVRLTSENALEILRPYDLVVDASDNFPTRYLVNDAAVLLGKPLVFGAIYQFDGQV
    AVFHHPTLHGEMGPCYRCLFPKPPPPGAVPS
    CAEAGVFGVLPAVVGSLMAAEALKVLLGIGKPLAGHLLLYDALEASFRK
    LTVRRNPRCPVCGDEPTQRELVDYEAFCGLR

    >gi|46199309|ref|YP_004976.1| hypothetical protein TTC1007 [Thermus thermophilus HB27]
    MTKKVVVHQIVGHRFLGVNEQGDKVMIDGDQPSTGPRPMELLLMALGACTAYDVVDIMRKKKQPLARYRVEVEGERAETH
    PKRYTRITVTHIASGPGVTLEALERAVHLSHTKYCSVSATLNAEITTRVVLEPWEGEEEEG

    >gi|46199339|ref|YP_005006.1| ccmG protein [Thermus thermophilus HB27]
    MRGWLWLLVVLALGGLFWWGMQRNPKELPSVLAKERRPAPDFTLPLLPPYRAEWGEAFRLADHLGKRPIVLNFWASWCYP
    A
    CYEEAPILEASWRRHREEVLFVGVNTQDKEEEALRFIAQFGLTFPQVYDPRGRVGVDYGMYGVPETFFIDREGRVLARH
    AGAIDEATLARYLEEALR

    >gi|46199351|ref|YP_005018.1| putative sulfurtransferase [Thermus thermophilus HB27]
    MRRRDLLALLPFLALARGQGGAGEDWTEAFGRFLKAVPPAGYLVYPTEARDLLLFEPFVLDVRTAEERKRGYIPGSVHIY
    AGEVPDRLGELPRDKEALILVY
    CNSGSVSAVVAAFLQAKGYKNAKNIAHGFKGWLDAGLPVEGA

    >gi|46199359|ref|YP_005026.1| thioredoxin [Thermus thermophilus HB27]
    MSSWGTLAVYRMRKVYTLLLSALLLWAWALPDFGRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSR
    LLEARFVVASVSVDTPEGQELARRYRVPGTPTFVFLVPKAGAWEEVGRLFGSRPRAEFLKELRQVCVKGGACG

    >gi|46199419|ref|YP_005086.1| thioredoxin [Thermus thermophilus HB27]
    MVVTCPKCGAKNRLGTPPPGQVPVCGACKTPLPWVVEADEKGFAQEVAGAPLTLVDFFAPWCGPCRLVSPILEELAREHA
    GRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPKRVLEERLRPYLEGR

    >gi|46199560|ref|YP_005227.1| thiosulfate sulfurtransferase [Thermus thermophilus HB27]
    MNLPEDAVLVDTRPRPAYEAGHLPGARHLDLSAPKLRLREEAELKALEGGLTELFQTLGLKSPVVLYDEGLTSRLCRTAF
    FLGLGGLEVQLWTEGWEPYATEKEEPRPERTEVVAKLRRDWLLTADEAARHPLLLDVRSPEEFQGKVHPPCCPRGGRIPG
    SKNAPLELFLSPEGLLERLGLQPGQEVGVY
    CHSGARSAVAFFVLRSLGVRARNYLGSMHEWLQEGLPTEP

    >gi|46199563|ref|YP_005230.1| osmotically inducible protein C [Thermus thermophilus HB27]
    MPVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGCFSMALAASLEREGFPPKRVSTEA
    RVHLEVVDGKPTLTRIELLTEAEVPGISPEKFLEIAEAAKEG
    CPVSRALAGVKEIVLTARLV

    >gi|46199574|ref|YP_005241.1| hesB protein [Thermus thermophilus HB27]
    MVETQEAVIRITPLAAEKAKEILARYGKEHAAIRVYIKSGGCSGFQYGMAVDERELPGDTFVEMHGVRLVVDRMSLPYLV
    GSEIDWVESLMGGGFTVHNPNAVSTCGCGHSFRTKDQEGTPRTCGH

    >gi|46199658|ref|YP_005325.1| heavy metal binding protein [Thermus thermophilus HB27]
    MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVKVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA

    >gi|46199660|ref|YP_005327.1| cation-transporting ATPase pacS [Thermus thermophilus HB27]
    MAQEIKVGVRGMTCAACVARVERALKRAEGVEEARVNLTTEEAFLRLQEGVDLKEVLRQVEEAGYEPVVARAEIPVKGMT
    CAACVARVERAIKRLPGVVSATVNLTAEKAFVEYLPDTVSLARIRQAIREAGYEPLEGTEEARKEAPTYRKDLLLALPFA
    LLTLLLAMGPMLLPLPHFPGFLQALAALPVLYAGRRFFRQALAEARHLAFGMSTLVALGAGSAYLYSFLVLLFPGLFPEE
    ARHLYFEAGAVILTLILLGKHLEEGAKGKASEAIRKLLALRPKTARVVQDGEEKEVPAEALIPGDVVRVLPGERIPADGV
    VLEGQSHVDESMLTGEPIPKAKGPGDEVVGGTVNGEGALLVRVSRVGEATFLAQMARMVEEAQGHKPKVQELADRIAGVF
    VPVVLGIALLTFLLWLFLGPGLAHAFVAALAVLLIACPCAMGLATPAAIAVATGRAAEMGLLFRKGTALEALARADTVVL
    DKTGTLTRGKPTLVRVLPFGLSQEEALRLAAALERGSEHPLAKAVLEAAESLPQAQAEEVRALPGEGVEGRVEGRRLHLG
    GPALMERLGVPLPEEAKALPEEGYTPLYLVEGTRLLAAFAVFDPPRPEAQEAVAALKALGLKLVLLTGDHPAPARRVAEA
    LGIPEVLAGVRPEGKVEAIRRLQAEGRKVVFVGDGINDAAALAQADVGLAMGSGTDIALEAGDVVLLTPDLRGVVNAVRL
    ARRTLRTIYLNFFWAYAYNVVLIPVAAGALYPFTGLLLNPMLAAAAMSLSSLFVLTNSLRLRAFRPQALPSLNPAASS

    >gi|46199687|ref|YP_005354.1| thioredoxin [Thermus thermophilus HB27]
    MAKPIEVTDQNFDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILF
    KDGQPVEVLVGAQPKRNYQAKIEKHLPATA

    >gi|46199786|ref|YP_005453.1| NADH oxidase [Thermus thermophilus HB27]
    MGKRMVVVGGVAGGASAAAKAKRENPELEVVVYEKSGWVSYGACGLPYVLSGEIPRLERLVARTPEEFRKQGVLVHTRHE
    VVDVDYELRTLTVHDHAEGRTFQDRFDHLVLATGARPSLPPIPGTEQEGVYTLRTMEDGERLLKALPQARRAAILGAGYI
    GLEAAEAFRKRGLQVTLLEAKDRPLPHWDPEVGALLKEELERHGVEVWTGVKVEAFRGMGRVEAVETSEGVVPADLVLLA
    TGIRPNTELAQAMGVALGPTGAIATDERMRTNLEGVYAAGDVAESFHRVLKRPYWLPLGDVANKHGRTAGSVIAGREARF
    LGVVGTAIFKAFDLAVATTGLSLEGALKEGFWAKKVFIQSRDGAHYYPGSGPLWVELVYEEGTGRLLGGAVVARGHGALR
    IDVLAALLHREGSVEDLLALDLAYAPPFSPVWDPLLIAAQQAR

    >gi|46199857|ref|YP_005524.1| thioredoxin reductase [Thermus thermophilus HB27]
    MEFNLSALGSTPAAEETYDVVIIGGGPAGLTAGIYAGRAQLKTVIVEKGLPGGQIAQTDEVENYPGFPEGISGPELASRM
    VRQAEKFGARIVMDEVLGLEKAEGGYLVRGYERNYRARAVIVATGANPRRLGVPGEDKFYGRGVST
    CATCDGFFYRDKEV
    VVVGGGDAAVEEGIFLTKFARKVTLVHRRDELRANKVAQKRAFQNPKMHFLFSHVVTEILGEDQVTGVRLKNLKTGEEYV
    YPTDGVFVFIGHEPNTAFLKGVVELRPDGYIAVRDEVFTSEPGIFAAGDVADPIYRQLTTSVGAGTRAAMMAERYLAEEA
    EKVKG

    >gi|46199982|ref|YP_005649.1| hypothetical protein TTC1680 [Thermus thermophilus HB27]
    MRRAGGGLDGAERQHLRHASRLGRGTKLRPLPPHARPARGGSGDHPGARPRHPPPPGARGRGKRRAAPPRGGRGRGRDPL
    AGGRRLPADGGARVRTPASPHALNPGGPPYTLRGMVRVYGVPG
    CGPCEIVKMFLAQKGVPFEFVNAREDEEARKKVTALA
    GSPTAGVVLEWEGGTEVIRGVSPASLHAWLARYRGKEA

    >gi|46200002|ref|YP_005669.1| dihydrolipoamide dehydrogenase [Thermus thermophilus HB27]
    MRTRRGSFWRCSVYDLLVIGAGPGGYVAAIRAAQLGMKVGVVEKEKALGGTCLRVGCIPSKALLETTERIYEAKKGLLGA
    KVKGVELDLPALMAHKDKVVQANTQGVEFLFKKNGIARHQGTARFLSERKVLVEETGEELEARYILIATGSAPLIPPWAQ
    VDYERVVTSTEALSFPEVPKRLIVVGGGVIGLELGVVWHRLGAEVIVLEYMDRILPTMDAEVSRAAERVFKKQGLTIRTG
    VRVTAVVPEAKGARVELEGGEVLEADRVLVAVGRRPYTEGLSLENAGLSTDERGRIPVDEHLRTRVPHIYAIGDVVRGPM
    LAHKASEEGIAAVEHMARGFGHVDYQAIPSVVYTHPEIAAVGYTEEELKAQGIPYKVGKFPYSASGRARAMGETEGFIKV
    LAHAKTDRILGVHGIGARVGDVLAEAALALFFKASAEDLGRAPHAHPSLSEILKEAALAAWERPIHL

    >gi|46200055|ref|YP_005722.1| dihydrolipoamide dehydrogenase [Thermus thermophilus HB27]
    MKTYDLIVIGTGPGGYHAAIRAAQLGLKVLAVEASEVGGVCLNVGCIPTKALLHAAETLHHLKVAEGFGLKAKPELDLRK
    LGGWRDQVVKKLTGGVGTLLKGNGVELLRGFARLVGPKEVEVGGERYGAKSLILATGSEPLELKGFPFGEDVWDSTRALK
    VEEGLPKRLLVIGGGAVGLELGQVYRRLGAEVTLIEYMPEILPQGDPETAALLRRALEKEGIRVRTKTKAVGYEKKKDGL
    HVRLEPAEGGEGEEVVVDKVLVAVGRKPRTEGLGLEKAGVKVDERGFIRVNARMETSVPGVYAIGDAARPPLLAHKAMRE
    GLIAAENAAGKDSAFDYQVPSVVYTSPEWAGVGLTEEEAKRAGYRVKVGKFPLAASGRALTLGGAEGMVKVVGDEETDLL
    LGVFIVGPQAGELIAEAALALEMGATLTDLALTIHPHPTLSESLMEAAEAFHKQAIHILNR

    >gi|46200124|ref|YP_005791.1| thio-disulfide isomerase/thioredoxin [Thermus thermophilus HB27]
    MTKLWTLLVAGALSLALAVKPGEPLPDFLLLDPKGQPVTPATMSKPAVIVFWASWCTVCKAEFPGLHRVAEETGVPFYVI
    SREPRDTREVVLEYMKAYPRFIPLLASDRDRPHEVAARFKVLGQPWTFVVDREGKVVALFAGRAGREALLDALLLAGADL
    P

    >gi|46255166|ref|YP_006078.1| methionine sulfoxide reductase A [Thermus thermophilus HB27]
    MPEEIATLAGGCFWCTEAAFKLLRGVLEVVPGYAGGHVPHPTYEEVCTGTTGHREAVQVRFDPGVLPYADLLRYFFAVHD
    PTSEDRQGPDVGPQYSPAIFYHSEEQKRVAEAVMRELAPLYPKPIATKLLPFTTFYPAEAYHRDYFARHPEAPYCRLVIA
    PKLEKARKAFKSLLRP

    >gi|46255239|ref|YP_006151.1| hypothetical protein TT_P0168 [Thermus thermophilus HB27]
    MSASEGPPWAAKARSRRLPAKAAESPVAVSTLMNCLRARIRSITASFKGEGFPPRPSLRRKGWGWISSSGTFPLCVRKDR
    MVRTLTRETTPRELLSFFARHRHTGRLTLGFAPGLGLTLELAGGRLAALGGPLVPRVGRVLEALGLQGLAGALVRGARLS
    ALPGGEEAQRLRFLVALSPFWDRLASFSFRPLDLPPVGPPLGRLLEEVEAHAHPPGPPLDPLARFAVPEDLGPAGGRLWA
    LEPEELRFLGLFGAGAPLALAAVRGLYPWDAFVPRVRALEALGLLGEASRPGPALRPGDPAPPFTLEALDGTLFSLGEMR
    GRKVLLAFFRHGG
    CPFCNRRVHELKASYPELRALGVEVVGVFGSPRESLLHRVGRQNPPFPLLADPDDRVHALYRTRTSL
    LGLLDPRALPYYLEGLRLGIPHGATDGELFRMPAEFLIGEDLRIARAHYGRNGADRLPLEEVLRWAR

    >gi|46198323|ref|YP_003990.1| hypothetical protein TTC0015 [Thermus thermophilus HB27]
    MELVFVTREGCGLCEKAERALWALGVPYLRRDVDRDPELFARYTFRVPVLLWGEEVLLEGAFGERELVEVAARLGGGTWT
    R