Thermotoga petrophila RKU 1 uid58655

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148269185|ref|YP_001243645.1| methylated-DNA--protein-cysteine methyltransferase [Thermotoga petrophila RKU-1]
    MRVPGNISVQTENGKVVKIILGSNETEGPEEILREIEEYLSGQRKSFSFQVEIRGTPFQKRVWEEVRKIPYGETKTYSEI
    AKKLGTSPRAVGQALSKNPLPLYIP
    CHRVVSKKGLGGFSAGLEWKKYLIDLERFRK

    >gi|148269203|ref|YP_001243663.1| thioredoxin reductase [Thermotoga petrophila RKU-1]
    MVFFDTGSIKKKEIKDKYDIVVVGGGPAGLTSAIYARRAGLSVLVVEKAIEGGYVNLTHLVENYPGFPAISGEELASKFK
    EHAEKFGADIYNAEVVKLEVLGDKKVVELDDGKKIEAPVVIVATGANPKKLNVPGEKEFFGKGVSY
    CATCDGYLFAGKDV
    IVVGGGDSACDESIFLSNIVNKITMIQLLETLTAAKVLQERVLSNPKIDVIYNSTVKEIRGKDKVEEVVIENVKTGETKV
    LKADGVFIFIGLDPNSKLLEGLVELDPYGYVITDENMETSVKGIYAVGDVRKKNLRQIVTAVADGAIAVEHAAKHYF

    >gi|148269204|ref|YP_001243664.1| glutaredoxin-like domain-containing protein [Thermotoga petrophila RKU-1]
    MGILSDKDIAYLKDLFGKELKRKVKIVFFKTKDKTRCQYCEITEQVLEELVSVDPKLELEIHDFDSDKEAVEKYQVEMVP
    ATILLPEDGKDYGIRFYGVPSGHEFGTLIQDIITVSEGKPQLSEESIQKLQSLEEPIRISVFVTPT
    CPYCPRAVLMAHNM
    AMASDKIIGEMIEANEYWELSEEFGVSSVPHIVVNRDPSKFFVGAYPEKEFINEVLRLAKG

    >gi|148269266|ref|YP_001243726.1| peroxiredoxin [Thermotoga petrophila RKU-1]
    MEGRIPLIGEEFPRLEVKTTHGKKILPDDFRGKWFVLFSHPADFTPVCTTEFVAFQKRYDEFKKLNTELIGLSIDQVFSH
    IKWIEWIKEKLGVEIEFPVIADDLGEVSRRLGLIHPSKGTNTVRAVFIVDPNGIIRAIVYYPQEVGRNIDEILRAVRALQ
    TSDEKGVAIPANWPSNELINDSVIVPPASSVEEARERLESKDFECYDWWFCYKKV

    >gi|148269293|ref|YP_001243753.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermotoga petrophila RKU-1]
    MLKSGDKAIDFELVNTDLKMVKLSDFSGKNVVLAFYPGAFTSVCEKELCTFRDSLSKFNRLNAVVLGISVDSPFANKAFA
    EKNHITFDLLSDFGGRVASQYGGVHENFLNIPGYTAAKRAVYVVDGGGTIVYSWVSEDPGKEPPYEEIEEALERLSK

    >gi|148269668|ref|YP_001244128.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermotoga petrophila RKU-1]
    MKYDVVVVGGGPAGLVAAFTTKRFFGDKKILVIKKTEKEMVPCGIPYIFHTLGSVENDYMGIEDRFKSAGIDLLIDEVVD
    GNPDEKKLLAKSGKEISYDKLIIATGSSPNTPKIPGVDLKDVFTVPKEADYLKLLHEKVKGAKDVVIIGGGFIGVEVADE
    IKKSGKNVTLVEIMDSLLPVSFDPDFGELARKELESDNVKVLTGRKVTEILGTEKVEGVKLDSGETIPADVVVLATGYRP
    NSELAKKLGLKVTELGFIETDEYMRTSKPDIFAAGDCVQHKDFLTGKPSRLMLASAAVFDARIAASNLYGLKVIRTNKGS
    LNAYSTVIGSKAFGSVGITERIAKEEGFEVVVGKAEAPDRHPGKFEDTSKLLVKLIFSEDSKILLGAQVCGGKSVGEIVN
    LISLGIQKGITANDLFTMQIGTHPLLTSAPTVYPLAKAAEMVL

    >gi|148269669|ref|YP_001244129.1| alkylhydroperoxidase [Thermotoga petrophila RKU-1]
    MAAKEKLEQIQKQLQEIIGKAPEIGKFAEYVHAAESTKALDTKTKELISLGIAVAVRCEPCIVWHTGAAVKAGATEEEIL
    DTIKVAVCMGGGPALMYGLKAYEIALEFLGK

    >gi|148269670|ref|YP_001244130.1| dihydrolipoamide dehydrogenase [Thermotoga petrophila RKU-1]
    MYDAVIIGGGPGGYVCAIKLVQLGKKVALVEKDALGGTCTNRGCIPTKAMLTVSHLMDEMKEKASKYGLKVSGVEYDVDT
    IMKHVQKSVMMSRKGIEYLLNKNGVEVFKGTAVVENKNTVVVQETGEKLEAKNLVLAHGSVPSVFSPFDIDGVWTSDDVF
    NLKEFPKSLVIIGGGVIGVEFATFFGSFGVDVTIVEIAEHILPYEDSDVAEEVKKALKRKGVKILEKTKVSSLSKVDDGF
    EVALENGETLKAEKVLLAAGRKPNIPEDVKALGVKIEKGVVTDSRMRTNVENVYAIGDIRSGIMLAHVAMYEGIVAAKNI
    AGEEEEMDYSAVPSIIFSSPEVASVGVREKDVNPEEVVISKFPVSANGRARTMLENIGFAKVIADKKDRTVLGMSIVSPS
    ATDMIMEGVIAVKFRMKAEDLEKAIHPHPTLTETILGALEGVSGKPIHL

    >gi|148269675|ref|YP_001244135.1| nitroreductase [Thermotoga petrophila RKU-1]
    MRVRHFELLTDEGKTFTHVDLYGKYTILFFFPKAGTSGCTREAVEFSKENFEKAQVVGISRDSVEALKRFKEKNDLKVTL
    LSDPEGILHEFFNVLENGKTVRSTFLIDRWGFVRKEWRRVKVEGHVQEVKEALDRLIEEDLSLNKHIEWRRARRALKKDR
    VPREELELLIKAAHLAPSCMNNQPWRFVVVDEEELLKKIHEALPGGNYWMKNAPALIAVHSKKDFDCALPDNRDYFLFDT
    GLAVGNILVQATQMGLVAHPVAGYDPVKVKEILKIPEDHVLITLIAVGYLGDESELSEKHRELERSERVRKELSEIVRWN
    L

    >gi|148269737|ref|YP_001244197.1| heavy metal translocating P-type ATPase [Thermotoga petrophila RKU-1]
    MEDRAAKNEEIKKTFTVTGMTCATCAKTVEKTLKKLDGVKFAAVNLATSTGFIVAEKEISFEEIKKAVEEVGYGVTTESP
    EDVERKRYEESKRNLILAWLVTAPLALLMIYHMFVSEVPYFTWIEVFAGAFVTFYVGRGTIRGAWIALTHKHTNMDTLIF
    FGAVTSWVTALLDSVGLPVMSFGAIGAMIVAFHITGRFIESYLRDRASKEIKALLKLQAKEARVITDEGEVMMPIEAVKE
    GFIVLVKPGERIPVDGVIVEGQSSIDESVVTGESIPVLKRENDEVIGGSLNVSSPIKIKVTKVGEDTFLSQMVKLIQEAQ
    GSKVPIQALADRITMWFVPTIIVLAITSALVWYFNYERFLPFVEKAREIFPWIIQTSDPLTFSVFVFVATIVIACPCALG
    LATPMALVTGTGLAAKKGLLIRNAEAIQTSKDVGVVLTDKTGTLTEGSPKVVDHNLSAELIKIVTSIERNSNHPLAKAIS
    ELSQNVVEVESVEEVPGEGVRARYKGEEYFVGKPLDYSKYESLLEEGKTVVEVRRNGEVVGFLAIEDPIREDSSEAVRKL
    KEMGIEPVMITGDNEKTAKAVARRLGIERFHAGVKPSEKLDLVRSYQAQGKKVAMVGDGMNDAAALKGADVGIAIGSGTD
    LAIDSADIIITKGGISKVVDAIEISRKTFKIIKQNLFWAFFYNVVAIPMAMMGLLHPVIAELAMAFSSITVTLNSMRVRE


    >gi|148269738|ref|YP_001244198.1| alkylhydroperoxidase [Thermotoga petrophila RKU-1]
    MNEFERWRREFPEVSGAVVRMRNKAFSDGSIPAKYKVLAALAIAVVEKCKPCAQGYYQKAIEMGATKDEIKEILEVAVTM
    GACIAETWAREVWQYERSENDGGSCCEE

    >gi|148269812|ref|YP_001244272.1| electron transport complex, RnfABCDGE type, A subunit [Thermotoga petrophila RKU-1]
    MKVFLLFFSAIFVNNFVLARFLGICPFLGVSKRLETATGMGIAVTFVMTVSAAISWFLDKLLISTGLEFLRTIVFILVIA
    SFVQFVELFLKKTSPDLYEALGIFLPLITTN
    CAILGMVLLNSLMKLNFVEAVFHALGSGLGFALALVIFAGIREKMDLYD
    LPEPFKGTAIALITAGLLSLAFMGFQGMVKL

    >gi|148269813|ref|YP_001244273.1| electron transport complex RsxE subunit [Thermotoga petrophila RKU-1]
    MSRLRELTKGIIKENPTYVQVLGMCPTLAVTTSAINGLGMGLATTAVLTMSNVVISLIRKIVPDKIRIPIFIVVIASFVT
    MIDLLMHGFAYDLWKTLGLFIPLIVVN
    CIIMGRAESFASKHGVLDSMLDGLGVGLGFTGSLVLLGSIRELFGNGTIFGYK
    VWELKIFLEILPPGAYITLGLLSALFTYIGIRRKKRGEAK

    >gi|148270301|ref|YP_001244761.1| alkylhydroperoxidase [Thermotoga petrophila RKU-1]
    MEYKKFVETRRELNEKVISRGTLNTKRFFNLDSAVYRPGKLDVKTKELMGLVASTVLRCDDCIRYHLVRCVQEGASDEEI
    FEALDIALVVGGSIVIPHLRRAVGFLEELREMEKNGEAISL

    >gi|148270725|ref|YP_001245185.1| thioredoxin-related protein-like protein [Thermotoga petrophila RKU-1]
    MKRFLIIAILALSVISLALTLDDAYRLANITQRKLIMMFSSPTCYYCNLFKKEVFPKEDFQEILIPNFVFVELYATDEKT
    TLFAKEVLGEESVSYRDLFAGFGVRGTPTFFFFKGKEGLGYLPGYVDKDNFIKILKYVAQELKEDFQTYLKKDDPFVGEP
    LIIEISKEDADFVLKKDKNAVKVDTVPNEVRRDRIYVTDSPDVAKTLQEKGALRVLLVK

    >gi|148270840|ref|YP_001245300.1| YruB family glutaredoxin-like protein [Thermotoga petrophila RKU-1]
    MQHLKIKIYTTPTCPYCRKAKEYFRSLGLEFKEVDVTKNPREAELMVKKTGQMGVPVIEIGNKIVIGFDKAKIDRILGIS


    >gi|148270866|ref|YP_001245326.1| redox-active disulfide protein 2 [Thermotoga petrophila RKU-1]
    MAKKVEILGKGCPRCKQTEKIVRMAIEELGIDAVVEKVQDIDEIISRGVVATPAVAVDGKVVISGRIPSLDEVKKVLQQA


    >gi|148270876|ref|YP_001245336.1| protein of unknown function DUF395, YeeE/YedE [Thermotoga petrophila RKU-1]
    MVWTGLLIGVLFGVILQRGRICFNSAFRDVLIFKDNYLMRLAALTLGLESITLLIFAQAGIITLNPKPLNWIGNIVGGFI
    FGIGMVLAGG
    CASGVTYRTGEGMTTAWFAALAYALTAHATSKGLFSGWIKWLNNYTVTVSNTNPIYAPKTGPTIATVLGI
    SPWIASIIFLALMLWYAFGVKNKSQRPSKLNWIAASVLIAILAPIAWWASASTGRNYGLGITGGWINLVSVYANNAPLNW
    GGAEILGIIIGAAISAIAGKEFKLRMPKNPKTYAQVLLGGFLMGFGAVTAGG
    CNIGHFLTGVPTLAISSIVASIFFILGN
    WTMAWFLFGRQK

    >gi|148270877|ref|YP_001245337.1| DsrE family protein [Thermotoga petrophila RKU-1]
    MKIGIQVMVPPYTYEDLDTAIKIAEAAMEKGHEVTLFLFADSVICTNKNIKPIKIDRNIPQKLVELMQKGNFEVHICGIC
    MDYRGITTDMIIEGSKPSGLPELANLIATCDRFINLMA