Thermotoga naphthophila RKU 10 uid42777

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|281411483|ref|YP_003345562.1| methylated-DNA/protein-cysteine methyltransferase [Thermotoga naphthophila RKU-10]
    MRVLGNISVQTKNGRVVKIILGSDKSEGPNEVLREIEEYLSGQRKNFSFQVEIRGTPFQKRVWEEVRKIPYGETKTYSEI
    AKKLGTSPRAVGQALSKNPLPLYIP
    CHRVVSKKGLGGFSAGLEWKRYLIDLERARK

    >gi|281411501|ref|YP_003345580.1| thioredoxin reductase [Thermotoga naphthophila RKU-10]
    MVFFDTGSIKKKEIKDKYDIVVVGGGPAGLTSAIYARRAGLSVLVVEKAIEGGYVNLTHLVENYPGFPAISGEELASKFK
    EHAEKFGADIYNAEVVKLEVLGDKKVVELDDGKRIEAPVVIVATGANPKRLNVPGEREFFGKGVSY
    CATCDGYLFAGKDI
    IVVGGGDSACDESIFLANIVNKITMIQLLETLTAAKVLQERVLSNPKIDVIYNSTVKEIRGKDKVEEVVIENVKTGETKV
    LKADGVFIFIGLDPNSKLLEGLVELDPYGYIITDENMETSVKGIYAVGDVRKKNLRQIVTAVADGAIAVEHAAKHYF

    >gi|281411502|ref|YP_003345581.1| glutaredoxin-like domain protein [Thermotoga naphthophila RKU-10]
    MGILSDKDIAYLKDLFGKELKRKVKIVFFKTKDKTRCQYCEITEQVLEELVSVDPKLELEIHDFDSDKEAVEKYQVEMVP
    ATILLPEDGKDYGIRFYGVPSGHEFGTLIQDIITVSEGKPQLSEESIQKLQSLEEPIRISVFVTPT
    CPYCPRAVLMAHNM
    AMASDKIIGEMIEANEYWELSEEFGVSSVPHIVVNRDPSKFFVGAYPEKEFINEVLRLAKG

    >gi|281411562|ref|YP_003345641.1| Peroxiredoxin [Thermotoga naphthophila RKU-10]
    MEGRIPLIGEEFPRLEVKTTHGKKILPDDFRGKWFVLFSHPADFTPVCTTEFVAFQKRYDEFKKLNTELIGLSIDQVFSH
    IKWIEWIKEKLGVEIEFPVIADDLGEVSRRLGLIHPSKGTNTVRAVFIVDPNGIIRAIVYYPQEVGRNIDEILRAVRALQ
    TSDEKGVAIPANWPSNELINDSVIVPPASSVEEARERLESKDFECYDWWFCYKKV

    >gi|281411589|ref|YP_003345668.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermotoga naphthophila RKU-10]
    MLKSGDKAIDFELVNTDLKMVKLSDFSGKNVVLAFYPGAFTSVCEKELCTFRDSLSKFNRLNAVVLGISVDSPFANKAFA
    EKNHITFDLLSDFGGRVASQYGGVHENFLNIPGYTAAKRAVYVVDGGGTIVYSWVSEDPGKEPPYEEIEEALERLSK

    >gi|281411615|ref|YP_003345694.1| nitroreductase [Thermotoga naphthophila RKU-10]
    MRVRHFELLTDEGKTFTHVDLYGKYTILFFFPKAGTSGCTREAVEFSKENFEKAQVVGISRDSVEALKRFKEKNDLKVTL
    LSDPEGILHEFFNVLENGKTVRSTFLIDRWGFVRKEWRRVKVEGHVQEVKEALDRLIEEDLSLNKHIEWRRARRALKKDR
    VPREELELLIKAAHLAPSCMNNQPWRFVVVDEEELLKKIHEALPGGNYWMKNAPALIAVHSKKDFDCALPDNRDYFLFDT
    GLAVGNILVQATQMGLVAHPVAGYDPVKVKEILKIPEDHVLITLIAVGYLGDESELSEKHRELERSERVRKELSEIVRWN
    L

    >gi|281411620|ref|YP_003345699.1| dihydrolipoamide dehydrogenase [Thermotoga naphthophila RKU-10]
    MYDAVIIGGGPGGYVCAIKLVQLGKKVALVEKDALGGTCTNRGCIPTKAMLTVSHLMDEMKEKASKYGLKVSGVEYDVDT
    IMKHVQKSVMMSRKGIEYLLNKNGVEVFKGTAVVENKNTVVVQETGEKLEAKNLVLAHGSVPSVFSPFDIDGVWTSDDVF
    NLKEFPKSLVIIGGGVIGVEFATFFGSFGVDVTIVEIAEHILPYEDSDVAEEVKKALKRKGVKILEKTKVSSLSKVDDGF
    EVALENGETLKAEKVLLAAGRKPNIPEDVKALGVKIEKGVVTDSRMRTNVENVYAIGDIRSGIMLAHVAMYEGIVAAKNI
    AGEEEEMDYSAVPSIIFSSPEVASVGVREKDVNPEEVVISKFPVSANGRARTMLENIGFAKVIADKKDRTVLGMSIVSPS
    ATDMIMEGVIAVKFRMKAEDLEKAIHPHPTLTETILGALEGVSGKPIHL

    >gi|281411621|ref|YP_003345700.1| alkylhydroperoxidase like protein, AhpD family [Thermotoga naphthophila RKU-10]
    MAAKEKLEQIQKQLQEIIGKAPEIGKFAEYVHAAESTKALDTKTKELISLGIAVAVRCEPCIVWHTGAAVKAGATEEEIL
    DTIKVAVCMGGGPALMYGLKAYEIALEFLGK

    >gi|281411622|ref|YP_003345701.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermotoga naphthophila RKU-10]
    MKYDVVVVGGGPAGLVAAFTTKRFFGDKKILVIKKTEKEMVPCGIPYIFHTLGSVENDYMGIEDRFKSAGIDLLIDEVVD
    GNPDEKKLLAKSGKEISYDKLIIATGSSPNTPKIPGVDLKDVFTVPKEADYLKLLHEKVKGAKDVVIIGGGFIGVEVADE
    IKKSGKNVTLVEIMDSLLPVSFDPDFGELARKELESDNVKVLTGRKVTEILGTEKVEGVKLDSGETIPADVVVLATGYRP
    NSELAKKLGLKVTELGFIETDEYMRTSKPDIFAAGDCVQHKDFLTGKPSRLMLASAAVFDARIAASNLYGLKVIRTNKGS
    LNAYSTVIGSKAFGSVGITERIAKEEGFEVVVGKAEAPDRHPGKFEDTSKLLVKLIFSEDSKILLGAQVCGGKSVGEIVN
    LISLGIQKGITANDLFTMQIGTHPLLTSAPTVYPLAKAAEMVL

    >gi|281412303|ref|YP_003346382.1| electron transport complex, RnfABCDGE type, E subunit [Thermotoga naphthophila RKU-10]
    MSRLREFTKGIIKENPTYVQVLGMCPTLAVTTSAINGLGMGLATTAVLTMSNVVISLIRKIVPDKIRIPIFIVVIASFVT
    MIDLLMHGFAYDLWKTLGLFIPLIVVN
    CIIMGRAESFASKHGVLDSMLDGLGVGLGFTGSLVLLGSIRELFGNGTIFGYR
    VWELKIFLEILPPGAYITLGLLSALFTYIGIRRKKRGEAK

    >gi|281412304|ref|YP_003346383.1| electron transport complex, RnfABCDGE type, A subunit [Thermotoga naphthophila RKU-10]
    MKVFLLFFSAIFVNNFVLARFLGICPFLGVSKRLETATGMGIAVTFVMTVSAAISWFLDKLLISTGLEFLKTIVFILVIA
    SFVQFVELFLKKTSPDLYEALGIFLPLITTN
    CAILGMVLLNSLMKLNFVEAVFHALGSGLGFALALVIFAGIREKMDLYD
    LPEPFKGTAIALITAGLLSLAFMGFQGMVKL

    >gi|281412379|ref|YP_003346458.1| alkylhydroperoxidase like protein, AhpD family [Thermotoga naphthophila RKU-10]
    MNEFERWRREFPEVSGAVVRMRNKAFSDGSIPAKYKVLAALAIAVVEKCKPCAQGYYQKAIEMGATKDEIKEILEVAVTM
    GACIAETWAREVWQYERSENDGGSCCEE

    >gi|281412380|ref|YP_003346459.1| heavy metal translocating P-type ATPase [Thermotoga naphthophila RKU-10]
    MSDQKTMEDRAAKNEEIKKTFTVTGMTCATCAKTVEKALKKLDGVKFAAVNLATSTGFIVAEKEISFEEIKKAVEEVGYG
    VTTESPEDVERKRYEESKRNLILAWLVTAPLALLMIYHMFVSEVPYFTWIEVFAGAFVTFYVGRGTIRGAWIALTHKHTN
    MDTLIFFGAVTSWVTALLDSVGLPVMSFGAIGAMIVAFHITGRFIESYLRDRASKEIKALLKLQAKEARVITDEGEVMMP
    IEAVKEGFIVLVKPGERIPVDGVIVEGQSSIDESVVTGESIPVLKKENDEVIGGSLNVSSPIKIKVTKVGEDTFLSQMVK
    LIQEAQGSKVPIQALADRITMWFVPTIIVLAITSALVWYFNYERFLPFVEKAREIFPWIIQTSDPLTFSIFVFVATIVIA
    CPCALGLATPMALVTGTGLAAKKGLLIRNAEAIQTSKDVGVVLTDKTGTLTEGSPKVVNHDLSAELTRIVASIERNSNHP
    LAKAISELSQDVVEVESVEEIPGEGVRALYGGEEYFVGKPLDYSKYESLLEEGKTIVEVRRNGEVVGFLAIEDPIREDSP
    EAVRRLKEMGIEPVMITGDNEKTARAVARRLGIEKFHAGVKPSEKLDLVRSYQAHGKKVAMVGDGMNDAAALKGADVGIA
    IGSGTDLAIDSADIIITKGGISKVVDAIEISRKTFKIIKQNLFWAFFYNVIAIPMAMMGLLHPVIAELAMAFSSITVTLN
    SMRVRE

    >gi|281412607|ref|YP_003346686.1| alkylhydroperoxidase like protein, AhpD family [Thermotoga naphthophila RKU-10]
    MEYKKFVETRRELNEKVISRGTLNTKRFFNLDSAVYRSGKLDVKTKELMGLVASTVLRCDDCIRYHLVRCVQEGASDEEI
    FEALDIALVVGGSIVIPHLRRAVGFLEELREMEKNGEAISL

    >gi|281412804|ref|YP_003346883.1| NADH dehydrogenase (quinone) [Thermotoga naphthophila RKU-10]
    MFKNAKEFVQYANKLKTLREKKLNGVSIYVCVGTGCTAKGALKVYSAFEEELKKRNLLGQVTLEKIDDDKVTLNRTGCCG
    RCSSGPLVKIMPYRFFYSNVAPEDVPEIVDRTVLKGEPIERLFLTDPLTGEKVPRIEDTTLFKNQDFYIMEAIGESECDS
    IEDYIARGGYESLVKALTSMTPEEIIETVKASGLRGRGGGGFPTGLKWEFTRKAQGDIKFVVCNGDEGDPGAFMNRTLLE
    RDPHLVLEGMIIAGYAVGAQKGYAYIRAEYPFAVKMFKKAIEDARKLGLLGENILGTGFSFDLEVKEGAGAFVCGEETAL
    LASIEGKRGMPRPKPPFPAQSGLWGKPTLINNVETYANIPRILRDGVENYRKRGTENSPGTKMFSVAGPLKATGIIEVEF
    GTTLRDIIYNICGGFVEGEEFKAVQIGGPSRACLSEDFIDMPLDYDTLKKADAMVGSGGIVVITKKTCMVEVARFFLDFT
    KRESCGKCVPCREGTMQAYNILEKFTHGKATYEDLKALEHLSKTIKTASL
    CGLGKTAPNPILSTLKLFREEYIAHIEGEC
    PSGMCTAFKKYVINPDICKGCGLCARSCPQNAITGERGKPYTIDQEKCVKCGLCASKCPFKAIELV

    >gi|281413030|ref|YP_003347109.1| thioredoxin-related protein-like protein [Thermotoga naphthophila RKU-10]
    MKRFLIIAILALSVLSLALTLDDAYRLANITQRKLIMMFSSPTCYYCNLFKKEVLPKDDFQEILIPNFVFIELYATDEKT
    TLFAKEVLGEESVSYRDLFAGFGVRGTPTFFFFKGKEGLGYLPGYVDKDNFIKILKYVAQELKEDFQTYLKKDDPFVGEP
    LIIEISKEDADFVLKKDKNAVKVDTVPNEVRRDRIYVTDSPDVAKTLQEKGALRVLLVK

    >gi|281413135|ref|YP_003347214.1| glutaredoxin-like protein, YruB-family [Thermotoga naphthophila RKU-10]
    MQHLKIKIYTTPTCPYCRKAKEYFRSLGLEFKEVDVTKNPREAELMVKKTGQMGVPVIEIGNKIVIGFDKAKIDRILGIS


    >gi|281413160|ref|YP_003347239.1| redox-active disulfide protein 2 [Thermotoga naphthophila RKU-10]
    MAKKVEILGKGCPKCKQTEKIVRMAIEELGIDAVVEKVQDINEIISRGVVATPAVAVDGKVVISGKIPSLDEVKKVLQQA


    >gi|281413169|ref|YP_003347248.1| DsrE family protein [Thermotoga naphthophila RKU-10]
    MKIGIQVMVPPYTYEDLDTAIKIAEAAMEKGHEVTLFLFADSVICTNKNIKPIRIDRNIPQKLVELMQKGNFEVHICGIC
    MDYRGITTDMIIDGSKPSGLPELANLLATCDRFINLMA