Thermotoga lettingae TMO uid58419

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157362977|ref|YP_001469744.1| hypothetical protein Tlet_0110 [Thermotoga lettingae TMO]
    MNWDVAVFGGGLAGVSAAVNAKRAGKKVILIEQNSIIGGNATLGLVNPFMRFWIDGKVLVGDFFQEIMADLESKGALFEN
    CFDSEMLKIVLLEKLEGVTLLFRAIPIDVLKEGKFIKKVVVKTSLGN
    CYTIEANLFVDATGDGTLSYLAGCEFQSGDEFG
    ENQAVTLMFVLGNVDFEKIRNNIRKDPDNFYKWVSADSKVLSVAGYFKEIKHARKEGMDLPNDFFFFTQLPGTGRVSVNT
    THISIKTTDDFQLSSAIKNLHKQVNDVYRFAKKFVPGFENSYIEKIATIPGVRESRRVVGLYIFSGKDVQLKMKFKDAAV
    KACYGIDIHRKNYTVTEEERTAIPKYEDYYEIPIRSLISKDFENLAVIGRNFSSDFPGQSAARIMPSCIDMGEAIGKFAG
    RVSKSFYEPAKVRGS

    >gi|157363022|ref|YP_001469789.1| alkylhydroperoxidase [Thermotoga lettingae TMO]
    MLKDFISYRQKLNDLINKKGNLHTKRFMNLDSQVYEQGALDTKTKEMLGLVASMVLRCNDCITYHMIRLFQLGTTDEEYF
    ELFNVALIVGGSIVIPHLRKAVEILEELREYEKDGKTISL

    >gi|157363110|ref|YP_001469877.1| methylated-DNA--protein-cysteine methyltransferase [Thermotoga lettingae TMO]
    MDCGFVSTKIGFVSVYVERGAVTRIEFAKKCEGKVSSEILKQLEQYFEGKRKTLDFPVRFSGTEFQKKVWNELRKIPYGK
    TVSYGELARKLNTSPRAIGQALKANPLPVYFP
    CHRVVAKGSIGGFSGGLEWKKMLLELERCNL

    >gi|157363156|ref|YP_001469923.1| electron transport complex RsxE subunit [Thermotoga lettingae TMO]
    MSAIKEFTKGFFKENPTYVQVLGMCPTLAVTTSAMNGLGMGIAATSVLTMSNIVISLIRKNVPKNLRIPIFITVIATFVT
    MIDLVMHAFTYDLWKTLGLFIPLIVVN
    CIIMGRAEAFASKNGVWTSFLDGLGVGLGFTGSLVLLGSIRELFGNGTIFGIN
    IWGKAFNVFVMILPPGAYMTLGLLAALFAFIGLKKKQRGEKK

    >gi|157363157|ref|YP_001469924.1| electron transport complex, RnfABCDGE type, A subunit [Thermotoga lettingae TMO]
    MRIFLILFSALLVNNYVFIRFLGICPFLGVSKKMDTAVGMGFAATFVLVMSSVITWIINKLLIALQLQFLQTVTFILVIA
    TFVQFVEFFLKKNSPSLYEALGIYLPLITTN
    CIILGVAILNAQTNYTLLESVFHALGAGLGFLLALVIFAGIRERLDLYD
    LPKSFEGLPIALILASIISMAFMGFQGLIKM

    >gi|157363166|ref|YP_001469933.1| hypothetical protein Tlet_0299 [Thermotoga lettingae TMO]
    MHIKKVLAVIFLFLSAVVFADILISNLEVAINLAKIEHKKLAIIFTTSSCPYCAKLKNETLTDETVRRLISANYVFAEAM
    FDYSRKTTAFGKEMTYSELFTKFQVNSVPMIWFFTQQATPIAYLPGYVDAQIFAKILRYVYQDIKEDFQQYIAKNDDFAG
    NPMILAVSPDEAEYVLKNDQNSIYIEDFPGEIDLYKIYITPDKNLAEKLVQNGVFRVLLVK

    >gi|157363177|ref|YP_001469944.1| dihydrolipoamide dehydrogenase [Thermotoga lettingae TMO]
    MYDAVVIGAGPGGYVAAIKLAQRGKKVAVVEKSFVGGTCTNWGCIPTKALLSSVHLYSEITEKGKQLGINVEKISYDFSA
    MKAHMNKTVMMSRKGIEYLFKKYGVELINGTATVESTSVVKTSDKKLETHNIILATGSVPTLIPPFDQIPGIWTSDDVFK
    MEKLPESILIVGGGVIGIEFATFFSTLKIPVTVVELMDHILPGEDKDVAETISKSLKKKGVEIYESSRITSVEPDSDAFK
    CIIETKQGTVEKIVQKVLVSVGRKPNIPKDIEKIGVNVQRGIKTNNKMQTSVPNIYAIGDVRGQIMLAHVAMYEAVVAAR
    NICGEDVHMEYSAVPSVIFSNPEVAVVGIREKEIDPSKIKVFSFPVSANGRARTILERDGFVKVIADKNSLKVLGMAIVG
    PSSTDMIMEGVVAVKFGLKANELEESIHPHPTLTETVLGALEGIVEMPIHL

    >gi|157363431|ref|YP_001470198.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermotoga lettingae TMO]
    MEFLGKKIDNLSLKDHNGKIEKLYHLQKKVLLSFHPLAWTSICSKQMLSIEEKYDVFAKLNVAPFGVSVDPLPSKKAWAE
    SLNIKKLPLITDFWPHGEIAKSFGLFREKDGFSERANVILDENKVVIFYKIYPIEELPDIEELIGFLKK

    >gi|157363518|ref|YP_001470285.1| OsmC family protein [Thermotoga lettingae TMO]
    MDIKFSISAKSESATRVAVKARNFTMYVDEPPQLGGDDRGANPVEYVLAALAGCLNVVGNLVAKEMDVKLQDLLIEIEGT
    LNPAKFQGKSSEERAGYKQINVKMKVKTDASPEILEKWLKTVEER
    CPVSDNLSNPTPLKITFEKF

    >gi|157363729|ref|YP_001470496.1| RnfA-Nqr electron transport subunit [Thermotoga lettingae TMO]
    MTVDPITLLFASIFTSNILLTNFLGMCSYISISKDLKSSNGLGMAVSFVMTVTTVINWFVYHYIIVPFELEYLRYIIFII
    VIAAVVQIMEMIIDRISPTLYLNLGIFLPLITVN
    CAILGVTLFMQIREYTLIQSLFYGLGSGLGWWLAIVLLAAIRKKTD
    NAPAPAGLKGNGLTFITIGIMAMAFMGFSGMIKVQ

    >gi|157363730|ref|YP_001470497.1| RnfA-Nqr electron transport subunit [Thermotoga lettingae TMO]
    MNRVFEITKRNILTENQILVQILGICSTLAVTNNLRNTLIMAIGVTLVTGFSNLTVSLIKDYIPRKIRMMMETLIISFYV
    IIVDIILRAYLPEVSKALGPYVGLIITN
    CIIMGRTEAFAQSNTPLISFLDGLTAGLGYTFVLIIVAFVRELLGFGTIFDL
    KVMPANFVPVTIMVMAPSAFFVVAILMWIFKSAVLKGGEKK

    >gi|157363815|ref|YP_001470582.1| hydrogenase large subunit [Thermotoga lettingae TMO]
    MRIYVNGREVEIKDNSKNVLEALKNIGIEIPNLCYLSETSVYGACRMCLVEVDGKDIVTSCTLKPREGMKIKTNTPEIYE
    LRRGILELILATHNRDCTI
    CDRNGSCKLQKYAEEFGIRDIRFTKIKKDNVVDKSSPIVRDNSKCILCGDCVRVCEEVQGI
    GVIDFAYRGFSTQVTPAFSNELAKSECVYCGQCVAHCPTAALTFRNDLEKLYQALSSDKIVIGMVAPAVRVAIQEELSLE
    SDLAMAERIATFLRMSGFNKVFDVAFGADLVAYEEAHEFYKRLSRQEKLPQFTSCCPAWVKYVEQYYPKFVENLSTVKSP
    QQALGSLIKKIYAKKMGLNPQDIFLVSFMPCTAKKFEAEREEHAGVVDLVLTTKELSQMIKASGINIKQISPEPFDRPFG
    ISSQGGLSFGKTGGVFGSVVSVLRDEIGISREEYDNLLEGVKIAKITLKDGKSIRAAVIFGLANARKIMKKISSGEFNVD
    IVEVMACNYGCIGGGGQPYPNDSRMRQKRAHILRETVGIKTLLSPVENFYVQKLYQEDLSDEHARHIIHTNYKPRKRVEF
    QDIEILPLPKEEKTVVRVCLGTSCYMKGSYNLLSQLIDYVRTEDLSDEVEITGTFCLEHCGKSPNVMVNDKLISEATFEK
    IKEVLEKYAKLSK

    >gi|157363840|ref|YP_001470607.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermotoga lettingae TMO]
    MGIPLLGEKFPEMEVLTTHGKIKLPDVYKGKWFVLFSHPADFTPVCTTEFIGFQKRYDEFKKLGAELIGLSVDQVFSHIK
    WVEWIKEKVGVEIEFPIIADTGKVAETLGMIHPAKGSNTVRAVFVVDPNGVIRTILYYPQELGRNIDEVVRIVKAFQIAD
    RNKVAMPANWPENELFKDEVIIPPPTTVEEAKKRKEQYECLDWWLCHKKI

    >gi|157363857|ref|YP_001470624.1| YruB family glutaredoxin-like protein [Thermotoga lettingae TMO]
    MYKITVYTAPGCPYCVKVKSYLRELGLKFTEVDVSKSQKDAEKLVRRTGQTGVPVVEIGNQLVIGFDRARIDKLLGVR

    >gi|157364115|ref|YP_001470882.1| redox-active disulfide protein 2 [Thermotoga lettingae TMO]
    MAKKIEILGKGCARCKQTEKIVRMALEELNVDAVIEKVEDIAEIIARGVVSTPAIAVNGKIVLSGKIPTLEEAKKLIQIG


    >gi|157364124|ref|YP_001470891.1| alkylhydroperoxidase [Thermotoga lettingae TMO]
    MAEMKKKIEELRSQLQNLVGKAPELGEFTKYVHTAESPKKLDTKTKELISLGIAIAVRCEPCIVWHAEAAVKAGADEQDI
    LDTIKVAVCMGGGPALMYALKAYQAALEFLA

    >gi|157364167|ref|YP_001470934.1| protein of unknown function DUF395 YeeE/YedE [Thermotoga lettingae TMO]
    MVWAGLLVGFIFGVILQRGRICFNSAFRDILIFKDNYLMKLAALAIALESISLLLFAQTGLIALNPPALNWLGNILGGYI
    FGLGMVLAGG
    CASGVTYRTGEGMTTAWLAAIFYGLTAYATNSGLFSPWKKWISTFNVVVQNNQSIYAPKTGPTLATVLNI
    NPWIVALIFAALLIWYAFGTKTSERSTKLNWIVAAILIAVLAPIAWWTSAKAGRNYGLGITGGWVNLFSVYTNNKPLSWD
    GAEIIGIILGALISSIAGKEFKLRMPKNPKTYLQVIVGGIFMGFGAATAGG
    CNIGHFLTGVPQLAISSILASIFFILGNW
    TMARILFGKER

    >gi|157364168|ref|YP_001470935.1| DsrE family protein [Thermotoga lettingae TMO]
    MKITIQVMVQPYTYEDIDTAIKIAEAAVEKGHEVTLFLFADSVICVNKNIKPLKIDRNIPEKLRTLINSGKLKVDICGIC
    MDYRGIKEDMIIDGAKPSGLPELAALLSTTDRFINLMA

    >gi|157364188|ref|YP_001470955.1| heavy metal translocating P-type ATPase [Thermotoga lettingae TMO]
    MKKRYEIKNLHCPDCAAKIENALKNSEGVKKATLNFSLGTLDIECEEFVDVKKIIKSVEENVEISDEKNHNKHKQLTFII
    LSSALLVLSLITGIWYFAIVSYLISGADVIKKSISNIRKRSFLDENFLMSVATIGAILLKEFPEAAAVMVFYKTGEYFQD
    LAVDKSRKSIKSLIESTPKHAWLVSGSQLLETDPQKLEPGQIVLVKPGEKVPADGIVVEGDAYIDSSPITGEFIPRHVAI
    SDSVLAGTIVRESSLKIKVTKKYSDSSMANILKLVESASERKAKTERFITTFARYYTPAVVITAALISFLIPVILNESFN
    QWIYRGLILLVISCPCALVLAIPLTYFAGIGKSSKRGILIKGASYLDTLANIKNIVFDKTGTLTHGSFEITNINSVNGFS
    KDDLLMYSAHAEANSNHPIARSILKHFKKIDHSLIKNFHELNGFGVTCSINGKLVHVGNDKLLHRENIPHPETVCKLDEK
    STVHVSVNRLYAGNILLADKLKESSRKTVDLLKSKGLSVYMLTGDNESAAREIAERLSNIDYYSELLPENKIDILEKKIL
    KSGKTAFVGDGINDTPALARADVGIAMNGFGNDAVVEIADVVIMGAEPIKIVESINIARMTKKIVLENIFFAITIKLLFM
    FFAITGKATMWQGVFADTGVALLCVLNSLRVLFSRKTEI

    >gi|157364303|ref|YP_001471070.1| heavy metal translocating P-type ATPase [Thermotoga lettingae TMO]
    MEKIKKTFTVTGMTCATCAKAVEKALGKIEGVEFAAVNLATSTGFIVAEKEIPIEMIKTAVEQVGYGISTQPPEKIEKKR
    YIAAKRNLIFAWFVTLPLALIMLYNMFISPVNYFVWLEIFMGGFVVFYVAKDTIKGAWIALTHKHTNMDTLIFFGSVVSW
    ITSVLEAFGLPVMSFGAIGAMIVAFHITGRFIESHLRDRASKEIKSLLKLQAKEARVITEKGEITVPLEAVKEGLIVSVL
    PSERIPVDGVVIWGKSSVDESVITGESIPVHKKEDDEVIGGSLNLTGPLRIKVTRVGEDSFLSQMINLVQQAQGSKIPIQ
    ALADRITMWFVPTIISLAVIASIVWYFNFEKFVPFLDKMNEIFPWVMSTTEPVNFAIFVFVATIVIACPCALGLATPMAL
    VTGTGLAAKKGLLIKNAEAIQTSKDVKVVLMDKTGTLTEGKPAVVQHNLDETTLKIVASIEKNSNHPLARAISSTVKDFF
    EVKDIDEIVGEGIRAKVGEDEYFVGKPANPDVYDSFYKEGKTVVEVRKNGDVAGFLAIEDTIRNDSKEAVSRLRNMGIKP
    VMITGDNETTAKAVANKVGIDEVYSNVKPQDKLDIVRRYQAKGLKVVMIGDGMNDAGALKGADVGIAVGSGTDLAIDSAD
    VIITKGGISKIVDTIEISKRTFKIIKQNLFWAFFYNVIAIPSAMAGLLHPVIAEIAMALSSITVTLNSLRISKGVEI

    >gi|157364311|ref|YP_001471078.1| hypothetical protein Tlet_1458 [Thermotoga lettingae TMO]
    MADYDVLVIGAGPAGLSAAVSANNFGAKVLVVEREPMPGGILKQCIHDGFGVIEFRERLTGPEYAERYIEKLNKLDIDVL
    LQSFVLDIKKENDFFYVTIQNNRGISIKKSKAIVLATGCRERTSKQIFIHGDRPAGVFTAGTAQYLVNIMGLLP
    CKRCVI
    LGSGDIGLIMARRLTLEGAQVLGVYEIQSQPSGLARNISQCLEDFKIPLFLSHTVTRVFGKERLKAVEIMKVDENKKPIP
    STARIIECDGLILAVGLIPENELAESLGIEMDEKTRGPVVDQNMMTSVKGVFSCGNALHVHDLVDYVTQTGKIAGRSAAL
    YSKGLLTVNSYSEIEFSNDIAYCVPQRISFPCQEKIRLFFRVKYQKKNAKLLVRSNEVITQKTFEIIRPQQTEFVDFEVS
    GGKIAIELAGLGGENVEKSTKKIVCIVCPKGCEIEILDENNATFRGYSCPRGLEFAKNDLLNPKRILCTTVATIGHKLLP
    VKTDRPIPLESFKEVMDCVKKIVVEKPVTRGEIVFENIAKTGANLVATGTSKVIEYV

    >gi|157364373|ref|YP_001471140.1| NADH dehydrogenase (quinone) [Thermotoga lettingae TMO]
    MPLTATTVLICAGGACISAGEESVKQALESEIEKYALSEVVRVVETGCMGACSLGPLMVIYPEGVFYQKLTPQAARRIVE
    EHILKGRIVKEHLYKMPTGETVPEAVEKLPFFARQVKIATRNVGYIDPMNIEEYIARDGYFALAKVLKHMSPDQVVEEVK
    KSGLRGRGGAGFPTGLKWELTRKSKGEKKYIICNADEGDPGAFMDRSVLEGDPHTILEAMAIAGYAIGANQGYIYVRAEY
    PLAIERLNAAISQAKEYGFLGENIMDSNFGFDIEIRIGAGAFVCGEETALIASIEGKRGQPRVKPPYPAQSGVWGCPTVI
    NNVETLACIPPIIIKGADWFRSIGTEKSPGTKVFALAGKITNTGLVEVPMGITLKELLYEIGGGSSTGKKIKAVQTGGPS
    GGCIPSDYFDTPVDYESLQKLGAIMGSGGMIVMDEDDCMVDVARFFLEFTVDESCGKCTPCREGTRQMLKILDKITSGEG
    TERDLEELERLANVIKDTSL
    CGLGQTAPNPVLSTLQYYRDEYEAHVKEKRCPALKCKNLIRYVIDSAKCVGCTACARVCP
    VNAISGEIRKTHVIDNDICIRCGSCIEVCRFGAISKVSP

    >gi|157364455|ref|YP_001471222.1| glutaredoxin-like domain-containing protein [Thermotoga lettingae TMO]
    MPLINEKDVKYLKKVFSEQLVDSVKILIFVDDASECEYCDLTKQVLEELSAVDSKIEFYVYHVKKDREVAEMYKIEMAPA
    VVFLNKNGEDTRIRFYGIPSGHEFSSLIQDIITVSSGKPAFFNEDQIEKIRSIKSPVKIRVFVTPT
    CPYCPKAVLMAHNA
    AFINPNITAEMIEANEFPELSMNYGVSSVPHTFINDQRDFVGAYPENMFLQELLKAAGEN

    >gi|157364456|ref|YP_001471223.1| thioredoxin reductase [Thermotoga lettingae TMO]
    MFFEVGSTKSIKDYYDIVTIGGGPAALSAAVYAKRAGLSVLVVEKVLEGGQLNLTTYIDNYLGFPNIEGQELARKMKEHA
    ESLQTEFLNNHVIELNVENSEMIIKTEERIVKSRVVMIATGADPKKLEVPGEREFLAKGISY
    CATCDGYFFKDKDVAVIG
    GGDTALNDALYLSKIAKSVTVIHRRDKLRAVKILQDKAFSNGKIKFAFDNVVERFHGDKKLERIVLRNVKTGQISELKVD
    GVFIAIGLKPNSELVKDIVKIDEQGYIFTDEWMQTNIPRLYAIGDVRKKNVRQIITAVSDGAIAAIHAAENYF

    >gi|157364426|ref|YP_001471193.1| aldo/keto reductase [Thermotoga lettingae TMO]
    MQYREFGKTIKTSLLGFGAMRLPIINNDESQIDEEKAIEMIRYSVDHGVNYIDTAYPYHRGNSEKVVGKALKGGYREKVF
    LATKCPVWQVEKYEDFDRFLDEQLKKLQTDHIDMYLMHALNKERWQKIRDLRFFEFFEMAKKQGKIRFAGFSFHDKYSVF
    KEIVDNYNWDFCQIQLNYMDINYQAGLRGLMYASEKMPVVIMEPLKGGKLARLPDRAMNILKRNGKNWSAVEWSLRWLGN
    FPQVSVILSGMSTLDQVKENIDIAGRVTVNNLTEDDLKLIEETRKALESFAVINCTE
    CNYCMPCPNGVNIPGNFRLYNET
    IMFEDIEGGKGTYRWFESQKMSASFCIECGECLSKCPQKLEIPSLLKRVHSEFVKR