Thermosynechococcus elongatus BP 1 uid57907

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|22297588|ref|NP_680835.1| hypothetical protein tll0044 [Thermosynechococcus elongatus BP-1]
    MLGQITVVELAQRLATEADTLQLIDVREPEEWAIAHLPHFTPLPLSAFPQWSPQICQLFDPDRETLVLCHHGVRSAQMGH
    WLIQQGFRNVKNIVGGIDAYAAVVDPTLPRY

    >gi|22297898|ref|NP_681145.1| thiol:disulfide interchange protein [Thermosynechococcus elongatus BP-1]
    MGAATAASGQRLRNFVIAVVAILISFALLAGLGSDNQPLTLAEQAKHATPWEEAQVNGKPTLLEFYANWCSTCRSMAKDL
    GELKAQYRDRVNFVMLNVDNSKWLPEIEQFNVDGIPHFVFLNRQLEPQAVAIGLQPKEVMAKNLEALSNDLPLPYGQLTG
    EMSQLPSPLARQRSDDPRSHGG

    >gi|22297940|ref|NP_681187.1| thiosulfate sulfurtransferase [Thermosynechococcus elongatus BP-1]
    MTPYAVAASWLAEHLADPTVVIVDCRFDLMDTRRGQREYAQGHLPGAYYLDLEQDLSSPRQKHGGRHPLPDPEKLAARLN
    QMGVTPETLVVAYDDSRFAYAARCWWLLRWLGHDRVAVLDGGYHTYVAAGHAITSLVPPPRQGNFKPQPRPEWVVDRAAV
    IAAQGNPQTVIVDAREPRRYRGEIEPIDPIAGHIPGAVNYPWQAISNEQGRLKSVAELQAYWQPLAGTEQIIVY
    CGSGVT
    ACVDILGLAIAGLHQTKLYAGSWSDWCSYLTASDNRSL

    >gi|22298007|ref|NP_681254.1| hypothetical protein tll0464 [Thermosynechococcus elongatus BP-1]
    MVELTPAAIQELERLQTHGVRRGQAAILRIQVQPSECGDWRYDLALVAEPKPTDLLTQSQGWTIAIAAEAAELLRGLRVD
    YIEDLMGGAFRFHNPNASQTCGCGMAFRVSRS

    >gi|22298288|ref|NP_681535.1| hypothetical protein tll0746 [Thermosynechococcus elongatus BP-1]
    MSKWYAPMPNRLSQCQSLYLRKHAENPIDWWPWCDEALAKAAAEDRVIFLSIGYSSCHWCTVMEGEAFSDLEIAAYLNTY
    FLPIKVDREERPDIDSIYMQALQLMTGQGGWPLNIFLTPEDRRPFYGGTYFPVQPRYGRPGFLQVLQAVRRFYDQEKEKL
    AAHQATLWQYLAPSTEMGEAIPLTEELLRAGIREVTPILRDRPQGTCFPMMPYAQMLLQGLAFSPNPPELLHLCRLRGQH
    LLQGGIYDHVGGGWHRYTVDPQWTVPHFEKMLYDNGQIVTYLARLWQQGDRSPQIPAAIAQTIQWLDREMTAPEGYFYAA
    QDADSFLSPTDSEPEEGAFYCWSYAELEATLSPTEFTQLQSYFDISAGGNFEGKIVLKQVRLPEDPQVLAPILRKLFARR
    YGADTPMDQPFPVATDNATAKGRAWPGRIPPVTDTKMILAWNSLMITGLATAAQVWRERTYWQRAAKAAQWLHEQQYRQG
    KLYRLNYGGTVAEVAQAEDYAYWIQALLALHQASLAVGETAQPWLALATQYQTLFDQELGAKDGGYYNAPERPDLIVRQR
    EGLDNATPSANGVAIANLVQLFLLTENPTYLEQAEKGLRFFSRLMQEAPQSCPSLLAALQWYLRPLCVQVRSDQLAPLWD
    RYLPTAVLKVRDDLEPVALVCEGLCCREPALTPAQLQQQLDDLYG

    >gi|22298354|ref|NP_681601.1| thioredoxin [Thermosynechococcus elongatus BP-1]
    MSSALSVTDATFEEEVLNSDIPVLVDFWAPWCGPCRMVAPVVDEIANEYQGRVKVVKVNTDENSKVATDFGIRSIPTLMI
    FKGGQKVDILVGAVPKTKIEATLAQFL

    >gi|22298410|ref|NP_681657.1| hypothetical protein tll0867 [Thermosynechococcus elongatus BP-1]
    MMTQATQPAKGIMMTEAALKHLLELRDKHGKDLCLRVGVKGGGCAGMSYTMDFEDPANIRPDDEVFDYDGFKVVSDPKSM
    LYIYGLVLDYSNALIGGGFKFTNPNATQTCGCGTSFSA

    >gi|22298411|ref|NP_681658.1| dihydrolipoamide dehydrogenase [Thermosynechococcus elongatus BP-1]
    MEAAEMGGTCVNRGCIPSKALLAAAGRVRELRQASHWQALGIQLGQVNVDRAGVAAHAANLVQKIRSDLTNSLKRLGVDI
    LIGRGKIAGSQKVSITTPTGEKIITAKDIIIATGSVPWVPPGIEVDGKTVYTSDDAIKLDWLPQWVAIIGSGYIGLEFAD
    IYTALGSEVTMIEALDQLMPTFDPDIAKQAQRILIAGRDIETYSGTLAKRVIPGSPVVIELADGKTQEVVDVLEVDACLV
    ATGRIPATQDIGLESVGVSTDKRGFIPVNEYLAVTKKGKPVPHLWAIGDATGKMMLAHAASAQGIAVVETIVGRPRQVDY
    RSIPAAAFTHPEMSFVGLTEPQARELGEKEGFEVQVARTYFKGNSKALAETETDGLAKVIFRADTGELLGAHIFGLHAAD
    LIQEAANAIRDRQTVSHLAFNVHTHPTLSEVLDEAFKRAHEMVTHR

    >gi|22298417|ref|NP_681664.1| hypothetical protein tll0874 [Thermosynechococcus elongatus BP-1]
    MQFCNWSTQEEKRTMTPELHAKIDNLVKSNKIIVFMKGSKLMPQCGFSNNAVQILNALGVPYETVDVLEDFEIRQGIKEY
    SNWPTIPQVFINGEFIGGSDILIELYQSGELQQLVEVALAS

    >gi|22298428|ref|NP_681675.1| methionine sulfoxide reductase A [Thermosynechococcus elongatus BP-1]
    MGFFGFKNKKLTMPSPSEALPGRAEPMPVPKAHLVNGHPLTPPYPEGMELAMFGMGCFWGAERKFWQVPGVYVTAVGYAG
    GYTPNPTYEEVCTGMTGHNEVVRVVFDPQIVSYEELLKVFWENHDPTQGMRQGNDVGTQYRSGIYYYSPEQKALAEASRD
    RYQAALTAAGYGTITTEILPAPEFYFAEPYHQQYLQRNVNGYCGLGGTKVPYELMGATPAFRGD

    >gi|22298436|ref|NP_681683.1| hypothetical protein tll0893 [Thermosynechococcus elongatus BP-1]
    MGDDRGNTKCLKTAMYTEQINHIKSYTAKLAAAMPDAMKAFYSLSRASSIPGALDTKTKELIALAIGVAKHCDGCIAFHT
    RAALQAGATPEEIMETLMVTVAMDGGPALMYATHVLEALEEFSQGQAP

    >gi|22298450|ref|NP_681697.1| glutaredoxin [Thermosynechococcus elongatus BP-1]
    MAKVEIYTWSRCPFCIRAKQLLTQKGVKFTEYVIDGDEVARDAMAKRAHGRRSLPQIFIDNEHIGGCDDLYALEAQGKLD
    ALLQGVA

    >gi|22298679|ref|NP_681926.1| type 2 NADH dehydrogenase [Thermosynechococcus elongatus BP-1]
    MIRESAVRSQICILGGGFGGLYTALRLAQFPWSSPPEITLVDHSDRFVFTPLLYELITGELEAWEIAPPFVELLRDTPVV
    FHQGAVTTIDLQEKTVHLGKGDPFTYEKLVLALGGETPKSTIPGVAADALTFRTLSDAYRLEEALQR
    CEHSDRDRIRVVV
    VGAGPSGVELACKLAERLGSRGRIRLVDRNPEILKSSPEFNRKAALRALEDRGVWIDLETTPVALTRDRISLQYKDRVDE
    LPVDIVLWTVGTAVSPVIAALDLPKTASGRLQVTPTLQVVDHPDIFALGDAADAVDEQGQPIPHTAQAAFQQADYVAWNL
    WASLSDRPLLPCRYSHLGEMLTLGRDRAALAGLGLTLDGPLAYLARRLAYLYRMPTLEHQLKVGLNWIAKPFLDLLTTIA
    S

    >gi|22298737|ref|NP_681984.1| bacterioferritin comigratory protein [Thermosynechococcus elongatus BP-1]
    MFLRSVLVALLSLILFLSPSAPSWALGGELPPLNAPAPDFSLPSSVNGQLISLKDYRGKWVVLYFYPKDFTSGCTLEAQR
    FQRDIEQFHAHNAEVIGVSADSVDSHQDFCDSEGLTFPLLSDPDGQVSKAYGSWLGFVSLRHSFIIDPEGILRERYRKVN
    PAIHSQEVLARLEELQQQG

    >gi|22298741|ref|NP_681988.1| bacterioferritin comigratory protein [Thermosynechococcus elongatus BP-1]
    MALAVGTPAPPFTAKDTQGNTISLSDFAGKTVVLYFYPKDDTPGCTKEACSFRDNYAAYQGKNIVVLGVSADDETSHQKF
    TAKFNLPFPLLADVDRSIIKAYDVDGGGYAKRVTYVIDGNGIISHVYTSVKTDTHATDILADLGL

    >gi|22298757|ref|NP_682004.1| methionine sulfoxide reductase B [Thermosynechococcus elongatus BP-1]
    MTKVVKTDAEWQAQLTPEQYYVTRKKGTERAFTGCYWNNKKPGLYSCVCCGTPLFRSETKYDSGTGWPSFWQPLDPNNIR
    MERDLSHGMVRTEVLCAVCDAHLGHVFEDGPPPTGLRY
    CINSAALAFVPESAASS

    >gi|22298832|ref|NP_682079.1| hypothetical protein tlr1289 [Thermosynechococcus elongatus BP-1]
    MAVQLPFLTSTNFSGLFNERFWQNAWPLPPQNELKRGALVPDVALPGVGLSDRVRLSNEWKKQPLLLVFTRIFTAHQYCP
    LCYPYLKTLNENHETFQGKGVAVLVVTSTDAQQSEKVKADMALKMPLLYDPSCQVFRKYRTGQALGAPLPAQFLIDQEGK
    LHYKHLFSFLEPNAPLERLFQEIDALAQGATVTTAA

    >gi|22298994|ref|NP_682241.1| bacterioferritin comigratory protein [Thermosynechococcus elongatus BP-1]
    MSLTAGAIAPPFELADATGQLVRLADFQGQWVILYFYPRDNTPGCTTEACAYRELSATLGDRNVVILGISPDSVTSHAKF
    QQKLDLPFRLLADVDAKVAQAYGSYGPKKFMGKEYLGVYRDTFLIDPTGKIAAIYRRVKPAAHVAQVLADLERLQG

    >gi|22298997|ref|NP_682244.1| thioredoxin peroxidase [Thermosynechococcus elongatus BP-1]
    MSECLRVGQPAPDFEAVAVYDQEFKTIKLSDYRGKYVVLFFYPLDFTFVCPTEIVAFSDRYDEFAKLNTEILGVSVDSQF
    SHLAWTQTDRKAGGVGDLKYPLVSDLKKDISTAYNVLTEEGVALRGLFIIDKEGIIQHATINNLAFGRSVDETLRVLQAI
    QYVQTHPDEVCPAGWHPGDKTMNPDPVKSKVYFEAVG

    >gi|22299151|ref|NP_682398.1| glutathione reductase [Thermosynechococcus elongatus BP-1]
    MTYDYDLFVIGAGSGGLAASKRAASYGARVAIAEGDKVGGTCVIRGCVPKKLMVYGSKFSHLFEDAVGYGWHPVKAKLNW
    ERLIRAVDQEVNRLSQLHISYLEKAGVELLPFFARFADPHTLELVDRQGQVQGRVTAAKILIAVGGEAIKPNVPGIEHSI
    TSREMFLLPKQPKRLAILGGGYISVEFAGIMQGLGTEVIHFLRGDRPLRGFDQDIQDGVYGGMIRHGIDVRPQCHITGLK
    LTKKGNIRIRYEQQGQTRETKVDTVLCAVGRAPNLQGLGLDRAGVHLRTNRQGIVAIAVDEYYRTNQEHIFAVGDCTNRV
    NLTPVAIAEGRAFADTQFGNLPRTLSYENIPSAVFSQPEAASVGLSEAQAKAKLGEENVKIYRAAFRPMYHSLTGRPEQV
    IVKLVVENNTERVLGAHMVGDNAAEVIQGIAIALKMGATKKDFDATLGIHPSTAEEFVTLR

    >gi|22299170|ref|NP_682417.1| hypothetical protein tlr1627 [Thermosynechococcus elongatus BP-1]
    MTMTTITMESPLISAAELHDALQRQQVLLIDVREPSEYNSAHIPGALLCPLANVKELEPPCRSDTPVVLYCESGRRSGMA
    YETLASRGWKNLKGLEGGIQRWKQRGYPVKGAARAPISLMRQVQIVAGSLILTGVILGFTVNPAFFLLSGFVGAGLLFAG
    ITGICALGRVLALLPFNRPQVK

    >gi|22299331|ref|NP_682578.1| hypothetical protein tlr1788 [Thermosynechococcus elongatus BP-1]
    MARTESTMLALGTVAPDFQLPDVVSGQTISLSTFADKKALLVMFICRHCPYVKHVQQELAKLGRDYKDTGLGIVAISAND
    AANYPEDAPESLKAMATELGFTFPLCYDESQETAKAYTAACTPDFFLFDSDRKLVYRGQLDDSRPQNGLPVTGKDLRAAI
    DAVLAGQTPSEDQKPSLGCNIKWKPGNEPAYYR

    >gi|22299430|ref|NP_682677.1| hypothetical protein tsl1887 [Thermosynechococcus elongatus BP-1]
    MTLKVEILGTGCKKCQQLEANAKEAIANRQLQAEVVHITDTMEIVKRGVMKTPALVVDGKVLSQGKVLEAKDIEPLLPA

    >gi|22299463|ref|NP_682710.1| cation-transporting P-type ATPase [Thermosynechococcus elongatus BP-1]
    MSLSSSLDSQAPEVAILRVSGLRCAGCVRSLENQLKEQPGVNAAAVNLVTGTAVVTYSPNETTPTAIVESLNQGRFQATL
    AEANVLLELPTTAEETSLPRLAIALVLLILSSVGHGINLLPGHWPMLEAMIWHWGLATIALVLPGWEILREGIAGLSQGR
    PNMNTLVALGALGAYLTSTVAWLWPALGWQCFFDEPVMILGFILLGRSLEQRVRQQAQRDLRSLLALQPKQALWQPSLTA
    SDRWPIPVSRIQVGDWLWVDAGEPFPADGTIVTGETLVDESMLTGESLPVAKGVGAFVLAGSRNVGAAVTLRVERCGRAS
    FLGQILDLVVQAQNRKAPVQQMADVVAGYFGYGVLLLAAGTALFWGAIAPHFFPEITNNTPLLPLKLALSVLVIACPCAL
    GLATPIALLVGISRAAAKGLIIRGGDVLQHSQQLDTIVFDKTGTLTTGELEVAEIHLYGDLSLETVLYLLASLEHKSRHP
    LAVAIQKAWAATNQTTELATVTELETVLGLGISGWIEGHYYQAGRLSWLRDQGIDSPPLAVETHVALARDRQLMAVVTFR
    DRLRPEAVSTIQALQAQGYEIHVLTGDTAKAAQQLLEPLGLLPVNIHPDLQPQQKLALIEEWQTKGKTVAMVGDGMNDAP
    ALTAAQVGISLGSGTEVAIEAADIILTRNHLEDVLAVLALSRATFRKIQQNLLWAVAYNIVALPIAAGVGLPLWGLSLTP
    GLAAAGMAFSSIIVVLNSLSLSRAN

    >gi|22299467|ref|NP_682714.1| thioredoxin reductase [Thermosynechococcus elongatus BP-1]
    MTPPRIENVVIIGSGPAGYTAAIYAARANLKPLMFEGYQIGGLPGGQLMTTTEVENFPGFPEGIQGPQLMARMKAQAERW
    GTEMVTEDVIQVDFSQRPFLISSAERQVYAHSVIICTGATAKRLHLPGEEQYWTKGVSA
    CAICDGATPIFKDVELAVIGG
    GDSAAEEAVYLTKYGSHVHLLVRSDKMRASKAMQDRVFANPKITVHWQTEAREILGDGNLMTGLRIINKATGEESLLPVR
    GLFYAIGHTPNTQLFKDFLELDSVGYIVTRHGTQTNVEGVFAAGDVQDHEYRQAVTAAGSGCMAALDAERWLSARGLIQE
    FHQRATETQPAATAKPTASPQQEFDPNAIKHRGSYALRKLFHESDRLLLVKYVSPT
    CGPCHTLKPILDRLVEEFDGKVQL
    IEIDITEDSAIAEQAGVTSTPTIQLFKNKELLEVIVGMKPKSQYRETLQRYLS

    >gi|22299518|ref|NP_682765.1| hypothetical protein tll1975 [Thermosynechococcus elongatus BP-1]
    MRLVSLLPSATEIIAALGLLPFLVGRSHECDYPPEVKALPVCTRARLNAQQSSLAIDRVVQELLRAALGIYDLELATLQA
    LKPTHIITQDQCDV
    CAVTLPDVQRAIADLLEPPPQLISLQPHCLEDIWEDIRRVGLTLGVAPDPLLTVLKERMRACQRRV
    SDRPRRQVVAIEWIDPPMASGNWIPELIALAGGENMLGTAGKHSPYIEWSTLLAIDPEVILVMPCGFDLERTRQELDQAL
    QTYPQWQQLRALQTGQLYILDGNAYFNRPGPRLVDSLEILVEILHPCPEPKFHGVGWRPYVGPSMAKMSDEG

    >gi|22299630|ref|NP_682877.1| thioredoxin M [Thermosynechococcus elongatus BP-1]
    MKGIQQSNIEGFQRQIRSAPVPVIVHFWAPWCGLCRLIDPLLDQLEQSLPQQLQVLRINADENFALSRHFQLRSLPTVLF
    FDRGELVQRFDPALVQGDFRQALQQLLAHSFPSLLPAESHRS

    >gi|22299804|ref|NP_683051.1| AhpC/TSA family protein [Thermosynechococcus elongatus BP-1]
    MSLKLGDVVPNFTQASSMGNINFYEWAGDSWVVLFSHPADYTPVCTTELGEVARLRPEFEKRNVKVLALSVDSVESHLGW
    IKDIEEVNNVKVDYPILADEDKKVSTLYDMIHPNSLNNLTVRTVFIIDPQKRLRLTMTYPASTGRNFAEILRVIDSLQLT
    DNYSVATPANWQEGQECVIVPSLSDEEAKQKFPKGFNAVKPYLRLTPQPNK

    >gi|22299829|ref|NP_683076.1| thioredoxin M [Thermosynechococcus elongatus BP-1]
    MTMATTRQFSSFSDLLATTDKPLLVDFYADWCGPCRMMAPILEQVKKYLKSEVEVVKIDSERYPQLTSQHHVQALPTLIL
    FHRGRELQRWEGVQPPEVLIDAIRRL

    >gi|22299946|ref|NP_683193.1| hypothetical protein tlr2403 [Thermosynechococcus elongatus BP-1]
    MLNPDLSTIQLTKDDYERYSRHLILPEVGVEGQKRLKAASVLCIGTGGLGSPLLLYLAAAGVGRLGIVDFDVVDSSNLQR
    QVIHGTSWVGKPKIESAKHRILEINPYCQVDLYDTRLSAANALEIMADYDIVVDGTDNFPTRYLVNDACVLLNKPNVYGS
    IFRFEGQATVFNYEGGPNYRDLYPEPPPPGLVPS
    CAEGGVLGILPGIIGVIQATETIKIILGKGTTLSGRLLLFNALEMK
    FRELKLRPNPERPVIDKLIDYEEFCGIRQAKAQEAAQMAEIPEMTVQELKALMDSGAQDYVLVDVRNPNEYEIARIPGSV
    LVPLSEIENGPGVEKIRSLLNGHRLLVH
    CKMGGRSAKALGILKEAGIEGINIKGGINAWSQEVDPSVPTY

    >gi|22297686|ref|NP_680933.1| hypothetical protein tll0142 [Thermosynechococcus elongatus BP-1]
    MKNSWRYLLLALGVGLAIALVPRLPVFQSPDMAMAQGASRTISPQGLANHLKKINAKMYGAYWCPACMKQKELFGSAFKT
    INYIECDARGTNGQPELCKEAHIRAYPTWEINGKRYEGVYPLEGLAQLSGYAGR