Bacillus selenitireducens MLS10 uid49513

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|297582610|ref|YP_003698390.1| Peroxiredoxin [Bacillus selenitireducens MLS10]
    MSVYDFKVKTSSGLNAPLNRYQGKVLLIVNTATKCGFTPQLDDLQKLQDQYGEQGLQILGFPSNQFDNQEPLGDGEITEF
    CSLNYGVNFPLFKKIDVRGEDAHPLYQHLTKAKPFNGFDMDHPTAKLMVSIIESKHPEYMLDDGIKWNFTKFLIDRNGEV
    TARFEPTVEPFDMKADIEALLQSETALNQ

    >gi|297582655|ref|YP_003698435.1| heavy metal translocating P-type ATPase [Bacillus selenitireducens MLS10]
    MGERKLDDQQSVADSTATYRIDGLSCADCAKTFESNVKRLDGVEDANLNFGAAKITVSGHTTIKELEKAGAFEGLKLRPE
    RASSSKQVSFWKLPTTRKVYVATLLLLVALAATVQYGESHPVTGIAYLATVITGGYSLFNKGFRNLIRLNFDMNTLMTIA
    VTGAAIIGEWMEGAIVVILFAISEALERYSMDKARQSIASLMDIAPNEALIRRNGEERMLLVEDIQVGDIMIVKPGEKLA
    MDGRVVSGTSSINQAAITGESVPVMKDSGDDVFAGTLNEEGLLEIEVTRLVEDTTLAKIIHLVEEAQNEQAPSQQFVDRF
    AYYYTPAIIVLAALVMTVPPLVTGAPWETWIYLGLATLVVGCPCALVISTPVAVVTAIGNAARNGVLIKGGIHLEEAGGL
    KAMAFDKTGTLTKGTPVVTDVIPFAYGKEEALHLAAAVEDGSKHPLATAIIRAAEASGFDRSAYVMSGFRSLTSLGVEAS
    VNGETILTGSPRVFQDRGLLHDERIQETIASLEASGKTVMAVGHSTALIALIAVADEVRETAKSVIKDLNRMAIETVMLT
    GDNERTANAIAHDTGVTRVYAGLMPEDKLDRIRNLRHSHGHVAMVGDGVNDAPALAASNLGVAMGGAGTDTALETADIAL
    MADDLNKLPFTIRLSQKALSIIKQNITFALGLKALALLLVIPGWLTLWIAIIADMGATLLVTANSLRLMRMKEKVYK

    >gi|297582673|ref|YP_003698453.1| rhodanese domain-containing protein [Bacillus selenitireducens MLS10]
    MKQLLIVLSGLFLLGACGGTADLDGLNTMTATDLEAQTEQGLEDDVQYIDVRETDEFDEESIPGFENMPMALVMDNPSLL
    NEEEDVVIL
    CNTQNRSKEVAEALIDAGFDHDRVIVVEGGISDYNGTVN

    >gi|297582714|ref|YP_003698494.1| alkyl hydroperoxide reductase, F subunit [Bacillus selenitireducens MLS10]
    MVLDNAITQQLKQYLDLLEGDLTFKLDAGSDANSDKLAGFVREVASMSPRITVEEASLARTPSFTVTRTGENTGVTFAGV
    PLGHEFTSFVLAILQVSGRPPKVEEETLNQMKQLEGDFTFETYVSLS
    CQNCPEVVQALNMLSAVNPGVTNTMIDGAAFKD
    EVEARDVMAVPAVYLNGEFLGGGRMTIEDILEKLGQGTDASELDAKDPFDVLVVGGGPAGASAAVYASRKGIRTGVVAER
    FGGQVQDTMSIENFISVKKTEGPKLVASLEEHVRDYSVDIMKSQRVKAVDKKDLFEVTLENGAVLKSKSVILSTGARWRN
    VGVPGEEAFKNNGVAY
    CPHCDGPLFEGKDVSVIGGGNSGVEAAIDLAGIVNHVYLLEFMPELKADEVLQKKLHSLPNVTV
    ITNAQTTEITGDKKVNGISYKDRVTEEDRHIPLQGVFVQIGLVPNTEFLDDSIETTRMGEIVVDQHGATNVPGLFAAGDC
    TNTPYKQIIISMGSGATASLGAFDYLIRSEEPVVSV

    >gi|297582715|ref|YP_003698495.1| peroxiredoxin [Bacillus selenitireducens MLS10]
    MSIIGTEVQPFTAQAYKNGDFVEVTEENFKGQWTILCFYPADFTFVCPTELEDLQNEYETLKNLGVEVYSASTDTHFTHK
    GWHDSSETIGKIEYGMIGDPSQTLSRQFDVLNEESGLADRGTFIIDPDGVVQAAEINAEGIGRDASTLVNKIKAAQYVRN
    NPGEVCPAKWEEGDETLTPSLDLVGKI

    >gi|297582716|ref|YP_003698496.1| OsmC family protein [Bacillus selenitireducens MLS10]
    MMAKATFKATTQLHEGTKVTAKTRNFTLTIDEPESLGGTDTGMNPVEAVLCALGACQAIVARVYAPKFDISFTDLWLDVE
    GDLDPDGFMNKADVRPGYSEIRYTMHIKTDAPKDKVDEFVRFVESKCPVGDSLENNVSMKLADVVIES

    >gi|297582764|ref|YP_003698544.1| beta-lactamase domain-containing protein [Bacillus selenitireducens MLS10]
    MSLKVMTANELGQKIIAREDLFILDVRNEDAYQDWKIEGDSITSINKPYFDLIDGVDEILGELPKDKEILVACAKEGSSQ
    FVAEQIVEATGQDVYYLEGGMKNYSEDLQPVKLGDLSNGGELYQFVRLGKGCLSYIAVAKNGDAAIVDTTRMVDQYQAFL
    DDKKATLKHAIDTHLHADHISGARTMRERTGAKYWLPSKDADEVQFNYEAFEDGQELTIGAAGEEIQLKAVYSPGHTIGS
    TSVIIDDQYLVTGDILFVESIGRPDLAGKAEDWVGDLRNSLYVTFKNLDQNLKVLPAHFAKFAEVDEHGRVFETLEELFK
    TNEGLQFEDEAEFRSYVTGNLPPQPNSYQEIRQTNMGKIDPEPEEKTEMEIGPNRCAVTE

    >gi|297582791|ref|YP_003698571.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Bacillus selenitireducens MLS10]
    MKKYDVIVIGGGSGGLTVAAGAASFGAKTALIEGKALGGDCLNVGCVPSKALIAAAKTVHQARQAGAFGLSVTGDVDIKA
    VMQQVQDAITDIQGHDSKERFENMGVDVYDGYASFLERDVIAIEGTGSIRGEKIVISTGSSPVIPPVPGLKEAGPLTNET
    IFSLETLPRRLAVIGAGAIGSEMAQAFARLGSEVTLIDMADTPLFREDGEVRETMTKVLSEELTFIGSAMVKEVTVNEQN
    EKQLLLEQNGKQVTVKADEILVAAGRRPNTGRLNLSFAGIETESTGAVKVDGSLRTTADGVYAVGDVNGGLQFTHVAGVE
    GKHVVQQLITGLHTKVSYNAIPWVTFTDPEVFHLGQTEEELQEQGTEYRILKQPLNSTDRFVAERASVGFVKLLTDKKGR
    LLGAHAVGHGAGDFMQEAVGVMKRGDAAHTLSTVVHPYPTHVEALKGASDQYWRSRMAHGLIPYASEKWMQLKRKR

    >gi|297582811|ref|YP_003698591.1| hypothetical protein Bsel_0489 [Bacillus selenitireducens MLS10]
    MKRILFPAIIMILSAVLFACGSNSSASTDQYYSDLDESAKAFYQKNEVLYNGIDDIDDERFLLYVHSPECKFCIQYMPEI
    QTYEARSEGTYPLYKINASLNENANVWETYGIEGVPTTLLMENGEEIDRIVGYVPAGDIFTP

    >gi|297582909|ref|YP_003698689.1| rhodanese domain-containing protein [Bacillus selenitireducens MLS10]
    MKTTILAIPLLALLLSGCSDNGASDAAFHNEPEQTDNESVSEPVPDEDEIRFTAGAAYFNRLTTNRYMLSEDDIDPADSG
    TWLIDLRNSAAFSEGSLPEAVSSDPASLGDVLGALRQTDQVVFISEDGQVASQVMAATRMAGINSSLLAGGIRDYKGDLQ
    PGQRSVSELLDTVEEAPGGDPETQIMDEVVNRYLSGDIATDRSRVDPETLHANLSDYYIIDTRSEADYKEAHVPTAHHIP
    VASIGQHMPDIPADKPLLVY
    CYSGQTGAQAATVLAVAGFETYTLTGGMGNWVQQGFETAQPEADPVTQ

    >gi|297582916|ref|YP_003698696.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Bacillus selenitireducens MLS10]
    MNIAVIGSTHAGTAAVKNMARLYPDATIHVYERNDNVSFLSCGLALYVGGVVQDAKALFYSSPDELSSMGIQVHMQHDVL
    NVDDENKTLRVKDLLTGEVRTDRFDKLVMTTGSWPVIPPIEGIGQDQILLAKNYNQANTIIKQTEHAHHITVIGAGYIGV
    ELVEAFQQAGKSVTLVDGESRILSRYFDSAITDEVERALTDRGIELRLNETVQAFKGDGRVRQVVTNKGAVDTDLVILCV
    GFRPNTGLLTDKVDMLANGAIKVNEYMQTSHPDIFAAGDCCAISYNPTGEEAYIPLATNAVRTGTLVAHNLLTPRIPHPG
    TQGTSGLHLFGLNLASTGLTDTAATQAGLTLQEVTVQETNRPTFMPDAEEVRFTLRFDPVTRIIKGAQVLSKADVTQAIN
    TMSVVIQKEMTIEELAFVDFFFQPHFNHPWHFLNKAGLAAIDALTPAEAVQAAR

    >gi|297582970|ref|YP_003698750.1| beta-lactamase domain-containing protein [Bacillus selenitireducens MLS10]
    MFLKYFYDDALAQASYMVACQKTGEAAVIDPSRNLKPYFDTAEQEELTITKVFETHIHADFVSGAKEMAERAMATIYYSE
    ENGGDEFGTYQWPAHLETVGIKDGDEIHMGNVTLKGLHTPGHTPEHMSFILTDGAASDEPIGIFTGDFLFVGDVGRPDLL
    EKSVGVQDSAKKGAKQMFQSLQRLNDFDPSLQIWPGHGAGSACGKSLGSIPTTTLGYEFKTNPALKPDNEADFADFLLAD
    QPTPPAYFGIMKQVNKTGAGLLAEQTTPFRYGANTKKVKHLLGQDVTMIDTRSRESFAASHIPGTLNVPYDSQFANWMGS
    LVSYDRDVYFIAEDHHFDGIREAMNAIGLDRTSGYFSPLVIEQYEMEEGTGDYPIIPPETAQEMHQSGELTILDIRERYE
    YEAEHVEGARHLVINDIPGTDPDQLPNGPVAVY
    CGSGQRSAIAAGLLKEKGVDVRNIKGGFMRWKQEQRPTEQHAKTAGH


    >gi|297582990|ref|YP_003698770.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Bacillus selenitireducens MLS10]
    MSKKIVIVGGVAGGATAAARLRRIDETSHIVVFEKGEHISFANCGLPYYIGGSIEEREKLLVQTVEGMSRKFNLDIRNLS
    EVTSIQRDEKTVTVTNAATGETYTESYDELILSPGARPIVPPIDGLNDTQNVFTLRNIPDTDKIKAWVDERHPKKAVVVG
    GGFIGLEMAENLHARGIDVTVVEMADQVMQPIDPEMAAIVHQHIQEHGKLILSDGVKAFRDQGKTVVLNSGEELESDITI
    LSIGVRPENELAVQAGLETGDRGGILVNEYLRTTDEHIYAIGDAIEVKDYIQNTPVMVPLAWPANRQGRIVADTIHGNPT
    AYKGTLGTSIAKVFDLTVAATGNNEKTLKQLGVNYKAVHVHPGSHAGYYPGASPVSLKMTFDPETGKIFGAQGVGLDGVD
    KRIDVIATAIKGELTVFDLPELELAYAPPYSSAKDPVNMLGYVATHVADGDLDIVHHDEIDAIVENGGFLVDVRDPLEVE
    MGAIPGSVNIPLDTIRERLDEFPKDQPVYIT
    CQVGLRGYLATRILEQHGVKTINLSGGYKTYACVHHVCTDSVRDDIVAD
    ETPEPEVRRADVTIDATGLSCPGPIMNLHKAIKELDNGQTVKISVTDTGFVRDVDAWCKSTGHTLIEKSTEKGNIFAIVA
    KGSLIKS

    >gi|297583040|ref|YP_003698820.1| Peroxiredoxin [Bacillus selenitireducens MLS10]
    MGENMEHQEKEVVSLPRIGDQAPAFEAETTHGTLQLDDFKGSWVILFSHPADFTPVCTTEFIAFQEIADDLRALNTELLG
    LSVDSVHSHIAWVRNVKEKMGVELTFPIIADLNKDVAKKYGMIMPGESTTETSRAVFVIDDKQIVRAVIYYPLSTGRNMP
    EILRLVKGLQTTDEKGLATPANWEPGDKAIVPPPMTQEEAEERANDPAYECVDWYFCKKDVD

    >gi|297583231|ref|YP_003699011.1| hypothetical protein Bsel_0923 [Bacillus selenitireducens MLS10]
    MIQNFYQILYGKQLIPMNRFLLWLMILPLFFTAPGQAGAVSELPPDDSTLLYLYADTCPVCQEATPAVEAFTDEHGLTLK
    KIDVQEEASRDLVEHVWSHYGVTHRVVPTFVYHDNIMQGFDGSRDEPFAGLLEDGSADPDGDACGEDDETGAVLCSDARP
    DAADETDLHLLAVIGTTLTIGLTDGFNPCSLWALMFLMSMVLRLKDPKAVYLTGFVFILTITAIYGLFIAGTFAIVTNIL
    GITWLRLLIFSFAALFALINIRDYFKETDDLTLSISDSHKKRWIAFSRGRLNSAGSMWRLALAAFAIGVFASLIELPCTA
    GYPIVWNGLMVSQGIGGASYAGLLGMYLFMYILVEFVILMLIGRSMKKMTLTAGIAKTMKLVSGTLMLYLAVLLLAGYEA
    MNNMTLLTGGSLAVIAVTLLYVWIRGRQAS

    >gi|297583233|ref|YP_003699013.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Bacillus selenitireducens MLS10]
    MMKVDLVVIGGGPAGLAAAIEAKENGVDDILVLERDRELGGILQQCIHNGFGLHRFKEELTGPEYAERFISQLKDMGITY
    KLDTMVLDITEEKLVTAVNTTDGLIQIEAKAVILAMGCLERTRGAINIPGTRASGVFTAGTAQRFVNMEGYMVGKDVVIV
    GSGDIGLVMARRMTLEGANVHAVVELMPYSGGLARNIVQCLNDYDIPLLLSHTVTEVRGKERVEEVVIQKVDEEMRLIPG
    TEQTIACDTLLLSVGLIPENELSKKANIALNPLTNGPDVNESMETSVPGIFACGNVVHVHDLVDWVTEESCRAGKSAARY
    VLGSLKSGSGPVRTKAKAGVRYIVPQTIEPSNIDSGKLTLMFRTDGVYEQSRIVIMNNGRRVKSVKKRHMVPAEMESVVL
    KAKDLALLEPGEITVAIESEEGVLS

    >gi|297583409|ref|YP_003699189.1| thioredoxin reductase [Bacillus selenitireducens MLS10]
    MSEERIYDVVIIGAGPAGMTAAVYTSRANLDTVMIERGMPGGQMANTEDVENYPGYDSILGPDLSQKMFEHSRKFGAEYQ
    YGDVKEIIDGKEYKTIVLGNGEVKTRSIIIGTGAKYKHLNVPGEQELGGRGVSY
    CAVCDGAFFKEKELVVVGGGDSAVEE
    AVYLTRFASKVTIVHRRDQLRAQKILQDRAFDNDKIEFEWNHVVKEINGEGGKVSSVTLESTKDGSTKDFKTDGVFIYIG
    MDPINEPFLNLGITNEDGYVVTNENMETDIPGIFAAGDIRDKHLRQIVTATGDGSIAAQTAQHYVENLMEELNATAEKV

    >gi|297583479|ref|YP_003699259.1| iron-sulfur cluster assembly accessory protein [Bacillus selenitireducens MLS10]
    MLEITEAAATQVKQMMEDEADAKFLRVGVQGGGCSGLSYGMGFDTEKAEDDTLLEVDGIEVLVDKESEPMLKGTKIDYKE
    NMMGGGFTIDNPNAVASCGCGSSFRTADNEGTPEEC

    >gi|297583615|ref|YP_003699395.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus selenitireducens MLS10]
    MNRTKLIQMSSGAVVIGILILFVVGLNLDGTAADVGDDAVSFSLEDREGNLVNLDDHLGEQPIVMTFFSTWCQPCRQQTP
    EVIAFQEEYGQEVLVLTVVKSETRRAVDRFIDDTGYEEPYYVFDFNSDVSKAYGITGQPETIIINQEGIIVEHVVGGVSR
    DMLAMRALPE

    >gi|297583630|ref|YP_003699410.1| redoxin domain-containing protein [Bacillus selenitireducens MLS10]
    MTITFKENPVTLKGTEVKTGDKAPDFTVLANDLSEVKLSDFDGKTRLISVVPSIDTGVCDEQTRRFNEEASKLDNVEIIT
    ISVDLPFAQKRWCAAAGVDNIQVTSDHRNLDFGQKYGVVIEELRLLARSIFVVDKNGKLQYKEIVPEVTHHPDYDKAIEA
    AKQLA

    >gi|297583695|ref|YP_003699475.1| thioredoxin [Bacillus selenitireducens MLS10]
    MAIVKASDATFAEETGQGVVLADFWAPWCGPCKMIAPVLEELDADMGDKVKIVKLDVDENQQTASKFGVMSIPTLLVFKD
    GEVVDQVVGFQPKEALAGTLQKHI

    >gi|297583771|ref|YP_003699551.1| rhodanese domain-containing protein [Bacillus selenitireducens MLS10]
    MVKVKQLLSVVLAGGLVLGMTACGDNENEAAPAGGEAQAEENNTENAEPEVEEVDEDEIVMNASRAYLNTLPEGSYMMSA
    EDVHDALDEVVVLDIRRADDFSEGAIAGAMNIPMGELGTSFDDIPADDKVVVV
    CYSGQTASQSAAVLRMAGFDTYIATGG
    MNGWNAAELPVE

    >gi|297583773|ref|YP_003699553.1| rhodanese domain-containing protein [Bacillus selenitireducens MLS10]
    MKHKWTGLLMGAALLTATACSSDEASVLADEENDNEEQAAVETNVFNDLMANSAAYMEDPNFNVITGEALHNKTVFENPE
    DYFILDVRDTTTFVSGHIPGAVNVPYRVSGLEQMYLELPEDKTIYVV
    CFSGHTASHTVGMLNALGYDAEALQFGMGGYAS
    GTDLGSNIPGGPAELPVVTTGFELTETHDLPEIMSDESDIRTIAHEQSQNFLDQEPPGVMGAPDLNEMINEGNLDGHQLI
    DIRLGEHYEQGHIEGAANLPYNELFNEENLSLLDPEKMTVVIGYNGYDASQVTRLLGQLEYSAVPLAYGMSIWSGDESVV
    GEHMFDFSNVYSLPVRELKFDMDAGDIEAGCR

    >gi|297583778|ref|YP_003699558.1| rhodanese domain-containing protein [Bacillus selenitireducens MLS10]
    MKKWAIGLLSLAGMITLSACGTSQASETEPTSFLPMEPDVSPYIVEEEAEEEGQDHVPYHENWNYIDTVQLTRLMDGLPE
    ISQDRESYDQVPPEWGDVALIDSRPPGVYAAGHINGAINIPDSEFDDYKHLLPEDKDTQLIFYCGGLH
    CALSGNSSEKAM
    DMGYENSYVYQEGTPAWKSAGNYFTVTPEYVEEQILESNVARDDTDPVMIIDTRTYAGYFAEHIPTAVFWDDTQYGTKYQ
    GFAPENKDAEIIIYCGGFF
    CHKSPALADDLLGDGYTNVKVLSGGMPAWKQAGLPTFGMETADADFDVSAGKVDRSVSAED
    FEDLIASGATVVDVRGDGEVANGMIDGALHVPDGDIHANDPSVEETLPDDKSTTLLIH
    CASGARASGVVEKIADLGYEEV
    YYWNGGISISDDGSYTLN

    >gi|297583810|ref|YP_003699590.1| rhodanese domain-containing protein [Bacillus selenitireducens MLS10]
    MSYMMQGIKQIDNQELKDMLKQNDKETMVIDVREPEEFDAGHIPGVSLLPMHQIPGMIQGFEADREYVFICRSGNRSQNV
    AMYLKQQGLDRITNVEGGMMFWDGDVKGGVENVIEAPDQLKQTINQK

    >gi|297583844|ref|YP_003699624.1| arsenate reductase-like protein [Bacillus selenitireducens MLS10]
    MVTLFTSPSCTSCRKAKAWLQEHDIPFSERNIFSDPLSVEEVKQIVRMTEDGTDEIISTRSKVFQELEVELDMMPLQELF
    QLISDHPGLLRRPIILDEKRIQVGYNEAEIRRFLPRTVRTFHLQEATKRLVNE

    >gi|297583862|ref|YP_003699642.1| Methionine sulfoxide reductase A [Bacillus selenitireducens MLS10]
    MNHLQNVIFGSGCFWGPDGRFGQLEGVTATEVGYAGGDMPEPTYRQMRDHTEVVRVTFDSDRISFERLLDEFWQHHSGKQ
    HGYGGTQYQSLLITETTEQLQMAKRMIQRYRETENREIETVLTMNKPFTSAEMYHQKYMLRNRSRSWQELLDQFDSEEAC
    IRSTFTARLNALACGELTKQELRSMLNYSVDFSGEREIFTSFLGRMKW

    >gi|297583887|ref|YP_003699667.1| glutaredoxin [Bacillus selenitireducens MLS10]
    MISEPITVYISKGCPYCEKVIAHLEEHDATFQVKNVSEDDDAFKEWKSINPMGTPLTVKGDRQVLGFSAEKLDALI

    >gi|297583901|ref|YP_003699681.1| dihydrolipoamide dehydrogenase [Bacillus selenitireducens MLS10]
    MVVGDFPIEVDTLVIGSGPGGYVAAIRAAQLGQKVTIVERENLGGVCLNVGCIPSKALIEAGHRYHDAGNSEDMGISVNE
    VKLDFSKVQDWKQSVVEKLTGGVEGLLKGNEVDIVKGEAFFVDDSTVRIMDEKTSQTYKFENCIVATGSTPIELPAFKWS
    DKVMSSTGALGLTEVPEKLVVIGGGYIGVELGSAYANLGSEVTILEGTKQILPGFEKQMSQLVSRRLKKMGVTIKTEAFA
    QEMEETDTGVKIKAEVKGKEEEFEGDVLLVTVGRKPNTDELGLEQAGVELTDKGLVKIDKQCRTSASHIYAIGDIVEGPA
    LAHKASYEAKVAAEAISGEASEIDYTAIPEVVFSGPELAQVGLTEQAAKDAGYDVIASKFPFQANGRALSLNDSEGFMKM
    VTRKEDGLVLGVQIAGHNASDMISEACVAIEAGMTAEDLALTIHAHPSLGEITMETAEVALGMPVHITK

    >gi|297584132|ref|YP_003699912.1| copper-translocating P-type ATPase [Bacillus selenitireducens MLS10]
    MAKVTVDLPVTGMTCAACSSRIEKVLNKQEDVEASVNLTMERATVTYDQEKVTTEAIIQKIEKLGFSVDQESLEFDIEGM
    T
    CAACSARIEKVLGKTTGVEQVSVNLAMERGQVTYIPGLVDEQDLFDKVKKIGFKAKAIEGNEDSKRDKKDELVKKQKFL
    FVFSLLFSLPLFVTMIDHFYPQQMILPHWLMNGYLQWALATPVQFYAGLQFYKGAYKSLRGGSANMDVLVAMGTSAAYFY
    SVYLVMTGEVYLFFETSAVIITLVLLGKLLEARAKVQTSEAIKKLMGMQAKTATVVRNGSEVQIAIENVQKGDIIKVKPG
    EKIPVDGIVTEGSSSVDESMLTGESIPVEKSNGEEVIGATINKNGSLYFEATKVGKETTLAQIIKVVEQAQGSKAPIQRM
    VDIISGYFVPGAVLIAVLSFVGWYFFAGASFQEALINFTAVLVIACPCALGLATPTSIMVGTGKGAESGILYKGGEHLER
    AHHTDTVILDKTGTITNGTPEVTDFIALNDSADQTTLMKLAASIEAYSEHPLGEAIVHYAQEHDLNTIKIDDFQAVPGHG
    LSGVAEGKPLHIGTRKLMSKEGMSVDGFEDQMAELEKAGKTVMILAYDRIPAALIAVADQVKETSGEAVKQLQKLGYQVV
    MLTGDNERTANAIAKSVGIDHVFSEVLPEEKALKVKELQEEGKRVIMVGDGINDAPALAMADIGMAIGTGTDVAMEAADI
    TLMRGDLRSIPQAIRLSHLTMRNIKQNLFWAFIYNSIGLPVAAFGFLAPWVAGAAMAFSSVSVVSNSLRLKRVKMDI

    >gi|297584133|ref|YP_003699913.1| Heavy metal transport/detoxification protein [Bacillus selenitireducens MLS10]
    MKTDIIEVDGMTCGHCKSSVEGALHQLEGVEKAEVNLDAKQVTVDYDEGKVTVSAMKSEIEDQGFDPK

    >gi|297584134|ref|YP_003699914.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus selenitireducens MLS10]
    MQTPVVIYFWTSWCPYCQASSQAMEEAHNKYGEDVTFIGVNATASDREQDAVSFIDEHSLSFVNVRDEGGGIAGSYYVPP
    VPTTVFVDGEGIITHRKTGGITANEIENHVRLLKEG

    >gi|297584263|ref|YP_003700043.1| peptide methionine sulfoxide reductase [Bacillus selenitireducens MLS10]
    MSNYEIATFAGGCFWCMVQPFEEQPGIIQVSSGYMGGHLDRPTYKDVKSGTSGHREVVQITFDPDLFPYEKLLSLYWPQI
    DPTDPDGQFIDRGDQYKTAIFYHNEKQKTAAEQSRKEIEQNGPFTKPIVTDILPASRFYEAEEEHQAFHRKNPEAYKEER
    LTSGRDQFINENWKGGEDH

    >gi|297584264|ref|YP_003700044.1| peroxiredoxin, Ohr subfamily [Bacillus selenitireducens MLS10]
    MSEKILTTSATVTGGREGHVKSDTGVIDLDLSMPKGKDLPTDATNPEQLFAAGYAACFDGALNLMASKAKKDISSTLTAS
    VSLIKDPEDGGFMIGVHLKAEIKGASQEEAEDLVHKAHDF
    CPYSKATRGNIDVTLEVTTA

    >gi|297584297|ref|YP_003700077.1| OsmC family protein [Bacillus selenitireducens MLS10]
    MKTTTTWTGKMGFLGKNPSRHEVKMDGPATIGGEDNGSRPTELLLQAVAGCTAIDIISILRKMRIEPERFETEVEGTRAE
    EHPKKFTHIHIHYILDGDIPEKKLARAIKLSKDEY
    CSVSHTLNADITASYTLNGQKGEMDV

    >gi|297584339|ref|YP_003700119.1| methionine-R-sulfoxide reductase [Bacillus selenitireducens MLS10]
    MKDKNERINALTPIQFQVTQQDGTEPPFDNPLWDFFEPGIYVDIVSGEPLFLSNDKFHSNCGWPSFSKPISEDALVEKKD
    TKLMMMRIEVRSKEADSHLGHVFNDGPEPTGLRY
    CINSAAIRFIPKSDMAEEGYEEYVHLIKS

    >gi|297584340|ref|YP_003700120.1| peptide methionine sulfoxide reductase [Bacillus selenitireducens MLS10]
    MSEQFRKATFAGGCFWCMVKPFDEEDGIEEVISGYTGGTKPNPTYKEVCSETTGHREAVQITYDPEKVDYEDLVDLFWQQ
    IDPTDAGGQFHDRGHSYTTAIYYHDDEQKEIAERSKLKLDESGKFHKPVVTDILPAKAFYLAEDYHQDYHKKNPMHYKMY
    RKGSGREDYIKGTWG

    >gi|297584375|ref|YP_003700155.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus selenitireducens MLS10]
    MELRDKQHFELSTISGDETFRLLDFKGTPLVLTFWVSWCPDCERDLKIKHELAQKIPGDELQFVMIHVTGRDTSTEAGKA
    FMQEKGYSFLSLSDRGTQIYDAWHCMTAPTTFIMDSNLTVLGRLNDKSSFEELMTAIGKAIQ

    >gi|297584376|ref|YP_003700156.1| hypothetical protein Bsel_2086 [Bacillus selenitireducens MLS10]
    MIELTNESEAIVLQKGVLFLHTPLCGTCKMAGQFLQIAEQIPDIPEIFSMDLNMAPHIAKDWKIESVPCLVVIDDGNVTD
    RMYAFKSIPDIVAFVTFNQKKG

    >gi|297584468|ref|YP_003700248.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus selenitireducens MLS10]
    MKNKRFLMRLSILIVMIGAVGYSLYVNFSEERGVVDAGDTAPNFIVQDLDGENVELTDYNGQGIYLNFWATYCVYCREKM
    QYLQEHEEEYREKGVTILNVNVDETTLQVERHKERQNLTFPLYIDRNMLVSNAYGVASLPTVFLIDHEGTVKERQIGGKT
    EGQVVEALESLVP

    >gi|297584494|ref|YP_003700274.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus selenitireducens MLS10]
    MLNSLETMNIKKWMSVLILIGAVSVSVYLIVDSNREASQNDALESYLESNGIEREPASELSLIDESEGEMTDETGLSPGY
    MAPDFELETLEGDLVSLSDFQGDFVILNMWASW
    CGPCRKKLPDYVQFHETYAEEAGDPVTILGMNMTSTEHSIEGVATLA
    DDFGLPFPVVLDPDGVIREEYEVLVTPTTYMIDPDGRVVVRRQGYFDYGDLENYYRQIVREYDSES

    >gi|297584517|ref|YP_003700297.1| OsmC family protein [Bacillus selenitireducens MLS10]
    MMTFQIKARSEGLKVEAEAGKHSLTLDEGSQMGGKDEGPNPLQTTLSALASCENVTAHMAAKEMNFDLQGITFEISGKFD
    PKGFMGDPEVRPYFQSVEVKAVVKTSESDDRIQELQEKVESRCPVYTMMKAANVDMNDQWTKAS

    >gi|297584544|ref|YP_003700324.1| dihydrolipoamide dehydrogenase [Bacillus selenitireducens MLS10]
    MALEYDLVIVGAGTGGYVAAIRASQLGLKTAIVERGKLGGTCLHEGCIPSKALLRSAEVYHTIRHAGGFGVDVSEYSLNF
    PAVQDRKEKIVDQLHKGVQHLIKKGKIDVYEGYGRIMGPSIFSPRAGTISVEHDGEEENTMLVPKFVMIATGSRAKTLPG
    LPVDEDRIMTSTGALVLSEVPESITIVGGGVIGIEWASMLADFGSKVTVLEYLDRILPGEDADISKEMLRAMKKKGVKVH
    TGAKVNGADTKIETNGVTLSYEHKGKTVTIESERVLVSVGREANTGDLGLGNTEIQTDHGFIQVNEHYQTAEEHIYAIGD
    VIGGLQLAHVASHEGIHAVEHMAELSPEPMQESLIPKCTYSAPEVASVGLTEEEAKNQGYQVKTGKFSFKAIGKALVFGD
    TSGFVKFVTDENNDDLLGVHMIGPHVTELISEAALARVLDAAHWEVASTIHPHPSLSEIMGEAALAVDGNEIHGG

    >gi|297584573|ref|YP_003700353.1| rhodanese domain-containing protein [Bacillus selenitireducens MLS10]
    MDIIILSVVTVLLFAWILIRSKKPSYLHPVTEEEFKKNYRKAQLIDVREEKEFDGGHILGARNVPLSQMKQRITEIRPDQ
    PVYMY
    CNSGSRTKQAAKIMRKKRGVEEMYTLKGGFKKWTGKVKK

    >gi|297584601|ref|YP_003700381.1| UBA/THIF-type NAD/FAD-binding protein [Bacillus selenitireducens MLS10]
    MSKWERYSRQMLFQPIGESGQEKLSKAKVLIVGMGALGTVVANHLTRSGVGHLVFCDRDYVEMSNLQRQTLFDEEDVKDM
    LPKAVAAEKRLKKINSDIHIEGHVTDVTAGNIGEFMEGTDLVIDGTDNFSTRYLMNDIAFQYGVPFIYGGVVSSRGMGAM
    FIPGETPCLRCLFPTFDSSGQT
    CDTIGVLSMAVDIVASQEALMAVQYLTGNRDQIEKSLFTVDVWRNDRFSMGFGSPVEQ
    CPTCGTQEYPSLKASEKDSVTTLCGRETVQIQHSTRYDLAKWANQLEPVSSSVKKTPFLVKAVLQEGETLVLFPDGRTLV
    QGTEDLARAKTLFTKYIGN

    >gi|297584687|ref|YP_003700467.1| Peroxiredoxin [Bacillus selenitireducens MLS10]
    MTDKRVVAKQAPRFDMEALMPDGSFGRISLEMIMKKDKWTVLFFYPMDFSTVCPTEIIAFSDHYDAFRQLDAEIIGVSTD
    TIHSHRVWTEMDRDQKGIGSVNYPLAADPSHSVSRDYGVLIEEDGIALRGLFIISPEGELVYAQVNHHNIGRNVSHTLHT
    LQALQTEGFCPADWEPGTKTL

    >gi|297584688|ref|YP_003700468.1| redoxin domain-containing protein [Bacillus selenitireducens MLS10]
    MKLHTPLPDFPEDLIWLNAPDNVTSASPLNRPVLIHFWSVSCTLCKKDYPELNKLREDFHDQLSMIAVHMPRQDIDYDMD
    EIRSAIHQHGITQPCVIDRERVLTDIFENRYVPAYYLFDASGKLRHYQAGGRATGMLRRRIMRITD

    >gi|297584708|ref|YP_003700488.1| methionine-R-sulfoxide reductase [Bacillus selenitireducens MLS10]
    MIKKRLLLGIAAIFILALIPVGQIAYEAAFHKSSGSDRSVTAEDHTEGELATFAGGCFWCMEKPFDELEGVLDVYVGYTG
    GSEAYPSYEDVASGQTDHVEAVQIRYDPSLVTYETILSVFWRQIDPTDDGGQFVDRGYQYSTAVFYHDEHQKAAAEESIA
    ALDEENRFDSPIVTPVRSADVFYLAEDYHQKFYQENPVRYRMYRSSSGRDDFLDEVWGEERYDIPESQSVGEYEGLYGVT
    YTDEELKEMLTPIEYEVTQEDGTEPAYRNQYWDHYEDGIYVDRVSGEPLFSSRDQYDSKTGWPSFTQPIDPHFLTEEEDN
    TLFYTRTEIRSLYGDSHLGHVFEDGPEPTGLRY
    CMNSAAMTFIPLDEMEEKGYGDYMDEVTS

    >gi|297584714|ref|YP_003700494.1| HesB/YadR/YfhF-family protein [Bacillus selenitireducens MLS10]
    MNITDKAKDFIQNILDENNASNIKVYVAGMGCGGPQLGLALDEPSQTDIVEEINGIKVAFEQHVHGQTSNMALDYQETPQ
    GSGLVMTGNESDCC

    >gi|297584849|ref|YP_003700629.1| methylated-DNA/protein-cysteine methyltransferase [Bacillus selenitireducens MLS10]
    MPKNSALMYSVMNSPLGDLTLVKSEKGLCYIEFGSSKDTICHVRRKLRTRQIRDELVWNEDELTAVKTQLEEYFNGERTS
    FDVALDMKGTPFQKLVWEKVNQIPYGKTKSYKDIAVEIGAPKAVRAIGGANNQNPVPLIIP
    CHRVIGSNGSLVGYGGGLD
    KKEKLLDLEGLKTVTKR

    >gi|297584858|ref|YP_003700638.1| redox-active disulfide protein 2 [Bacillus selenitireducens MLS10]
    MKIEVLGTGCTKCKRLEERTKEAVQELGIDAEVSKVEELDQIIEYGVFKTPGLVIDGEVKATGKVLTVKELKKLLS

    >gi|297584972|ref|YP_003700752.1| UBA/THIF-type NAD/FAD-binding protein [Bacillus selenitireducens MLS10]
    MTARYSRQERFEGIGHDGQAKIRDGSVMIAGAGALGSAAAEMFVRAGVGRVLIVDRDYVEHSNLQRQQLYTEQDAHGRLP
    KAVAAERRLRSINGDVTITGLTEEITPVFLAQMADVDAVVDGLDNFETRMAINDACMKRGIPFIYGACVASGGLSYTVLP
    EEKPCLQCILGDAGPGGET
    CDTAGIISPAVQMTASFQTAEALKLLSGNREALREELVEFDVWSNETRKVNVTGLKDPGCP
    SCGPDPKYPNLDRSAQTKTAVLCGRDTVQIRPHKAVSFERVRHDLPDVPVSENPFLMQLELEGRRVVLFRDGRALVHNTS
    DPVEALSLYQRYIGS

    >gi|297585003|ref|YP_003700783.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus selenitireducens MLS10]
    MSLTKGDQVPQVPVTSTTGEAVTLDQYKGKYVVLYFYPKDMTPGCTTEACDFRDHHEQFQELDAVILGVSPDPVKRHESF
    INKHELPFELLADEENELAEAFGTWKLKKNFGKEYMGIERSTFLIDPEGTIIEEWRKVKVKGHVEEALQHLRSLVS

    >gi|297585063|ref|YP_003700843.1| SirA family protein [Bacillus selenitireducens MLS10]
    MSIKVDHVVDAKGLACPMPVVKTKKMMDQIEAGQVLLVEATDRGSLADMKGWAKNTGNQYLGSKEDGDVLFHYLRKSDDA
    DTTEVAEFEPVAQNDDVKNKIGEDSVTILDVREPAEYVFSRVPGAVSIPMGDLEDRLGELNKDDEIYVI
    CRTGSRSNMAS
    HTLKEQGFEKVYNVKPGMTEWDGPTEGEA

    >gi|297585064|ref|YP_003700844.1| thioredoxin [Bacillus selenitireducens MLS10]
    MDAIQTMEELQTSVNDHEAYLLLIKTENCSVCEAVEEQINQGVLDEAELPIGKVRLKDIPEVSGEFLVFTSPTLILFLEG
    KEQWRGSRFVSYDEIIRIMKLWRS

    >gi|297585138|ref|YP_003700918.1| hypothetical protein Bsel_2863 [Bacillus selenitireducens MLS10]
    MFTIEVFILAAVFGLIYGFLLQKADFCFVASVRDFVSVKDSRVGKGILVLMATAMIGWGLSLTLGIASVDQLWAVPIGFQ
    NLLGGLLFGIGMTIAGS
    CASGALYRSGMGYIQFWIVIAAMITGNLLFAFIYDPWANDYMMEPLTMAEGYSLYEIGLPFMT
    LPLLLVGLLLFVTIRKFGWAGFWQGVKNSFTDWKGNPFTQQHWDVRFVALLMGITATVQFITLSSISVTGPETRIGGVFL
    ASIFGEQAVYNNLYLNNMFAAYPTVGIGPEEVLVIMIVVGAFISSVLSKSFKIRFPKAKRLPAAIGGGLLMGVASRIAPG
    CNIANVVAGVGGLSIASFLVIIGMMVGVFLVTKYYFKMPIMLFYREKDAA

    >gi|297585140|ref|YP_003700920.1| rhodanese domain-containing protein [Bacillus selenitireducens MLS10]
    MSEIKENVKQLSFDEVKGLYDKEDRKEILIDVRELEEYEEAHIPGVPLIPMSEIVSLVDQFKPDEEYVLICRSGRRSHEV
    AKFFQENGIERVHNYADGMLGWEAVKTDGPEWVVSQVNEIYK

    >gi|297585141|ref|YP_003700921.1| rhodanese domain-containing protein [Bacillus selenitireducens MLS10]
    MKKILSSIVVLSGLLIACNNDPSVEEVEEAAEDITAGGVVDASEYENGDLLVSTDWLEEDNGDVVVVDVRREGYEDGHIP
    GAVSVEPGQLSDPDNPVDGVLPPEEGFEALMQEIGVNEETTVVAYDDGDSLWASRLFYALELYGHEDVRILNGGFTAWLN
    DGKDVSTEAPEPERGNFTAQLNPELQSSREDVDANIGNEATVFLDARSEGEYTGEDVRAERGGHIPGAPHLEWSEAVSGD
    GVPYFKSAEELEEQFAAAGVDRDKTIIPY
    CQTNVRGAHSYFSLRLLGFDDVKPYEGSWAEYGNDPDAEIEGSS

    >gi|297585375|ref|YP_003701155.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Bacillus selenitireducens MLS10]
    MNVIVIGGVAAGMSAASKLRRTDPDAVITVFERGAFPTYGACGLPYYISGENDDYERMIARKEDVFKKQGIDVRLKHEVL
    KVDFGRRQVMVKDLTTGSVWIEAYDRLMIATGTKAIVPPIPGTGLDRVRVLKTMEDGLRMKEELDQPSVRHVTIIGAGYI
    GIEMAEALRTLKKDVCVIEMAPRILMPFDEEISNVARDELITNAVSLHLSEAVQEITDTGRGLSVKTAQGAYETDYVILS
    AGVRPATDLFTDTALQLDGRGAVVVDKEMRTNLPDVFAAGDCATVYNKVKDETDYIPLGTNANKGGRIAGENLAGGRKKY
    TGTLGSAAIKVFNAELGRTGLTEEEAKMRYEDVTTVTVTANDHPGYYPGSTPLLIKLICEKRTRKILGGQIAGAKGAVLR
    VDLIALAIHNGMTSDELGMVDFCYAPPFAGVWDAVHIASNAVK

    >gi|297585441|ref|YP_003701221.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Bacillus selenitireducens MLS10]
    MNVVIIGGDAAGMSAAMQVSRKRKDASITVLEKGGIYSYAQCGLPYFIGGEVDKSEELIARPVSFFREKAGIDARVFHEV
    TAVDAENKQVSGTDLNSGEPFSVDYDILLVATGAGSIFPPFEGRDLEGIHLLKTIPDAEAIVEDLKENVLNVTVIGGGYI
    GLEVAENLVKDGRKVRIIDLADRIGNVYDKEISEKIQEEAERNGIDLVLGESVTSFEGENGRVSKVVTDQGSYNADMVVV
    AIGVKPNTGFLEGTGVHLHPSGAVLVNPYMETNIPGIYAAGDCATQFHRVKQKDDFVPLGTHANKQGRIAGINMSGETKA
    FKGITGSSVMQFFDLTVGKTGISENEAKELGMDYEVIGYDAAAIAHYMPGNSPLFIRMMKDKTNDKLIGMQAIGKKGVDK
    RIDVAATAIYHGMTTEDMENLDISYAPPFNTAWDPVQQGARRL

    >gi|297585546|ref|YP_003701326.1| rhodanese domain-containing protein [Bacillus selenitireducens MLS10]
    MSKKWKITGFSTVAVAIIAVIVYFSVTGIEAQEVDMDAQQEKITEYAVPEAFITATELKDLMETDEDVVVIGTMSERGGA
    IPGSFEIWRPDYSGTELYPYDGMANEKEEVEALLSSFGVTPETTVVTYAANAQHDSARVFWQLKMLGHDDVRFLDGGINA
    WIGQGYDTGNPLELGDREKTEYVAPDYNPAAFNAELEDVIAAVDGEGILIDTRGGDEEDGSTTLAGAFGPGKIAGAEYIN
    WTEAVAEDGTAVSMSELEALYGDMIESGETLIPY
    CQSGVRSSYTWLLLTYGLGYDDVLNYDGSWIEWSYEAYELENQDVI
    DRTENGDF

    >gi|297583848|ref|YP_003699628.1| dithiol-disulfide isomerase involved in polyketide biosynthesis-like protein [Bacillus selenitireducens MLS10]
    MSKAKGNFVCNDELGICCPVDPASLFTAPKEKKPVEIYMFIDPLCPECWVLEPFVRKLQMEYSHYVTIKTFIGKGASAYT
    PASDKDVQKLIHEMAKSYNATACRTGMPCNGDVWHEQKITMPYTANLGIKAAELQGKAIGSKFLRRVREALFLKKKNIAD
    KDTLIECAKFIDGMDVEEFMKDLDSDSPKIALESDERTTQEMEVSQLPTLIFFGEDVNEPGLKVEGHYPYEVYVQIIEEL
    VGKPLKKCPPIPLQEFISFYSIVTEKEIAVLYDLSLDDVHREMKKLKLRQIVNEVPTRQGFLWQYKKVHNFKQTNSL