Thermosipho melanesiensis BI429 uid58683

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|150020049|ref|YP_001305403.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermosipho melanesiensis BI429]
    MKVVIIGCTHAGTAAAINASKLYKDAEITIYERNDTISFLSCGIALHVGGVVKDPSKLFYSSPEHLKSLGINTKMRHNVK
    KVDFDEKTLLVEDLKSGEIFEDSFDKLIITTGSWPIIPNIEGIELNNILLSKNYYHAQEIIKRSENAKNVVVIGAGFIGV
    ELAEAMKEKGKNVTLIDIESRILSKYLDEEFTKIAEDKLLKNGINLALNEKVTRFIGGKSVEKVITDKGEYNADLVILSV
    GFKPNTDLFKRKLDMLENGAIIVDEYMQTSRDDVFAAGDCSAVFYNPLKKYKYIPLATNAIRMGTIAAYNLNERRLRHLG
    TQGTSGIKIYDLNIAATGLTESMAKCNELEVDSVVITENHRPEFMPKFEKVMFKVVFGKDSKKILGAQILSKADLTQSIN
    TMSVVIQNEMTIEELAFVDFFFQPHFNKPWNFLNMVGLEYLNRI

    >gi|150020449|ref|YP_001305803.1| thioredoxin-related protein-like protein [Thermosipho melanesiensis BI429]
    MRKVFFLTLIIFATFIFAYNYTFYDLGIAHQISKIEDKPLLIYFSSPSCVYCKKFENEVLTSEDFQQILRASYVFAKINP
    NTQKTTFMSEEFTNMELFSAFGVRGTPTFVFLYMDSGITSIPGYMSLEDFKKALMYILKVTFENYKESFQTYSKQKDFCL
    GKSKIIKVSKEDFDLVKEMDKNSVELKEIKDKIDIYKTYLTNSREIADKLFEKGVLRILLLED

    >gi|150020450|ref|YP_001305804.1| YruB family glutaredoxin-like protein [Thermosipho melanesiensis BI429]
    MQHVKIVIYTTPTCPYCRKAKQYFKQLGFKFKEYDVSKDQKAAERMYKKSKQLGVPVIEIGNQVIVGFDKAKIDRLLNVN


    >gi|150020451|ref|YP_001305805.1| thioredoxin reductase [Thermosipho melanesiensis BI429]
    MVHFDLGNISTGPKEYYDVLIVGAGPAGLTAAIYAGRAGLSAVVFEKALEGGAVTQTHVVENWPGIIKIEGGELGEKFAE
    HAKAFGAEIVTTEIMKISYDDEYRYVELDNGKKVKGKVLIYATGAVPRKLGVPGEEEFRGRGVTY
    CAACDGYLFSGKDVV
    VVGGGDSACDEAHFLAKMVKSITMVQNLPYLTAAKVLQDRLLQNKNVKVILNSLVKEIRGTDKVEEVVVVDNETGKETVI
    KAEGVFIYVGLQPNSDLVKEIVEVDEYGYILTDENMETNVPGIYAVGDVRKKNLRQIVTAAADGAIAVEHAAKKYF

    >gi|150020452|ref|YP_001305806.1| glutaredoxin-like domain-containing protein [Thermosipho melanesiensis BI429]
    MALLSEKDREYLEDLFSKELDNKVKLIFFGDSKDNCEYCDLEEQILDEVRELSDKIVVEKYNVNEHKDLAEKFQVEMTPA
    LILTLEDGEDKGVRFYGIPSGHEFGTLVQDIVTFGKGANPELSPETIEKLKKIDKPVKISVFVTPT
    CPYCPRAVLTAHNF
    ALVNPLIKAEMIEANEFFELSNEFGVSSVPHIVINRNPNTFFIGAYPEAQYLEEVLKAIK

    >gi|150020544|ref|YP_001305898.1| RnfA-Nqr electron transport subunit [Thermosipho melanesiensis BI429]
    MPNINPFVLFFASIFTSNILLSNFLGMCSFISISKSLKSSNGLGMAVTMVMTIATVLNWIVEKYIIVSFNIEYLRYIVYI
    VVIASVVQILEMVIDRVSPNLYISLGIFLPLITVN
    CAILGVVLFMQLRNYSLIQSVFFGLGSGIGWWLAIVLLAAIRIKV
    DKAPVPAPLKGVGITLITIGIMAMAFIGFAGMINVQ

    >gi|150020545|ref|YP_001305899.1| RnfA-Nqr electron transport subunit [Thermosipho melanesiensis BI429]
    MNKYKEVFLKNVWYENPVFVLVLGICSTLAITNNLKNTLIMTIGVLLVTGFSNLTVSLLKSLILSKVRMITQVLIISFYV
    IIVDIILRVYLPDVSKALGPYVGLIITN
    CIIMGRAEAFAQSNSPLLSFWDGVTSGLGYMLVLMVIAFFRELLGFGTIFGY
    RVMPEGFVNWTIMVMPPSAFFMLALFIWIVKGRSGDNA

    >gi|150020577|ref|YP_001305931.1| heavy metal translocating P-type ATPase [Thermosipho melanesiensis BI429]
    MVPIWGGISEVKKMEEKTSFTITGMTCANCARTIEKALLKSEDIEFAAVNLATNTGFVVGKNIDMEKIKKIVESVGYGIS
    DKPAEKIEEERYKRIKKNLIVSLIFTIPISILMIINMFFQKISYFTFLETVFGAIVTFYAGRDTIKGAWIALTHKHTNMD
    TLIFFGSIAAWSTSVLSLLGIEIGSFGAIGTMIISFHLLGRFIESYLRDKAAKEIKSLINLQAKEARVISENKELMLPIE
    AVKEGMIVLVKPGERIPIDGEIIDGKSGIDESMISGESLPVEKGIGDEVIGGSLNLTGVLKIKATKIGKDSFLSQMINLI
    KEAQGAKVPIQALADKITNWFVPVIISLAIFSGLFWYFGFENFYPLIEKASNYLPWILKTNNPVSFGIFVFVATIVIACP
    CALGLATPMALITGTGLSAKRGLLIRNAESIQTMKDIKYVLMDKTGTITEGHPSVVEHNLDEMTLKIAASIEKNSNHPLA
    KAISDLTNEYIQVDNINEISGEGIVANVNDIEYFVGKPLDYSKYSELTEKGYTVVEVRENKIIKGYIVIVDPIRPDTKNS
    VKILKNIGITPIMVTGDNEETARQVAKQVDIETYYAQVKPNEKLDIIRKYQAKGQKVLMVGDGMNDAAALKGADVGIAIG
    TGTDLAIENADIIITKEGISKIVDAIKISQLTFKVIKQNLFWAFFYNIIAIPMAMMGLLHPAIAEAAMAFSSITVILNSS
    KINEKRYVKTLLDNEKKACCM

    >gi|150020632|ref|YP_001305986.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermosipho melanesiensis BI429]
    MKYFKYNIGDSFDFEFTNLEGEKVKIPKGKWVVLYFYPKDNTKGCTTEAVEFSELLDEFEKLGAVVIGVSSDSIESHKKF
    IAKHNLRVNLFSDENKKVLEKLGIWQLKKMYGREYYGIVRTTVLINPDGKIAYVWEKVKAKGHAKEVLEKLKEMID

    >gi|150020653|ref|YP_001306007.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermosipho melanesiensis BI429]
    MLKKGDKFVDFELVNTDLKKIKLSEHLNGKVALVFYPGAFTSVCEKELCSFRDMIAKFNNINAKVFGISVDSPFSNKAFA
    EKNHLSFDLLSDFGGKVSEKYGGIHKNFIGIENYTVSKRAVYIIDENGTIIYDWVSDDPGKEPLYDEIEKILEQ

    >gi|150020717|ref|YP_001306071.1| dihydrolipoamide dehydrogenase [Thermosipho melanesiensis BI429]
    MYDVVVIGGGPGGYIASIRLSQLGKKVAIIEKEELGGTCTNKGCIPTKALLTSAHLYRDIKEKASKFGIKVDSVDFELSG
    IMKHMQKAVTMSRKGIEFLMKKNKIDVFKDKGIIKDNETVLLENEGKEIKGRYLILAQGSIPSVFPPFDKLEGIWTSDDV
    FKIKEFPKSLLIIGGGVIGVEFATFFSSFGVDVTIVELADHILPNEDKDVAEEIKKELKKKKVNVLEGKKVEEIKKELNY
    IAIVDGETIEAEKVLLAVGRRPNITDDIKELGVKIDRGVITDKKMKTNIDNIYAIGDIRGQIMLAHVAMYEGIIAAHNIA
    GKEIEMDYSAVPAIIFSTPEIASVGLREKDIEADKINVWKFPVSANGRARTMEERAGFAKVIEDKKTGKVLGVTVVSPSA
    TDMIMEGVLAVKYGMTSHQVSEAIHPHPTLTETLLGAFEGKWAIHI

    >gi|150020719|ref|YP_001306073.1| redox-active disulfide protein 2 [Thermosipho melanesiensis BI429]
    MKKIEILGSGCPKCKQTEKIMKIAVKDLEIDAKIEKVTDIDEIISRGVVATPAVAIDGKVVISGKIPTLEEAKELLNN

    >gi|150021081|ref|YP_001306435.1| peroxiredoxin [Thermosipho melanesiensis BI429]
    MGLPLIGEKVPEFEAVTTKGVIKFPDDFKGKWVVLFSHPADFTPVCTTEFYAFQKRYDEFQELNTELVGLSIDQVFSHIK
    WVEWIKEKLGLEIKFPVIADDRGKIAEMLGMIHPAKGTNTVRAVFIIDPKGILRAILYYPQELGRNMDEILRMVRGLQTV
    DENGVALPANWPNNELVKDEAIVPPANNVKDAEKRLKEYECYDWWFCHKKLK

    >gi|150021113|ref|YP_001306467.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermosipho melanesiensis BI429]
    MKKYDVIIIGGSAAGIVAATTGKCCYKDKSFLMIRKDRDALVPCGIPYVFGVLGTTQKNIIPLEAITKSGVEFLNDEVVK
    IDRESKIVVTKQGEQFQYEKLILATGSKPFVPNIKGKELKNTFVVPKNKEYLDKMIEELKSLDKIVVIGAGFIGVEVSEQ
    LAKVGKNVTIVEILPHILGKAFDSEIAKIAQEELEKLGIRVYTNTKVVEIKGDEKVREVLLDNGELLESDAVIFATGYVP
    NTELAKEAGLELNKYNAIRVDSYMRTSDPDIFAIGDCAQKVDFITRKSVPVMLASTATSEARIAAMNLYKLSTVRSFLGT
    IAIFSTKIGNRVFASAGLTEEEAKKNNFDIKVGYFEGVDKHPGSLPNTNKQIVKLIVSKESDIIIGGEVVGGDSAGELIN
    VIGMEIQNSVTITELFISQIGTHPLLTSAPTAYPLIKAAEKVFMSK

    >gi|150021449|ref|YP_001306803.1| electron transport complex RsxE subunit [Thermosipho melanesiensis BI429]
    MSSKTWKEFSKGFFAENPTFVQALGMCPTLATTTSAKNGLGMGLAATVVLVLSNIVISILRRAVPEKIRIPIFITIIASF
    VTMVDLLMHAYVYDLWKTLGLFIPLIVVN
    CLIMGRAEAYASKNNVWYSMIDGLGMGLGFTASLTLLGAIRELLGNGTIFD
    VVVWGKAFNVFIMILPPGAYLTLGLLAALFAFIGMKRKERGKAK

    >gi|150021450|ref|YP_001306804.1| electron transport complex, RnfABCDGE type, A subunit [Thermosipho melanesiensis BI429]
    MKVFLILLSAMLVNNYVFMRFLGICPFLGVSKKMDTAVGMGLAATFVLVMSSTISWFLDKLLVGLGLEFLRTIVFILVIA
    SFVQFVELFLRKNNPNLYDALGIFLPLITTN
    CIILGVALINSMNNYNLLETIFNALGAGLGFLLALIIFSSIREKLELYD
    IPKPFEGLPLALITASLLSLAFMGFQGMIKL

    >gi|150021520|ref|YP_001306874.1| glutaredoxin 2 [Thermosipho melanesiensis BI429]
    MKILYFKNDKCSVCEAMLPKIKKVADDYNIDFEVIDVIKNPEIAGQNLVLTVPTVLFVDNGTELTRFARNFSVSEIVSFI
    ERYLEFVNN

    >gi|150021570|ref|YP_001306924.1| glutaredoxin 2 [Thermosipho melanesiensis BI429]
    MKILYFKNDTCSVCKAIFPKIGNIAKQYDVNLEVIDVVKNPEVAGQKLIFTVPTIVFLEKGIELKRFSRNFSILEVQDFI
    ERYNKIMSK

    >gi|150021781|ref|YP_001307135.1| alkylhydroperoxidase [Thermosipho melanesiensis BI429]
    MELKEFKEFREKMNEKILESGTLNTKRFFNLDGNVYKNGALDSKTKELLGLVASMVLRCDDCITYHIIKCVENGVRDEEF
    FEAFDVALIVGGSIVIPHLRRAVSTLQEIREMQKNEGTISF