Thermosipho africanus TCF52B uid59095

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|217076170|ref|YP_002333886.1| thioredoxin [Thermosipho africanus TCF52B]
    MKIEYFKNDKCSVCKAMLPKIQTIAKNFDIDIEVIDVIENPSYPAQKLVFTVPTVIILDKEFEIKRFARNFSISEVINTI
    ERYLEISNKE

    >gi|217076188|ref|YP_002333904.1| dihydrolipoyl dehydrogenase [Thermosipho africanus TCF52B]
    MYEAIVIGGGPGGYVAAIRLSQLGKKVAIVEKEEFGGTCTNKGCIPTKAMLTASHLFTEINEKAKKFGILVDNVSYDLSL
    IMKHMQKSVTMSRKGIEFLMKKNKIDVFKDKAVLKDKNTVLLENSGQEIQGENIILAHGSVPVIFSPFDQIEGIWTSDDV
    FKMEKMPESILIIGGGVIGVEFATFFSSFGVDVTVVELAEHILPYEDSDVAEEIKKALKKNKVKIIEGEKVEGVEKKGEK
    YIAKVAGKEIEVEKVLLAVGRRPNISEDIKALGIEIERGVKTDKHMRTNIDNIYAIGDIRGQIMLAHVAMYEGIVAAHNI
    AGEEIEMDYRAVPSIIFSNPEVASVGKREKEVDRERVNIYKFPVSANGRARTMEEKLGFAKVIEEKETGKVLGVTIVSAN
    ATDMIMEGVLGVKYEMTTEKIAEAIHPHPTLTETLLGAFEGKWAIHI

    >gi|217076342|ref|YP_002334058.1| carboxymuconolactone decarboxylase [Thermosipho africanus TCF52B]
    MNLEEFKKFREKMNERILEEGTLNTKRFFNLDGNVYKNGALDEKTKELMGLVASMVLRCDDCITYHMIRCAQLGVSDEEF
    FETFDVALIVGGSIVIPHLRRAVKLLEDIREMQKNGKDVSI

    >gi|217076488|ref|YP_002334204.1| copper-translocating P-type ATPase [Thermosipho africanus TCF52B]
    MPEKKITFSVTGMTCANCARTVEKVLSKDENIKFASVNLATNTAFVVGDESIDLEKVKKLVESVGYGVSTEKPQQIEEKR
    FRQIKRSLIMALAVTIPISILMIINMFFVKVPYFVLLEVIGGAFVTFVAGKNTIKGAWIALTHKHTNMDTLIFFGALTSW
    LTSVLALFGFELASFGAIGTMIISFHLLGRFIESYLRDRATKEIKKLLSLQAREARVVINGEELFLPIEAVKENMLVIVK
    PGERIPVDGIVIEGASGVDESVVTGESMPVEKKENDEVVGGALNLTGILKIKVTKTGEDTFLSKMIQLIQEAQGAKVPIQ
    ALADRITNWFVPTIITLAVISGIFWYFGFDKFYPLLESARKIFPWILSTNDPLSFAIFAFVATVVIACPCALGLATPMAL
    ITGTSLAAKKGLLIRNAEAIQTMKDVKVVLMDKTGTITQGNPAVVDTNLDEEVKKIVASIEKNSNHPLAKAISKISEKYL
    EIKDIKEISGKGVIAKYDGKEYFVGKPEDYSRYETLLKEGYTVVEVRQDSEIVGYIAIEDPIRQDSKIAIENLKSLNVIP
    VMVTGDNEKTAKIVAEKVGIEKVHSQVKPDEKLEIVRKYQVEGNKVLMVGDGMNDAAALKGADVGIAIGSGTDLAIDNAD
    IIITKEGISKIVDAIYISNLTFKVIKQNLFWAFFYNIIAIPMAMLGLLHPAIAEAAMAFSSITVILNSSKINERRYAKVF
    SSKKSCCI

    >gi|217076791|ref|YP_002334507.1| Na(+)-translocating NADH-quinone reductase subunit e (na(+)-translocating nqr subunit e) (na(+)-nqr subunit e) [Thermosipho africanus TCF52B]
    MNPNINPLVLFFASIFTSNILLSNFLGMCSFISISKSLKSSNGLGMAVTMVMTITTAINWLVEKYIIVPFQIEYLRYIIY
    IIVIAAVVQILEMVIDRTAPNLYISLGIFLPLITVN
    CAILGVALFMQLRNYTFLQSIFFGLGSGLGWWLAIVLLAAIRIK
    VDKAPVPAPLKGVGITLITIGIMAMAFMGFAGMINVQ

    >gi|217076792|ref|YP_002334508.1| NADH:ubiquinone oxidoreductase, na(+)-translocating, d subunit [Thermosipho africanus TCF52B]
    MEKFKEVFLKNTWYENPVFVLVLGICSTLAVTNNLKNTFIMTIGVMLVTGFSNLTVSLLKNLIPSKVRMITQVLIISFYV
    IIVDIILKAYLPDVSKALGPYVGLIITN
    CIIMGRAEAFAQSNPPLISFWDGITSGFGYMIVLVAIAFFRELLGFGTIFGF
    KVMPENFVTWTIMIMPPSAFFMLALFIWIVKGFKKEGAK

    >gi|217076797|ref|YP_002334513.1| bifunctional methionine sulfoxide reductase B/A protein [Thermosipho africanus TCF52B]
    MAKKINKNLSEFEKFVLFEKGTERPFSGKFEDHFEKGIYVCKNCGIPLYNSSSKFNSGCGWPAFDDEIPGAIKKQVDRDG
    IREEIVCSYCGAHLGHVFYGEGFTEKNVRH
    CVNSVSLDFVPEGEKPLIDRIFFAGGCFWGVEYLFRKLDGVVDTRVGYMG
    GRRKNPTYEQVCTGVTGHLETVEVIFDPKKLDEETLIKYFFEIHDFTQENGQGPDIGEQYKSAIFYTNDLQKKISEKLIQ
    ALKKKYDVVTQLKKASDFWVAEDYHQQYYEKTGKTPYCHVRFKLLKTWDGII

    >gi|217076808|ref|YP_002334524.1| bacterioferritin comigratory protein [Thermosipho africanus TCF52B]
    MEKAKNFCLPDKNGKMHCLEDFKGKWVVLYFYPKDNTSGCTREAKDFSQLKEEFEKLGAVIIGISKDSPKSHQKFVEKHS
    LSILLLSDEAHKVIEDYQAWGKKKMYGKEYFGVIRSTFLINPDGNIVKVWRNVKVKDHANEVLKTLKELL

    >gi|217077065|ref|YP_002334781.1| redox-active disulfide protein 2 [Thermosipho africanus TCF52B]
    MAKKIEILGSGCPRCKQTEKIMKMAVEELNIDATIEKVQDINEIISRGVVATPAVAIDGKIVISGKIPTLEEAKKLLQ

    >gi|217077066|ref|YP_002334782.1| NADH oxidase [Thermosipho africanus TCF52B]
    MKVIVIGCTHAGTAFTVTAKKLYGDKVDITIYEKNDTISFLSCGIALHVGGVVKDPEKLFYSSPKQLSETGANPKMKHEV
    IDVNTKEKWVLVKNLETGETFKDTYDKLLISSGSWPIIPNIPGIDLEGIKLSKNFYHAQDIINHSKNAKRIAVIGAGYIG
    VELAEAFKENGKEVMLFDIKDRILSRYLDREFTDILEAELKNNGVELILGEKVVEFKGENNHVSKIITDKGEYNADMVVL
    AMGFKPNTELFKGKVEMLENGAIKVDKYLHTFENDLFAVGDSAAVWFTPTNSYEYIPLATNAVRMGTIAAYNLFDDTVEY
    KGTQGTSGVKVYSYNVFTTGISQQFAEERNLDVKTIFTIENNRPEFMPEYEKVYIKIVYDDKTKRILGGQIMSKANVAES
    INTLSLAISNNMTLVDLAFSDFFFQPHFNKPWNFLNTVALKAIQ

    >gi|217077108|ref|YP_002334824.1| bacterioferritin comigratory protein, AhpC/TSA family [Thermosipho africanus TCF52B]
    MLEKGSMYIDFELVNTKLEKVKLSSLIGQKIVLVFYPGAFTSVCEKELCSFRDMMAKFNNLNAKVFGISVDSPFANKAFA
    EKNRLNFELLSDFGGIVSRKYGGVHENFVGIENYTVSKRAVYVIDEEGKIIYSWVSDDPGKEPPYNEVEEVIAK

    >gi|217077451|ref|YP_002335169.1| hypothetical protein THA_1383 [Thermosipho africanus TCF52B]
    MKKFIFIFLVLATMISFSYDYTMYDLGIAHKISVIEDKPLIIYFSSPSCVYCKKFESEVLSDEKFQELLKLYYTFVKVEP
    NNNKTIFLENEYTNNELFGAFGVRGTPTFVFWYKDAGITMVPGFMPLEDFLNALNYILKYVYEDYREDFQTFLDNKESFN
    PKTKVINISNNDADFVLAHDKNAKKYTSDQKIEKGTVYLVYSKEDLEKLKQSGVFRILFVNK

    >gi|217077452|ref|YP_002335170.1| hypothetical protein THA_1384 [Thermosipho africanus TCF52B]
    MQHVKIVVYTTPTCPYCKKAKNYFKQLGLKFKEYDVSKDQKAAERMYKKSGQLGVPVIEIGNQIVVGFDKAKIDRLLGIN


    >gi|217077453|ref|YP_002335171.1| thioredoxin-disulfide reductase [Thermosipho africanus TCF52B]
    MVHFDLGNISTGPKDYYDILIIGGGPAGLTAAIYAGRAGLSAAVFEKALEGGAVTQTHVVENWPGFIRIEGSELGEKFAE
    HAKAFGAEIITAEVLKISYDNEYKYVELDNGKKVKGKVLIYATGAVPRKLGVPGEEEFRGRGVTY
    CAACDGYLFSGKDIV
    VVGGGDSACDEAHFLAKMVKSITMVQNLPYLTAAKVLQDRLLENKNVKVILNSLVKEIRGKDKVEEVVVVNNETGEETVI
    KAEGVFIYVGLVPKSDLLKGIVDINEYGYIKTDENMETNVPGIYAVGDVREKNLRQIVTAAADGAIAVEHAAKKYF

    >gi|217077454|ref|YP_002335172.1| hypothetical protein THA_1386 [Thermosipho africanus TCF52B]
    MALLSAKDREYLTDLFSKELENKVKLIYFGDSKENCEYCDLEEQILDELKELSDKIIIEKYNVKENADLAEKYEVEMTPA
    LILTLEDGEDKGVRFYGIPSGHEFGTLVQDIVTFGKGAKPELSPDTIEKLKAIDKPVKISVFVTPT
    CPYCPRAVLTAHNF
    ALVNPLIKAEMIEANEFFDLSNEFGVSSVPHIVINRNPNTFFIGAYPEPQYLEEVLKAIK

    >gi|217077553|ref|YP_002335271.1| methylated-DNA--protein-cysteine methyltransferase [Thermosipho africanus TCF52B]
    MEKGIVNTEIGSIIVYVKDNKAIKIEFKNEFLKEIELGIFTSQIKEYFEGKRKKLLFNVEINTGKTFKKIWDFVREIPYG
    QTMTYGQIAKILNVNPRVVGFAMSKNPLPIYIP
    CHRVVGKNDIHGFTGGRKWKEYLLNLESSQQY

    >gi|217077618|ref|YP_002335336.1| NADP-reducing hydrogenase, subunit c [Thermosipho africanus TCF52B]
    MPLTTNTILICAGGACISAGEESVKDVLERKIKEYNLQDTINIVETGCMGACSLGPIMVIHPEGVYYQKLTPEAAEKIVE
    EHLLKGRVVEEYLYKGDKGKIVPQPQKEIPFFSRQVKVATRNVGIIDPLSIDEYIARDGYFALHKALKEMTPEQVIEVVK
    ESGLRGRGGAGFPTGLKWEFARKSPGDEKYMICNADEGDPGAFMDRSILEGDPHSIIEAMTIAAYAIGATKGFVYVRAEY
    PIAIERLTVALNQAREYGFLGENILGTDFSFDIEIRIGAGAFVCGEETALMHSIEGKRGQPRVKPPFPAQKGLWGKPSNI
    NNVETLACVPPIIYHGPQWFRQWGTEKSPGTKVFALAGKVKNTGLVEVPMGITLRELIYEIGGGSPTGKKIKAVQTGGPS
    GGVIPEEYFDTPVDYESLQQLGAIVGSGGMIVLDEDDCMVDVAKFFLEFTVDESCGKCTPCREGTKKMYEILDKITKGEG
    TEEDIEILENLANVIKDSSL
    CGLGQTAPNPVLSTLRYYKDEYLAHVRDKTCPAKKCKDLISYVINPEKCVGCTACARVCP
    VNAINGEVKKVHEIDQDACVKCGSCIEVCRFGAISKVTPAVQ

    >gi|217077646|ref|YP_002335364.1| peroxidase [Thermosipho africanus TCF52B]
    MGIPLIGERIPEFEAVTTKGVIKFPDDFKGKWVVLFSHPADFTPVCTTEFVAFQKRFDEFQKLNTELVGLSIDQVFSHIK
    WVEWIKDKLGVEIKFPVIADDRGKIAEMLGMIHPAKGTNTVRAVFIIDPKGILRAVLYYPQELGRNMDEILRMVKGFQVI
    DENGVALPANWPNNELVNDEAIVPPASTVKDAEQRTKEYECFDWWFCHKKLNNK

    >gi|217077955|ref|YP_002335673.1| electron transport complex RsxE subunit [Thermosipho africanus TCF52B]
    MASRSWKEFSKGFIVENPTYVQALGMCPTLATTTSAKNGLGMGLAATAVLVMSNIVVSLLRKAVPEKIRIPIFITIIASF
    VTIVDLLMHAYVYDLWKTLGLFIPLIVVN
    CVIMGRAESFASKNNVWYSMLDGLGMGLGFTASLTLLGAIRELLGSGTLFD
    VKIWGKAFNVFIMILPPGAYLTLGLLAALFAYIGMKRKERGNTK

    >gi|217077956|ref|YP_002335674.1| Na-translocating NADH-quinone reductase, Nqr5 subunit [Thermosipho africanus TCF52B]
    MKIFLILLSAMLVNNYVFMRFLGICPFLGVSKKMDTAVGMGLAATFVLVMSSTISWFVDRLLISLGLEFLRTIAFILVIA
    SFVQFVELFLKKNNPNLYDALGIFLPLITTN
    CIILGVALINSMNNYNLLETIFNSLGAGLGFLLALIIFSAIREKLELYD
    LPKPFEGLPIALITASLLSLAFMGFQGMIKL