Thermosediminibacter oceani DSM 16646 uid51421

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302388656|ref|YP_003824477.1| thioredoxin [Thermosediminibacter oceani DSM 16646]
    MKPLTLTDDNFEQEVLKSDVPVLVDFWAPWCGPCRMMAPVIDELAAEYEGKIKVGKLNVDENPNSAAAYGVMSIPTLILF
    KDGQPDKKLIGFRPKREIIAELGI

    >gi|302388678|ref|YP_003824499.1| protein of unknown function DUF395 YeeE/YedE [Thermosediminibacter oceani DSM 16646]
    MKESTITRRKNQLPYAMALLLTLVIFGIYLSRAGKILTVRWIFGIAFGFVLQRSRFCFTAAVRDPILTGNTSLFRAVIIA
    IAVAMVGFSSIQFAAHLSGYPVPGMIKPAGVHTLLGGIIFGIGAVLSGG
    CASGTLMRVGEGHLLNLIALVFFIAGSAAGA
    YHFGWFKEHIIKSARPVFLPDLMGWGAAFFGQLALLFILYRLALWWDYKSRAQ

    >gi|302388679|ref|YP_003824500.1| protein of unknown function DUF395 YeeE/YedE [Thermosediminibacter oceani DSM 16646]
    MKNMEFYKEKLKRFADVILKEPFPYWFGAIVLGILNVCLLAVSGEPWRITSYFAHWGAWVARAFGARPEFWAFYGERENA
    AALADGFLRDGGSVQNLGIIAGAMLAALLASQFRFRKIKSYKQVIGAVIGGFLMGYGARLSFG
    CNIGALFSGISSMSLHG
    WIFMAGMLAGAYLGSRLLIKFFLY

    >gi|302388681|ref|YP_003824502.1| Rhodanese domain protein [Thermosediminibacter oceani DSM 16646]
    MRKIVALALILLLAVSLAACSQQKSATAPAKFLTGKEKGYANPEAIITPQELKELIDKNAVKIIDARPEDRYAKEHIPGA
    VRAWRNEYNDPTHKYEGMRATPEQFAQLMSKLGIANGDLVVVYGDAEKHSPADAARVWWLFKLYGDNKVRILDGGIEAWK
    AAGFETTKELPQVTETKYEVKVDTSLLAEVEDVLAGQNNPDVIILDTREEAEFLGKQKVKGAARAGRIPGAVWLYWGDAL
    NEDKTLKSYDELKKLYEEKGVTPDKTVIPY
    CQSAVRSAHATFVMTELLGYKNVKNYDGSWVEWSQRTDLPIETGEPKN

    >gi|302388748|ref|YP_003824569.1| thioredoxin reductase (NADPH) [Thermosediminibacter oceani DSM 16646]
    MYDLAIIGAGPAGLSAAIYGARARLSTVMIEKMYPGGQAAITDIIENYPGFPEGIGGAELTEAMKKQAERFGAQFLNGNV
    EKIEKVGEKFLIRLKTETLEAKTVILAMGAEARKLGVKGEKEFTGRGVSY
    CATCDGAFYTDRPVMVVGGGDTAIGEAIYL
    THFATSVTVVHRRNELRATKILQERAFKNEKIKFIWDSVVDEIKGGDAVEEVVVRNVKTGEKTSVPVDGIFVAIGWDPNT
    AIVKDLVQLNERGYIVTDENMATNVPGLFAAGDIREKSLRQVVTAVADGAIAAVSAEKYLEEHQMR

    >gi|302388810|ref|YP_003824631.1| methylated-DNA/protein-cysteinemethyltransferase [Thermosediminibacter oceani DSM 16646]
    MVYFRKINTAIGVIMVASTERGVCRIALPGENMESFINDLKKMYGGAELVDESVRGKSSEINFLAEQELTAYFNRELKNF
    TVPLDLKGTEFQKKVWKEVMKIPYGEVRSYGYIARAIGKPKACRAVGGANNRNPVPIIVP
    CHRVVGNDGSLVGYGGGLEM
    KSFLLKLEGIKREF

    >gi|302389182|ref|YP_003825003.1| Arsenite methyltransferase [Thermosediminibacter oceani DSM 16646]
    MEFNVKEKVKEYYSNIAKKAEKGSKSSCCSCGSSCCGDVDDITFYNEEDLKGLPEEAVNLSLGCANPIVLADLKEGETVL
    DLGSGGGIDVLIASKYVGDTGKVYGLDMTDEMLALANKNKEKMGVTNVEFIKGYIEDIPLGDETVDVIISNCVINLCEDK
    EKALKEAYRVLKKGGRLAIADIVALKDVPEDIKKQVELWAG
    CIAGTIKIEEYREILQKVGFKNIEIDPVHIYTKDIIKEL
    LIDKKGIMELVKEIDLNSVDGAFAGAYIKAFK

    >gi|302389202|ref|YP_003825023.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermosediminibacter oceani DSM 16646]
    MRSFPEKSKTFGLLTVIVFITLYLAGCGKTKVETANPEPEIKPYEGFLAPDFELPDLSGRKVRLSNFRGKTVVLNFWSLN
    CSYCLAEMPDFEEFNATKPENVAILMINLDRDAGRVATYIKNKGYTFTVLKDDSAQTVRSYLIRGVPTTVVAGGDGVIKA
    RIEGQVTKQILDSLVN

    >gi|302389272|ref|YP_003825093.1| electron transport complex, RnfABCDGE type, E subunit [Thermosediminibacter oceani DSM 16646]
    MYQLVKDFLNGLWNENPTFRMIIGMCPTLAVTTAAMNGIAMGLATTFVLVFSSLLISLLRNIIPAKVRIPCYIIVIATFV
    TVVDLFMSGYFPAMYKILGLYIPLIVVN
    CIIMARAEAFASKVSALRAIADALGMGIGFTWAITMIGAVRELMGSGTVFGY
    HVLSENATRWVIMLLPPGAFFTMGILLGIMNVITRKSVKNTQCH

    >gi|302389273|ref|YP_003825094.1| electron transport complex, RnfABCDGE type, A subunit [Thermosediminibacter oceani DSM 16646]
    MKELFFIIAGSVLVNNFVLSRFLGECPFLGVSRKLETAISMGVATTFVLTMTSVATYFIQFYILEPFGLSRFLQIVSFIL
    VIAALVQLVEMVILKTSPALYKALGIYLPLITTN
    CAVLGLALLIAIKRYNLIQSVAFGLGAGIGFTLAMALMAGIREEME
    FGDIPEALQGTAIVLITAGLLSMAFLGFSGLIPM

    >gi|302389291|ref|YP_003825112.1| copper-translocating P-type ATPase [Thermosediminibacter oceani DSM 16646]
    MAEAIEKAAQNIALTIKGMTCASCAARIEKALSKMDGVQEVNINFATEKASITYDHGEVSIADFVQKIRDLGYDVIADRV
    ELGLKNMT
    CASCAARIEKVLSRAPGVLKASVNFAAETATIEYLSSLTDVKNLIKVIRDIGYDAYEKTEMDVDREKQEREK
    EIRSLGRLVVISAILTTPLLMTMIFSVMGLHGGILANPWLQVVLATPVQFIIGYRYYRGAYHNLKNGSANMDVLIAMGTT
    AAYFYSLYNVFTLPMEMIHNYLYFEGSAVIITLITLGKYLEAVAKGRTSEAIRKLLGLQAKTARVIRNGEEMEIPVEQVE
    VGDIVVVRPGEKIPVDGVIIEGYSSVDESMLTGESIPVEKRVGDEVIGATINKTGTFKFKATKVGKDTVLAQIVKLVEEA
    QGSKAPIQKLADRISGVFVPAVIAIALITFAVWYFVFDNFTAGLINAVAVLVIACPCALGLATPTSVMVGTGKGAELGVL
    IKGGEHLERAHRIRAIVLDKTGTITKGKPEVTDIIPAGNLGEEEILSFAAIAEKNSEHPLGEAIVNKAKESGLELSDPES
    FEAIPGHGIYAKIKGRQVILGNRRLLKTKNIPTEGIEDLLSKLENEGKTAMIMAMDGVLEGIVAVADTVKENSREAIDEL
    KKMGIEVWMITGDNERTAKAIARQVGIENVLAEVLPEHKAEEVEKLKKQGKITAMVGDGINDAPALAAADVGIAIGTGTD
    VAIEAADITLMSGDLKGIVTAIKLSRATMRNIKQNLFWAFIYNTVGIPFAALGYLSPAIAGAAMAFSSVSVVTNALRLKR
    FKP

    >gi|302389300|ref|YP_003825121.1| UBA/THIF-type NAD/FAD binding protein [Thermosediminibacter oceani DSM 16646]
    MILPKEQLYRYLRHIIMPEISGPGQKKLIESTGLVISSSLDCALPLLYYLTAAGIGRIYVAAEKFNQEFLYLKENLEDLN
    PDLKIEFLEDATALPTGEKLDFAVFINNFKAAKYLKEIPAILAATRPWKGYMRTVKRADLLDDTLPETIDGDYSERGSAG
    AAFSRCLAGTLCAIEAVKLCLNMGRLLESPLYFDLDDMEFKTGVSWNEFIKADIPEHPLEKEKLSRSKVLIVGTGGLGSL
    AALALTLAGVGTIGLVDIDTVEISNLNRQILHTTSRIGMPKVESAEIFLKKINPEVNVVKYHTRFDRENALEIIKDYDVI
    IDGVDNLPTRYLLNDACVLAGKPLAEAGVLRFEGLGMTVVPGEGPCYRCVFPKMPPPGSTPS
    CSETGVLGPVPGVMGSIE
    AAEAAKILTGRGKLLSGRLLIFDAMELDFKLPDLKKDPGCPVCGQSPSIRGLSGEYDFVCERKENNL

    >gi|302389302|ref|YP_003825123.1| copper ion binding protein [Thermosediminibacter oceani DSM 16646]
    MPHCCNHGPGRSDITLKVSGMSCSHCKHAVESAVKALPGIEKVDARVEDGKVDVSFDPSKVSLEQITRAIEDAGYEVQR

    >gi|302389373|ref|YP_003825194.1| dihydrolipoamide dehydrogenase [Thermosediminibacter oceani DSM 16646]
    MLLVDEISIGGGREVSKRIVVIGAGPGGYVAALKAAKLGAQVTVVEKDKVGGTCLNRGCIPTKALLASAEVLTAIKEAEE
    YGIRVEGKITPDMGLIIARKNKVVERLNKGIEFLFEKNNVRLVKGKGTLVGNKAVKVELEEGGCETLEADNIIIATGSSP
    AKIPVFPFDGKRVLTSDEILDLDYVPSSIIIVGAGVIGCEFGTFFSAVGSAVTMVEMMERVLPTEDSDLGKEMEKVLKRK
    KIKLHLKSRIEKVEIKENGVKAVLDSGKELEAEIMLVATGRRAEINDLGLETVGVKTDKGRIIVDDRMETSVKGIYAIGD
    IVPGLQLAHVASFEGICAAENIMGIESRMDYSAVPRGIFTDPEVGAVGMTEEEALNAGFRIRTGRFYFRGLGRAQAAGKI
    IGFAKIIAEEGTDKILGASIIGPNATDLVHEIVPAIKCAITVKDMSKLIHSHPTFSEAVMEALHDVHGQSIHNA

    >gi|302389450|ref|YP_003825271.1| OsmC family protein [Thermosediminibacter oceani DSM 16646]
    MAKVTFKAKADWKGGLVAEATARGFKVTLDEPKDLGGTDTAMNPVEMLLCSLGGCMTIAASAFAPMCGVELKGFSVELEG
    DLDPDGFLGKNPNVRKGFSEIRYRMYIVSDSPEENIKKLYKMIEER
    CPVKDTLQGVPVSGEMIIEK

    >gi|302389984|ref|YP_003825805.1| dihydrolipoamide dehydrogenase [Thermosediminibacter oceani DSM 16646]
    MHYDIVVIGGGPGGYVSAIYAAKKGARVGLVEKRDLGGTCLNRGCIPTKALSHCAQIYQSLGNAKNFGILAENVKIDWQL
    AQGQKDSIVRTLGKGVENLLKANGVSVFRGEAKLEDERRIRIYYSGGQQVITAENIILATGSKPAVIPFPGHDLPGVITS
    EEALALSKIPDSMLVIGGGVIGVEMACIYGSIGSNVTVVELLPRILPRADEEISSEIKKVLQSKGIKVLTGTRVESVEKE
    KDLLKVNIITPDGPRSIAVEKVLVAVGRKPDLEAFEDLNIDLDKSGVIVDDFMRTSLKNVYAVGDITGKFQLAHVAAHQG
    IVAASNALGENKRMDYRAVPSCIFTNPEIAYVGLTESEAREIYGDDIRVGRFPFVASGRALTLGESLGFVKIVADSRWNE
    ILGVHIIGPGATELIAEAALAIRLECTAQELADTIHAHPTLSETIMEAAMDLLGTPIHKM

    >gi|302390164|ref|YP_003825985.1| Thioredoxin domain protein [Thermosediminibacter oceani DSM 16646]
    MIEVNSENFEQEVLRSEKPVLVDFWSPRCEPCKALMPHVEKLEDVYGDRVKFCKLDTSKNMRLAISQKVMGLPTLTIYKN
    GEKVDQVTKEVTIEMVEEMIKRNI

    >gi|302390264|ref|YP_003826085.1| heavy metal translocating P-type ATPase [Thermosediminibacter oceani DSM 16646]
    MGAEEKLYRVNEKKVYRVEGITCLDCAAKFERNVAALPGVTRAVLNPATGRLTVEGNVDIDAIRREGLKENYKIFPAEEK
    EERAQAGTGIKINKELLRTVVSAAALLAAYIGRKVGVIAYFYVPLFLLAMVAGGWENFRKAYYSLRRLNLNMSVLMSIAV
    IGAVAIGELEEGAVVAFLYSVSEMLESWTMERARRSIRLLMDIAPKTARIKKPWGEVDVPVDEINIGDIIVIRPGEKIAM
    DGVILKGESAINEAAITGESIPAEKGPGDEVYAGTINTHGSLEVKVTKLVQDTTLAKIIHLVEEAQTRRAPVQAFVDRFA
    AVYTPIVIVLAGAVALVPPLFLGHEWTPWLYRGLALLVVSCPCALVVSTPVAVVSAIGNAARNGVLIKGGIYLEEAGSLK
    VVALDKTGTLTRGKPVVTDVIAVGNESETEVLRKAASVEKRSEHPLAVAIVKAAEARGVEMIPAEDFTAFTGRGARGSVD
    GEALFVGNMKFFEELGVEAGGITEDVKRLQEEGKTAMLVGTENGIIGIIAVADEIRETSKKALALLKRAGIERTIMLTGD
    NKATAKAVAARAGVDEFLAELLPQDKVRALEDLIKKYGKVAMVGDGINDAPALAAATLGIAMGGTGTDTALETADIVLMT
    DDLTKVAFTIRLSRAALQVIRQNITLSLVIKALAVAAVFPGWLTLWLAILADMGATLLVTLNGIRLLKIKKLEERT

    >gi|302390271|ref|YP_003826092.1| hypothetical protein Toce_1734 [Thermosediminibacter oceani DSM 16646]
    MNSIDSKRKPNRLINEKSPYLLQHAYNPVDWYPWGTEAFEKAKTENKLIFLSIGYSTCHWCHVMEKESFEDEEVGNILNR
    YYVSIKVDREEHPDVDNFYMEVCQALTGSGGWPLTIIMTPDKHPVFAATYLPKEDSYGRPGLKTVLFKINELWQKDRERL
    ITTGREIVSSIKKLERTGHGELDPGVIDKAFEILKASYDRKYGGFFGAPKFPMPGTLLFLLGYYHYRKDPEALEMVENTL
    KNMYKGGIYDHIGFGLCRYSTDRRWLVPHFEKMLYDNALVSFVCAEAYKIARDEFFKTFALEIIDYVLRNLRNPEGGFYT
    AEDADSEGEEGRFYTWTPQEIRHVLGDRADEFMESYNITERGNFEGKNIPNLIGRDLSCKMDEDTRKKLFEYREQRVKPF
    RDEKILVSGNSLMIASLFRVYGITKNENYRKEAEVALNFILENARGSDGRLHVGYREGIMKAKATFDDYSHLLWALLEAY
    EYTLETSYLKKAKSLADEMIDLFYDKEAGGFYLTGSDVDHLPARAKDAYDGAVPSGNSMAAFSLARLSRLLFDSGMEELA
    RNQYRVFARTISENPVYHTFFLYSFIYAVTGGTEVIIAGERPEMFTNYLAENFFPYAVWAHADRLKEIVPAYENYGKIGG
    RTAAYVCKNGSCKSPVTTLEEFKEALDFDG

    >gi|302390500|ref|YP_003826321.1| redox-active disulfide protein 2 [Thermosediminibacter oceani DSM 16646]
    MEIKILGTGCPKCRALEQNTREALEELGISANIEKVQEVNKIMEYDIMFTPGLVVNGEVKVEGKVASKDEIKEILRQFI

    >gi|302390503|ref|YP_003826324.1| selenophosphate synthase [Thermosediminibacter oceani DSM 16646]
    MEKVKLTELTCSSGCASKLSPSALSQVLRHLPVIKDENLLVGLETSDDAAVYKINEELAIIHTVDFFTPVVDDPYLFGQI
    AACNALSDIYAMGGRPLLALNIVGFPEKLVEDVLPLVMKGGADKVIEAGAIIAGGHSIKTPEPVYGLSVLGVVHPDRVLT
    NAGAKPGDVVVLTKPLGTGVFTTAAKAGMVDSRVEREALEAMNTLNKSASDAAVQVGVSAVTDITGFGLLGHAHEMAAGS
    GVTLRIQAEKVPVIPGILQYAAMGLLPAGLYANRKYLADKVAFAENIREELADVLFDPQTSGGLLISCPEERAEAMMEEL
    KNNGVKWASIIGRVEEKSGKDIIVE

    >gi|302390550|ref|YP_003826371.1| dihydrolipoamide dehydrogenase [Thermosediminibacter oceani DSM 16646]
    MDYNVIVIGGGPGGYTAAIRASELGARVALVEEDSLGGTCLNRGCIPTKVYAHAASIINEIKKAGDFGIAAQYTIDVDKL
    RAKKEKVVERLVGGVGYLMKAHKVDVIKGRAKFLDRNTIKVDRKYTAEKFIIATGSKTLIPPVPGMGLPGVMTSDRALEL
    ERVPERIAIIGAGIIGLEFANIYSSLGSQVIIIEMLPELLPMVDRDIAGILQSALENRGIELHLNSRVEKIEEGPIVVFT
    KSGNTERLECDAVLVAVGRVANVNGVEALNLRLEGKGIKVDDFMRTNIDNIYAVGDVTGGIQLAHVAAYQGIIAAHNAVG
    EKRKADMKVVPSCVYTEPEIAWVGLNEALAREKYGDIKVGTFTYSASGRALTMGEDHGLIKIIAEAKYNQIVGMEIIGRD
    ATEIIHEGALAIKEEFTAEEIAETIHAHPTISECIKEACEDILGLPINKVSLKK