Thermomonospora curvata DSM 43183

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|269124366|ref|YP_003297736.1| heavy metal translocating P-type ATPase [Thermomonospora curvata DSM 43183]
    MTTGAASERIELEIGGMTCASCANRIERKLNKLPGVSATVNYATEKATISAPGDITVEELIAVVEKAGYTAALPEPPAEP
    ERPAEPDELRPLRQRLITAIALSVPVIAMAMIPALQFRYWQWLSLTLAAPVVVYAGWPFHRAALINLRHGTATMDTLISM
    GTLAAFGWSLWALFFGEAGMPGLRHDFTLALTRGDGAMAIYLETAAGVTMFILAGRYFEARAKRRAGAALRALLELGAKD
    VTVLRGERTERIPVERLKVGDAFLVRPGEKIATDGEVIEGSSAVDVSMLTGESVPVEVGPGDAVTGATVNVGGRLVVRAT
    RVGADTRLAQIARLVQQAQSGKARVQRLADRISGVFVPVVIALALATLIYWLAAGAGATAAFTAAVAVLIIACPCALGLA
    TPTALMVGTGRGAQLGILIKGPEVLESTRAIDTVVLDKTGTVTTGKMALVEVIPADGVDAGQALRLAGALESASEHPIAR
    AIAAGAAERTGALPKVTEFGNVAGLGVQGVVDGHAVVVGRPRLLAEWSLALPAELEQAMAEAQARGRTAVAVGWDGAARA
    VLTVADQIKPTSAEAVARLRELGLRPVLLTGDNEPAARAVAEAVGIDEVIAEVLPAGKVEVVKRLQAQGRTVAMVGDGVN
    DAAALAQADLGLAMGTGTDAAIEAGDLTLVRGDLRAAADAIRLSRRTLATIKGNLFWAFAYNVAALPLAAAGLLSPMIAG
    AAMAFSSVFVVGNSLRLRRFRPLSGTAGHAAAPAPAARKTPVAP

    >gi|269124367|ref|YP_003297737.1| Heavy metal transport/detoxification protein [Thermomonospora curvata DSM 43183]
    MITSTYTVTGMTCGHCVASVKEEVGQVPGVTGVEVDLDSGRMTVTSDGPLEAARIREAVAEAGYQLKD

    >gi|269124369|ref|YP_003297739.1| Rhodanese domain protein [Thermomonospora curvata DSM 43183]
    MMFFGEDVPAVAVTDVPQDAYLLDVREQDEWEAGHIPTAVHIPMGELSDRAAEIPRDRDVYVICRSGVRSAQVTVALNNA
    GWRARNIDGGMKEWAGAGLAMVAESGAAPRVI

    >gi|269124663|ref|YP_003298033.1| OsmC family protein [Thermomonospora curvata DSM 43183]
    MDEITVLHQEGDEFAILVRDHVIRVDQPYRSGGRDAGPTPVELFVASLAACAAHYGRRYLARHGLRSEGLEVTADYTMSM
    ARPARIPRVRLQVRCPTDLPATHLEGLKRAMEGCTVHNTLHRPPAVRLEIEQPASKAA

    >gi|269124863|ref|YP_003298233.1| hypothetical protein Tcur_0600 [Thermomonospora curvata DSM 43183]
    MTGAFVAAFVLLAATVFGLVRRHRDGRLRPARGGDVPEAATDRLGPAELGAALGERATLVQFSTAFCAPCRATRRVLAEV
    AAMVEGVAHIEIDAESHLDLVRRLGVVRTPTVLVLDAAGNVRRRATGAPRKADVIAALGAVID

    >gi|269124865|ref|YP_003298235.1| Thiosulfate sulfurtransferase [Thermomonospora curvata DSM 43183]
    MSRSDVLVDADWVQQHLDDPGVVLVEVDEDVSAYDKGHIRGAIKIDWKNELQDPVRRDFVDKTGFEELLSRKGIANDDLV
    ILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDSRELVTEVPQRPATQYKAKDQDLSIRAFRDEVVDAIGKKNL
    IDVRSPDEFTGKLLAPAHLPQEQAQRPGHVPTARNIPWSKAANDDGTFKSDEELRALYEEAGVDFSKPIIAY
    CRIGERSS
    HTWFALRELLGLSDVKNYDGSWTEYGSLVGVPIELGEAK

    >gi|269124914|ref|YP_003298284.1| hypothetical protein Tcur_0651 [Thermomonospora curvata DSM 43183]
    MGRSLVIKATSGADAKERCNQAFTVAAAGVAAGAKVSLWLTGEAAWYALPGRAEEFELPHATPLRDLLEVVLAGGTVTVC
    SQCAARRDIGPDDVIPGVRIAGAPTFVEEVMAEGAQALVY

    >gi|269125325|ref|YP_003298695.1| protein of unknown function DUF255 [Thermomonospora curvata DSM 43183]
    MNRLKNATSPYLLQHADNPVDWWEWGEAAFAEARRRDVPILLSVGYAACHWCHVMAHESFEDEATARLMNDLFVNIKVDR
    EERPDVDAVYMEATQAMTGQGGWPMTVFATPDGEPFYCGTYFPRQQFRALLMAVARAWREEREDVLKQGRKVVEALTARG
    PAPGETEPPSPERLSAAVRSLAASYDTAYGGFGGAPKFPPSMVLEFLLRHYARTQDAQALAMATGTLEAMARGGIYDQLG
    GGFARYSVDEAWVVPHFEKMLYDNALLARVYAHWWRLTGSPLAKRIALETCEWMLRDLRTPQGGLASALDADSEGQEGKY
    YVWTPEQLRRVLGEADGNAAAELLGVTESGTFEHGTSVLRLPGDPGDQEWWSRVRARLLAARAERVPPARDDKVVTAWNG
    LAIAALAECGALLGRPDLVGAAEEIARLLREVHLRDGRLTRTSRDGVPGANAGVLEDYADFAEGLLALHAVTGDPAHVRL
    AGTLLETVLTHFPDDRGGFYDTADDAERLFRRPQDPTDNATPSGQFAAAGALLSYAALTGSSRHRQAAASALAAATLLAG
    RHARFAGWGLAVAEALVSGPLEIAIVGDPADARTRALHGAALASPAPGAVITVGTGEAAGDVPLLRGRTPVDGAPAAYVC
    RNFTCRLPVTTPADLMAELAGG

    >gi|269125600|ref|YP_003298970.1| hypothetical protein Tcur_1350 [Thermomonospora curvata DSM 43183]
    MTQARTPVDFWFDPLCPWAWITSRWIHEVAALRPIEPRWHVMSLSVLNEGKDVPEQYRRLIAEGWGPVRVCIAAEQKYGP
    QVLGDLYTELGVRRHLRKLPFDRPTIEDALRAAGLDPELAQAAESTDYDEAVRASHAEGIGLVGEEVGTPVIAVEGVAFF
    GPVVTPAPKGEDAVRLWDGVLAVARTPGFYELKRTRTEEPSFE

    >gi|269125858|ref|YP_003299228.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermomonospora curvata DSM 43183]
    MAIASFMVPLGTPAPDFTLPAITGGTVSLKDLSGAPAVLVMFLSNHCPYVRRIESALGSVVAGYRDKGLAAVAICSNDVT
    NYPDDGPDHLREQAERAGFTFPYLVDETQEVAKAYRAACTPDFFLYDRDLRLAYRGQFDGARPGNDVPADGSSLRAAIDL
    VLAGKTVPEPHVPSLGCGIKWKPGNEPA

    >gi|269125875|ref|YP_003299245.1| Rhodanese domain protein [Thermomonospora curvata DSM 43183]
    MTDAPTPGRQARAGEGSPLIGVPELAELLRLPGPPTLLDVRWRLGGPPGMADYRRGHLPGAVFIDLDRDLAGPPGPAGRH
    PLPAPEAFQAAMRAAGVSGGRPVVVYDEADSTAAARAWWTLRYFGHPDVRVLDGGYRAWTAAGHEVTTAVPSPAPGDFTA
    RPGGMPVLDAAGAAALAENGVLLDARAPERYRGEVEPIDPVAGHIPGAVSAPTFGNVGPDGRFLPARRLRERFAALGVTG
    AAEVGAY
    CGSGVTAAHEVLALTLAGIPAALYVGSWSNWVADPANPVATGEG

    >gi|269125892|ref|YP_003299262.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermomonospora curvata DSM 43183]
    MAVEVGDVAPDFELTDQHGTPVRLSEHRGRHNVVVVFFPLAFSGVCTGELGAIRDELESLGRDTRVLAVSVDSKFALRAW
    ADKEGYTFPLLSDFWPHGEVARTYGVFDAELGVALRGTFIIDREGVVRWKVVHPLPEARDIDEYRKALAAL

    >gi|269126010|ref|YP_003299380.1| methionine-R-sulfoxide reductase [Thermomonospora curvata DSM 43183]
    MEKVRRSEDEWRALLTPEEYHVLREGGTEPPFSGEYNDTKTVGVYRCRACGAELFRSETKFESHCGWPSFYAPADSDAVV
    LLEDRSHGMVRTEVRCARCDSHLGHVFHGEGYGTPTDDRY
    CINSVSLTLEPAEPQ

    >gi|269126054|ref|YP_003299424.1| Peroxiredoxin [Thermomonospora curvata DSM 43183]
    MSVYDVEIQDLRGGPADLAQYRGKAMLVVNVASRCGLTPQYKGLQELHERYAERGFTVLGVPCNQFLEQEPGTHEEIAEF
    CSVNYGVTFPLTEKIEVNGEGRHPLYRELVDVPDATGYTGDIRWNFEKFLIGPDGSVLARFAPQTEPDDEQLVAAIERAL
    PR

    >gi|269126131|ref|YP_003299501.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermomonospora curvata DSM 43183]
    MKIGDVVEDFELPDEQGTLRSLSGLLAGGPVVLFFYPAAMTPGCTAEACHFRDLAAEFAELGAQPVGISADPVSKQREFS
    GKHSLGYPLLSDEDGTVARRFGVRRGFALAPTKRRTFVIDTDRRIIEIVKSEIRMSVHADRALEALRRRRG

    >gi|269126197|ref|YP_003299567.1| OsmC family protein [Thermomonospora curvata DSM 43183]
    MATIRTANAHWEGPLMGGQGTVSLDSSGLGTFEVTWPSRAEKPDGRTSPEELIAAAHSTCFSMALSHGLAGAGTPPESID
    TRADVTFQPGEGITGIHLTVRAKVPGLSAEEFQRAAETAKAN
    CPVSKALAGTGITLDATLI

    >gi|269126272|ref|YP_003299642.1| Rhodanese domain protein [Thermomonospora curvata DSM 43183]
    MSVIDVTAARELIAANPDVLLVDVRTPGEFAGVHIPGAVNLPLDQVEAHLERIVKDAGGRMILICRSGARAERCRRTLQT
    AGVHDALVLEGGMNAWIAAGGPVVRGRPRWDLERQVRLTAGGIVAASIAASLLWPPARFVAGLVGVGLVVAAITDTCALG
    MLLAKLPYNRPAQAGGGHEGLERPAGAER

    >gi|269126273|ref|YP_003299643.1| beta-lactamase domain protein [Thermomonospora curvata DSM 43183]
    MEVLSFRTPGLGDSTHLLIHEGIGVLVDPQRDIDRFLEAAAERDVTLRFVADTHLHNDYLSGAAQAAARTGAELVLPAGA
    APAYPCTPAFHMEDLKAEGGLVLRPLHTPGHTPEHTSYLVLVEGEPVAVCSGGSLLVAAAGRPDLLGPERAGTLARLQYR
    SLHRLAGLPRNVLLLPTHGEGSLCTSGGAGRYVSTIGEEVDSNPLLALASAEEFTERMLARPLPIPAFYRHMGPANLRGA
    PPMPPLEVPALQAADLAGLPPEVQVVDMRPRRAMAAGFVPGSTGIELGEDFGLWAGWLLPHGAPIVLIAEPGQDVAEAVT
    QLARIGFDRVRGVVTDLTGSRTARFEIAGLRLFAALARLPGAQVLDVRTPAEREEVALPGAIWRFLPDLVEQGVPEDLDP
    ARPVLVA
    CASGRRSTIAATVLHRAGFAPVVLSGAGVTELAALAALPGSGRR

    >gi|269126282|ref|YP_003299652.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Thermomonospora curvata DSM 43183]
    MRDFDILVIGSGPGGQRAAIAAAKLGRRVAIVDRRDMIGGVCINTGTIPSKTLREAVLYLTGLNQRELYGQSYRVKEEIT
    VADLGMRTRHVVGREVDVIRSQLARNRVTVVTGTARFLDPHTVEVTDGGGQRRELTADKIVIATGTRPARPASVEFDDET
    IIDSDGILRLKRIPDSMVVVGAGVIGIEYASMFAALGTKVTVVERRERMLEFCDLEIVEALKYHLRDLAVTFRFGENVKA
    VEKRPGGAITILESGKRIPADTVMYSAGRHGMTDDLGLEAAGLTADERGRIAVDDCYRTAVPHIYAVGDVIGFPSLAATS
    MEQGRLAAHHACGEPAGGIHELQPIGIYTIPEISFVGHTEDELTAAKIPFEVGVARYRELARGQIIGDSYGMLKLLVSPL
    DRSLLGVHVFGTGATELVHIGQTVMGCGGTVDYLVDAVFNYPTLAESYKVAALDAMNKMRQIALLDE

    >gi|269126737|ref|YP_003300107.1| DSBA oxidoreductase [Thermomonospora curvata DSM 43183]
    MGGMPRRQDRLDPDVNVEIFSDVVCPWCYLGQARFRAALAGFAGRVEVTWRPFQLDPTAPATAVPMNEHLAVKFGGAEKV
    AAAHERLRALTAAEGLPFAPEKALHVNTRDAHRVIELAGRAGVQDAVVERLFRAQHAEGRDLGDVGTLAELAGEAGLQAD
    AVRRSLESDEGTAEVERQLERARRLGVTGVPLFLFEGKWAVSGAQPAEVLAEALREVAARLPGSS

    >gi|269126859|ref|YP_003300229.1| thioredoxin [Thermomonospora curvata DSM 43183]
    MATVTLTADNFDKTAQGEGIVLVDFWAAWCGPCRRFAPVFESASERHPDITFAKVDTDAEIELAERFGISSIPTIMAIRD
    GIIVYAEPGALPEAVLEDVIQQVRDLDMDEVRKRLED

    >gi|269127084|ref|YP_003300454.1| DSBA oxidoreductase [Thermomonospora curvata DSM 43183]
    MSKAERYRNARERLAEQRRREEQRRKRLRALLVSGGAIALIAVVVVAVVLVRAGGDDGEAVATAPVSRQSDGSIVMAQPG
    VTGPVLEIYEDFQ
    CPACQKFEEATGKTIKQLAADGEVKVIYRPFSLFRASPEPTRGNSLRALNASLCAPADKWLAYHDKL
    FEEQGPESRTGFKNDDLIDWAADVGITGEAFEKCVKNTERQSLVDQANDIADKAGVQSTPWVALNGNKLGDVAVFTPEGM
    REAVRNAPASPAPSSG

    >gi|269127232|ref|YP_003300602.1| arsenate reductase-like protein [Thermomonospora curvata DSM 43183]
    MEIWHNPRCSKSRAAKAALDAAGVTYTERRYLDRPPTADELDRVLTAIGAEPWEVARLNEPVAKELGLKDLPRQRARWIE
    VMVAHPVLIQRPIIITDDGRAVVARDEAAVKRALEGA

    >gi|269127292|ref|YP_003300662.1| iron-sulfur cluster assembly accessory protein [Thermomonospora curvata DSM 43183]
    MTVESTETTEQVSGVILTDAAAAKAKDLLEQEGRDDLALRVAVQPGGCSGLIYQLYFDEREMDGDLVQDFNGLQVRVDRT
    SAPYLAGATIDFVDTIEKQGFTIDNPNATGTCACGDSFN

    >gi|269127302|ref|YP_003300672.1| dihydrolipoamide dehydrogenase [Thermomonospora curvata DSM 43183]
    MVDSGGPFDVVVLGGGSGGYACALRAAELGMRVALIERDTLGGTCLNRGCIPTKALLHAAEVAETARRAARFGVRASFEG
    VDMPAVHAYKDKVVSGTVKGLTGLLRAKGVTIVEGEGRLAGPTAVQVATPAGPVRCEGRHLVLATGSAPRSLPGLPVDGE
    RVIFSDQALTLQRVPASVIVLGGGVIGVEFASIWRSFGAEVTIVEALPHLLPMEEPSSSRRLERAFRKRGIAFELGARVE
    GVKTTETGVTVTLAGGRTLAAELLLVAVGRAPCSAGLGLAEAGVRTERGFVEVDRYCRTSVPTISAVGDLIATPQLAHVG
    FAEGILVAERLGGLSPAPIDYDGVPRIAYCDPEVASVGLTSAQAAERGHQIMQVTYDLAGNPKSKILGTQGEVKVIAERG
    GRVLGIHMVGARVGELITEGQLIYNWEALPSEVAQLIHPHPTQSEAVGEAHLALAGKPLHVHG

    >gi|269127385|ref|YP_003300755.1| beta-lactamase domain protein [Thermomonospora curvata DSM 43183]
    MFFAQYYLDCLSQASYLIGDEGTGRAVVVDPRRDVSEYLAAAKEHGLRIEGVINTHFHADFIAGHLELAAQTGAWIGYGR
    RAEAEYPIRKLADGERIELGDVVLQVMETPGHTPESISLLVFEHAGDEVPYGVLTGDALFIGDVGRPDLLASLGKTADEL
    GRMLYDSVHRKLMALPDQVRVFPAHGAGSACGKNLSTERWSTIGEQRLSNYACAPMSEEEFLAIVTEGQPSAPGYFVYDA
    VLNRKEHGLLDVDKRLRPLEAGEFLAHRAAGAVVVDARPTQEFVAGHVRGSLHVPADGRFAEWAGTVVAPGSRILVVAPQ
    DREKEVITRLARIGFDDVIGYLREPEGAFMGMPEEIAHGPRMTARELRAELDGEQPPLVLDVRNVGELRAGRIEGSLHIP
    LAELPGRLEEVPKDRTVVAY
    CAGGTRSAIAASLLRRHGHAQVLDLIGGYAAWRGALSPAGA

    >gi|269127417|ref|YP_003300787.1| alkylhydroperoxidase like protein, AhpD family [Thermomonospora curvata DSM 43183]
    MEARMDLAKTAPKPYQAVLAAYRTLAEGPLDPVVQELVKIRASQLNGCAFCLDLHVHEARRRGESEQRLALVAAWREAPV
    FSEAERAALAYTEEATRLSERGVSEEVWQAVTACFDQEEAGALVVLVALINALNRLGAPLRRRPAVR

    >gi|269127945|ref|YP_003301315.1| glutaredoxin [Thermomonospora curvata DSM 43183]
    MANPASTPDGRPTMYTTSWCGFCRRLKAQLAREGIYLREVDIERDPEAAEFVMRVNGGNQTVPTLLFPDGTVMTNPPAKK
    VKQHLESLAASGK

    >gi|269127961|ref|YP_003301331.1| UBA/THIF-type NAD/FAD binding protein [Thermomonospora curvata DSM 43183]
    MSLPPLVEPAAELTREEVNRYSRHLIIPDVGMAGQKRLKNAKVLCVGAGGLGSPALMYLAAAGIGTLGIIDFDVVDESNL
    QRQVIHRQSSLGVPKAESAAATVREINPLINVVVHNVALDRDNVMEIFSGYDLIVDGTDNFATRYMVNDAAVLLGKPYVW
    GSIYRFDGQASVFWAEHGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIQVNEAIKLITGIGEPLVGRLMIYDALE
    MTYRSVKVRKDPECALCGKNPTITELLPDYEAFCGTLSDEASEAVKDSTISVHDLKAMLDRGEDIFLVDVREPNEHEIVS
    IPGATLIPKGEFLNGSALERLPQDKKIVLH
    CKSGVRSAEALAVVKNAGFSDAVHVGGGILAWINQIDPSLPTY

    >gi|269128014|ref|YP_003301384.1| dihydrolipoamide dehydrogenase [Thermomonospora curvata DSM 43183]
    MSTHFDVVVLGAGPGGYVAAIRAAQLGLRTGIVEERYWGGVCLNVGCIPSKALLRNAELAYLFNNERKLFGIEVDGQVRF
    DFAAAVQRSRQVADGRVKGVHYLMKKNGITEFHGRGVFTDPHTLQVTPTDGGQAQTVTFDHCIIATGAHPRLLPGTSLSE
    RVVTYEEQILAEELPESIVIAGAGAIGVEFGYVLHNYGTKVTIVEFLDRMVPGEDEEVSKELARRYRKLGIDVLTSTRVE
    AIDDSGEKVKVTVTGSDGQPKTLEADKVLQAIGFAPNVEGYGLEKTGVRLTDRGAIDVDARCRTSVPHIFAIGDVTAKLM
    LAHTAEAMGIVAAETIAGAETMEIDYRMVPRATYCQPQIASFGLTEAQARAEGYDVKVAKFPFTANGKSHGLGDPNGFVK
    LIADAKYGELLGGHMIGPDVTELLPELTLAQQWDLTVHEVARNIHAHPTLSEAVKEAVHGLAGHMINF

    >gi|269128058|ref|YP_003301428.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermomonospora curvata DSM 43183]
    MSERLQPGDVAPDFELPDADGTTVSLSSLRGKRVIVYFYPAAMTPGCTKESVDFRDSLPELEAAGVAVVGISPDPPAKLA
    KFRERDGLTFPLLSDPDAKVLRAYGAYGEKKLYGRVVVGVIRSTFVIDPEGKVEKAYYNVKATGHVARLRKDLGL

    >gi|269128083|ref|YP_003301453.1| Thioredoxin domain protein [Thermomonospora curvata DSM 43183]
    MASRDFSIRGAIDLGARQAALKKQQEQAARAAQTSGNGPGAAGGYVVDVTDATFNTEVVERSRSVPVLVDFWAEWCGPCK
    QLGPILERLAEEAAGQWILAKVDIDANPQLAAYMQQMGVRGIPFVAAVVGGRLMPLLPGAYPEPQVRQIIGQFMDALRRE
    GMLPQGGPGAGAQPEPDPVYAKAQEALQRGDLEAAKTAFQEILNSSPQDAGAKRGLAEVELHLRARQLDPGRALAEADAA
    PADVALQTKAADVEMLSGRVEEAFERLVATVRRTAGEDRDAARKHLLSLFEVLPPDDPRVSQARRRLQTALF

    >gi|269128280|ref|YP_003301650.1| thioredoxin [Thermomonospora curvata DSM 43183]
    MSAPIKVTDETFDELVLKSDKPVLVDFWADWCGPCRMISPILDEIAAEYADKLTVAKLNADENPATVAQAGVQGLPTLNL
    YVNGEVVEQIVGAKPKRALLSTLAPHLGVVAK

    >gi|269128330|ref|YP_003301700.1| methylated-DNA/protein-cysteinemethyltransferase [Thermomonospora curvata DSM 43183]
    MTINTTVLQTPIGPLALLEHDGALVGAGFTADPAELHARLHPSLRALELRPVGDLGAITKAHLAYFDGDLTALDALPVHH
    PASQRRERLWRALRRVGPGQTVTYAELAVLAGMDRTAARAAGQACAQNLIAPAIP
    CHRVLPSGGAPKGRLGGYYYGLERK
    AWLLSHESAVTGGRPDASAAPAPR

    >gi|269128375|ref|YP_003301745.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Thermomonospora curvata DSM 43183]
    MTRIVIIGGGPGGYEAALVAAQLGADVTIVERTGLGGACVLTDCVPSKTLIATSTRMGVMSESASLGLRFDGGPDGIVGG
    LTVDLAQVNKRVKDLARAQSFDVAERLAYEDVRIVRGEARLSDPHTVTVNGTDLPADIILIATGATPRVLPGAEPDGERI
    LSWRHLYDLTELPEELIVVGSGVTGAELAGAYLSLGSRVTLISSRDRILPTEDADAAGVLQEVFLRRGMKVLSRSRAAAV
    ERTGDGVVVTLEDGRKVEGSHCLMTVGMEPNTRGIGLEKAGVKLSRGFVQVDKVSRTSVSHIYAAGDCTGVMMLASVAAM
    QGRIAMWHALGEAVQPLKLGWVAANIFTDPEVATVGVTQKMIDAGEVNARSVMLPLFSNPRAKMQGFEDGFVKLFCRPST
    GIVLGGVIVAPRASELILAVSLAVQQHLTVDQLAQTFAVYPSLSGSITEASRRLMQESAY

    >gi|269128438|ref|YP_003301808.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermomonospora curvata DSM 43183]
    MLTVGDQFPEYELTACVSLDPDKAFETINHKTYEGKWRVVFFWPKDFTFICPTEIAEFGRLNGEFADRDAQVLGVSVDNE
    YVHYAWRKDHPDLRDLPFPMLSDINRELSSALGILTKEGVAQRATFIVDPDNEIQFAMVTAGSVGRNVKEVLRVLDALQS
    DELCPCNWNKGEATLDPKKLMAGA

    >gi|269128597|ref|YP_003301967.1| peptide methionine sulfoxide reductase [Thermomonospora curvata DSM 43183]
    MFGIFNTAFKTEMVPADKALPGRDTPMPVPPAHEVLGTPLAPPYPEGSEIADFALGCFWGAERTFWQVPGVITTAVGYQG
    GYTPNPTYEEVCSGLTGHAEAVRVVYDPAKVTYERLLRVFWESHDPTQGMRQGNDIGTQYRSAIYTHSEAQRKAAEASRE
    AYQKALTAAGHGTITTEIAPAGPFYFAEPYHQQYLSDAKNPNGYCGLGGTGVSCPVGIAPAE

    >gi|269128626|ref|YP_003301996.1| Redoxin domain protein [Thermomonospora curvata DSM 43183]
    MPGVKAAAAAVVAVCALLAGCAGTTASQGGPDSGDERFIAGDGTAQVIAPAARKTVANVAGTTLDGEPLALADLRGKVVV
    MNFWASW
    CAPCRGEAPTLQKLSQEHKSKGVEFVGVNFKDAKDQALAMERSFGITYPSLFDGDGRLMLAFRDIPPNAVPST
    LIFDRQGRVAVRVIGATTYSKLNPLINRVVAEG

    >gi|269128755|ref|YP_003302125.1| uncharacterized peroxidase-related enzyme [Thermomonospora curvata DSM 43183]
    MAHIDLDDGIPGLPSLLRFRPETAGALSALAETLLRGPSPLARGERELIAAYVSTLNDCRFCAGSHSACAAAQLEGGMSL
    VEQVHADPDAAPISDKLKALLRIAAAVQRSGKDVTAEHIAAARAAGATDVEIHDTVLIAAAFCMYNRYVDGLGTSVPPDP
    RAYAQMAERLVAHGYGSAAPGPDPR

    >gi|269129142|ref|YP_003302512.1| thioredoxin reductase [Thermomonospora curvata DSM 43183]
    MSDVRNVIIIGSGPAGYTAAIYAARADLKPLVFEGSVTAGGALMNTTEVENFPGFPDGIMGPDLMDNMRKQAERFGADLI
    ADDVTEVDLTVHPKVVKTGDTEYRAKAVIIATGSGYRELGLENEKRLSGRGVSW
    CATCDGFFFRDQDIAVVGGGDSAMEE
    AIFLTKFAKSVTVVHRRDQLRASKIMQDRAFANDKIRFVWDSEVVDILGEDRVTGVRVRNRKTGEESTLQVTGLFIAIGH
    DPRSELFKGQLDIDENGYLVVDSPSTRTKIPGVFACGDVVDHTYRQAITAAGSGCAAAIDAERWLADQGEAELVHQPTA

    >gi|269124737|ref|YP_003298107.1| Rhodanese domain protein [Thermomonospora curvata DSM 43183]
    MVTVRPPQARSIEEILQAARRRLDRLEPAEAHREFSRGQALLVDIRPQAHRAAEGEVPGSLIIERNVLEWRFDPASPARL
    PQATGYDVRVIVL
    CAEGYTSSLAAASLHELGLTRATDVIGGYRAWRAAGLPTTGAPHAAAPDPTYPTLPPEPVMNARPAR
    RSR

    >gi|269128637|ref|YP_003302007.1| glutaredoxin 2 [Thermomonospora curvata DSM 43183]
    MTAPVTITLLGKPGCHLCDEAREVIVRVAEEMGADWEEHDITQSPELLRRYWEQIPVTLVNGVQHDFWRVDEARLREAVA
    KARHG

    >gi|269128439|ref|YP_003301809.1| alkylhydroperoxidase, AhpD family [Thermomonospora curvata DSM 43183]
    MSVDALKEALPAYAKDIKLNLGSVTSTSQLTEQQLWGTVLACAMATKSKQVIAELAEEAGDYLSAEAFEAAKGAASIMAM
    NNVYYRATHLIGDETYAQLPVKLRMTIIGKPGVEKVDFELWCLAVSAINGCGR
    CLESHEKVLREAGMPREHIQEALRIAA
    VINATAATLEAEAALAPAGV