Thermomicrobium roseum DSM 5159 uid59341

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|221632106|ref|YP_002521327.1| thioredoxin [Thermomicrobium roseum DSM 5159]
    MAKPVTVSDETFEREVVQSPVPVLVDFWAPWCGPCRMIAPILEEIAEEKAGKLKVAKINVDENMQVAMQHGISSIPTLIL
    YKGGKPVERIIGAMPKQRLLQQIEKHL

    >gi|221632192|ref|YP_002521413.1| hypothetical protein trd_0158 [Thermomicrobium roseum DSM 5159]
    MSEETKKILYVQTHGVDTPERSATPFFLAAAAAAMEIEAAIYFTMNGPTLLKKGVPETLVVPKAGGGGAKLKHFIDQALD
    LGVKLYV
    CQPSLDLHGLTMDDLIEGVQMIGGAAFNLMALEADAVVAF

    >gi|221632489|ref|YP_002521710.1| flavin containing amine oxidase [Thermomicrobium roseum DSM 5159]
    MTGPQYDAIVIGSGHNGLIAAGYLAKAGKQVLVLERRPIIGGATVTEEHFPGYRLSTCSYVCSLLLPEVVRDLEMPKYGY
    EVRPFDPQYFVPFPDGRYLMVYLDERRTHAELAKFSRRDAERWHDYWAMWNRMIARFRPFILRPAPTLGELEQAFAGPDG
    LEDLRTLLLKSIAEVLDTFFESEEIKAPLCTGGVIGVNLGPKSPGTAYVKFHHLLGNLNGHQGAWGFVRGGMGSIAEALA
    GFCRDHGVTILTDAEVAEIDVSDGAARGVRLTDGRRFSARVILSNADPQRTFLQMVPANALPASFRDAITRMKVKGSVVK
    VLLGLNQLPNFRCLPGTEIGPQHTGGIVINPSIDYLERAWEDCKHGRPSARPFMDCYIQSATEDGLAPPGKHVMSLYVQY
    APYDLAEGTWEERKDEIGRNIIDTLAEYAPNMWDAIEHMSVLGPRDIEDVIGITGGNIFHGEITPDQMFVFRPAPGFSGY
    ESPIERLYLCGSGAWPGGAVFGAPGRNCALQVLADLERRGG

    >gi|221632512|ref|YP_002521733.1| hypothetical protein trd_0486 [Thermomicrobium roseum DSM 5159]
    MRAEKGDGTTMTQQSRLEQFRAYRARMNQRIGEIGHREINRFFALDSATYRDGALDARTKELLGLVASLVLRCNDCVDYH
    LDRCVALGWSDAELYDAMQVALMVGGSIVIPHLRHAVETLDLLRAERHERD

    >gi|221632535|ref|YP_002521756.1| Protein of unknown function, DUF255 family [Thermomicrobium roseum DSM 5159]
    MPNRLANEKSLYLRQHADNPVDWYPWCEEAFRVAREQDKPILLSIGYSSCHWCHVMERECFENPEIAQLQNELFVNIKVD
    REERPDLDELYMNALQAMTGSGGWPLNVFLTPDGKPFYGGTYFPPEDRGQLPAWPRVLLAVAQAYRERRADVERAAEDLV
    SYLQQQSRPPLQAAPLREQFLDEAARNLVPHYDREHGGFGTAPKFPSPLQLEFLLRTFRRAGAPRALEMVLQTLTAMARG
    GIHDQIGGGFHRYTVDEAWLVPHFEKMLYDNALLARVYTLAHLASGNRLCRTIAEETLVYIQREMRGDHGAFFAAQDADS
    EEGEGAFYLWTPEEIAAVLGNDDAGLACRYFGVTPRGNFEGKSILHVAEDPVTIASEFGLSLDELEQRIGSIRARLYEAR
    DQRPHPARDEKVIVAWNALAIRAFAEAGTALDRPDFVALAERAATFLRDQLWDGKTLYHVWEEGEARFPGFLDDYADLVN
    ALVSLYEATFDPFWIAWARQLTEAILAKFIDPVAGDFYDTASDGEQLIVRPKTFIDQGTPSGNGATAEALLRLGTLLGEH
    RFIDQARTLLERYAQLAVEHPIACGQLLLAMDFALGQPFEVAIIGDPTQPETRALLRVVQASYLPNRVLALRRPEDEIAA
    SIVPLLAERSLVDGHPAAYVCRNFACQRPVTTPQELASQLGIALPDS

    >gi|221632541|ref|YP_002521762.1| 3-mercaptopyruvate sulfurtransferase [Thermomicrobium roseum DSM 5159]
    MVSERLTAHFVDTGWLAERLGNPLVRIVDCRYYFDGRDGYEEYRKGHIPGARYLDWTVVTVDPHDPVAYRLAPSQYIAGR
    LGELGIGDEHLIVGYDDEGGHFVARLWLALAYYGKADRLRILEGGWTRWVAEGRSTATDEPVWPRAAFHLPSTPVHPELV
    ADARDVLEALAFGKSVVLDVRRLSEYTGEEVRARHGGHVPGARHWFWQRSLDWDGLRMFRPPEEVRAGLAELGVTTSTPV
    ITY
    CHGGVRAAHAALALARAGFRHVRVYVGSWAEWGNRDDLPRALGLPHGDGRES

    >gi|221633086|ref|YP_002522311.1| senC homolog [Thermomicrobium roseum DSM 5159]
    MTLRRLRLLLWILALSALGTSAGIAWYRWYIAQHTDTWALELDGRPVPAFQLLDQDGRLVSLDALEGDLFVVTFAYTTCP
    DTCPVTLRRLVAVLQRLPETLRDRIQLLAVTVDPERDTPDRLRQYAVANGFDLSLRFLTGDRAALEPVWSGFGIAVVRHP
    LPQGQYEVQHTAVTYILDRSGSLRYLIRDEALEPARLAELLERLVR

    >gi|221633155|ref|YP_002522380.1| OsmC-like protein [Thermomicrobium roseum DSM 5159]
    MAIRTNGMLVKEAVSNLAAAIRANPRLATGTTTVRVHWQGGTQAIGRVRQFEPIVIDEPPAFGGTDRGPNPAELLLVALG
    A
    CQELTLAVLAEQLGLQIESIEVEVQGELDLRGFLGIDRAVRPGFQRIEMTVHITSPEPEERLRDLLDLADQLCPVSDML
    RQPVPTETILEVSHPMGTGVDPVLTTRR

    >gi|221633156|ref|YP_002522381.1| putative thiosulfate sulfurtransferase precursor [Thermomicrobium roseum DSM 5159]
    MATLEIDPRVAARGYAHPESLVTTEWVAEHLNDPNVRIVESDEDVLLYELGHIPGAVKVDWHTDLQDPVVRDFIGPEQFA
    ELCSRLGITPETRVVFYGDKNNWWAAYAFWFFRYMGHGPLSIMDGGRKKWEAEGRPMTREVPSYPRTNYPVPKPNPELRA
    FRDEVLAFIGYRDRQKVGEPRGALVDVRSPGEYRGELLHMPDYPQEGALRGGHIPGAANIPWAQAVNEDGTFKSPEELRK
    LYESQGVTPDKEVIVY
    CRIGERSSHTWFVLHELLGYPKVRNYDGSWTEWGNVVGVPIER

    >gi|221633208|ref|YP_002522433.1| c-type cytochrome biogenesis protein/thioredoxin dsbE [Thermomicrobium roseum DSM 5159]
    MTTTQGLWRARLPVLIAGVFVLAFVALVAVAFERQRGTSELGAGGRINTVGTFIRFANRAAPDFTLPDLRGGKDIALADL
    RGQVVIVNFWGSW
    CPPCREEAPVLAAFAREYADDGVTVVGIDVWEKDWNDGRAFLEEFRVDYPNVYDARGRVTIDYGVSG
    VPETFFIGPDGQLLGKYTGPLKSADQLLSILAELGITLSPMR

    >gi|221633260|ref|YP_002522485.1| putative pyridine nucleotide-disulphide oxidoreductase [Thermomicrobium roseum DSM 5159]
    MAIRKERLVIVGGDAAGMSAASQVRRLRSDVEIIAFERGAFTSYALCGLPYYVAGYVAEWSQLIARTPEAHRRNGIDVRL
    RTEVIGLDLARREVIALDHEQRREYREPFDQLVLATGARPRELAVPGRDAAGIFTLHGIEEAQALVDWLARERPQRAAVV
    GGGYIGIEIAEAFRARGLATTLIEAGEQVMPMLDPDMAELVERALREEQVTVLTKAPVEAFATRGGRIRAVITPAGEIAA
    DVVVIGIGVEPNSELARATGLVVGERNAVHVDDRCRTSEPGIWAAGDCADVSHRLLGRSVYFPLGTTANKQGRICGLNLG
    GRDARFPGIVGTAITRFGDTEIARTGLSEREARVAGLSVITGHARSTTRSGYFPGASWMTVKMLAEESTGRLLGAQIVGG
    PGAGKRIDTVATALSAGLTLEEFIYLDLAYAPPFSPVWDPVVVAARKLAREA

    >gi|221633289|ref|YP_002522514.1| molybdopterin biosynthesis protein [Thermomicrobium roseum DSM 5159]
    MARRYEQLFQEIKRAIREVDVHQLYQQLRSGRRPVIIDVREREEWEQGYVPGALFIPRGYLEMRIEEEVPDKSTPIYVYC
    AGGVRSAFAAKTLEELGYQNVYSVAGGFSAWKHAGYPFVTPRQWTREQLQRYSRHFLIPEVGEEGQAKLLDSKVLIIGAG
    GLGSPAALYLAAAGVGTLGIVDADVVDLSNLQRQILHTTDRVGRPKTESAREAITALNPDVEVIAHDVWLSSQTILDVIR
    DYDVIVNGADNFPTRYLVNDAAVLLGKPVVDGSIFRFDGQVTVYKPGEGPCYRCLYPEPPPPELAPS
    CDQAGVLGVLPGV
    IGVLQATEAIKLLLGIGEPLVGRVLLYDALAATFRELSVERDPECAACGPNSTLTVETIGQIDYQQSCILPVRQTAAD

    >gi|221633343|ref|YP_002522568.1| periplasmic binding protein [Thermomicrobium roseum DSM 5159]
    MRIVSLLPSLTEICWALGLADELVGVTHECDYPPLVRCKPRVTRSLLPPNLSHAEIDAAVRERTAARLPLYALDTELLAT
    LQPDLILTQALCPV
    CAISIDDVCQLAATLPGPPRVLSVEPTTLEEILISVELVARETGRERTARAIVSALRQRLAWISAR
    LAGRTEEPRVVCLEWLEPPIVAGHWVPEMVAAAGGRDVLGIAGQPSYTVTWDQVAAAEPDILVAMPCGYTLSETVDLAHQ
    LLGHPIIQSIPAVQRGALWAVDASAYFSRPGPRVVRGVEILAAILHPERCSSDVQRLAVPVRTGTPLAPA

    >gi|221633394|ref|YP_002522619.1| cation-transporting ATPase pacS [Thermomicrobium roseum DSM 5159]
    MSDPREQRRAESTPVVRLAIEGMTCASCVRRVERALASVPGVAEASVNLATEEAAVTLSRPDVAVEELTTAIERAGYHAR
    PLATPPASEAEAAATVELAIEGMT
    CASCVRRVERALSQVPGVQEASVNLASERALVRYDPHTTSLDALIGAVEAAGYHAA
    IVPTIPAVAEASDEAEQRRARQLRRLRDEVILAWVLALPVVALNMFVPPSRWSSIVLLVATLPVWGYLGRRFHFAALHNL
    RHGQFTMDTLVSLGTSAAFFSSLASTLAALWAPHAHVGHTYYDVAAVVIAAILLGRYLEARARGQTTSAVRRLLGLQPKT
    ARVRRGGREIEIPVHEVLPGDLVVVRPGERIPVDGFVIEGRSAVDESMLTGESLPVEKGPGDRVWGGTLNTTGTFVLQAT
    AVGQATVLAQIVRLVQHAQGSKAPIQSLVDRVASVFVQAVIVIALLTFAGWWLVTGDPLRGLLPAVAVLVIACPCAMGLA
    TPTAVIVGTGRGAELGVLVKRAEVFERMERLTTIVLDKTGTLTLGRPTVTDVIPVAGWSAEELLRLAAAAESRSEHPLAR
    AVIEAALENDSTVPSVERFEAFPGRGVEALVAERMLLVGTMRFLQERGVTVEPASEDAAALEAAGKTVIAVAVDGTLAGL
    IGLADRPRPEAPTVVRALRDRGLRVVLLTGDNERTARSIARAVGIDEVRANVLPDQKASVIRALQEEGQIVGMVGDGIND
    APALAQADVGIAMGSGTDVALEAGDVVLVRPDLHGILVALELARRTLATIRWNLFWAFAYNTVLIPVAAAGLLNPMLAGL
    AMALSSVFVVSNSLRLRRFTPAGWEGRETGRIGAESSVLAAR

    >gi|221633506|ref|YP_002522731.1| cadmium-translocating P-type ATPase [Thermomicrobium roseum DSM 5159]
    MAESVRSADEQQRWTTLILPVAELDCAECAQHVEQALRTVPGVLDVEGFPVARKVAVVLDPTRVDRVAIERALARAGYTV
    GSEPAEDTQRTWRRVALLSGVAVAVVLGVVVAELAGLVERANQVIPWPIWLLGIAIGGWPVFRDVARASWQRRVTAHTLM
    TIGALAAMVVGAWAAAAIVVLFMRLGSALEEVTGRQAGRALRELAALAPQLARVERDGSELEVPAGSVAPGEIVLVRTGE
    AIPVDGTVLEGTALVDEAALTGEPLPRAVAAGDPVYAATVVRSGSLRIRATAEAAGSTFARIVRLVEAAEGQAGRLQRVA
    DRFSGWYLPVVVAVALLTLILRRDALAVAAVLVVSCSCAFALATPMAFVATIGRAARRGVLIKGGAILERLARADILLLD
    KTGTLTLGRPMVTDVVPVAGRCSVEELLSLAAAAEHAATHPLAEALRLAARERGVALVRPEWSVVDPGIGVRARVAGRSI
    RVRAPLQEEASVPEIAAFQEEGKTVVIVERDGEAIGIVAFADELRPGIAEAIAELRRSGFRTIELLTGDHERAAEALARP
    LGIGWRARLLPEDKLAIVAAYQAQGHVVVMVGDGINDAPALAQADVGIAMGQLGTALAAETADVVLLREDWALIPETIRA
    ARRALRTAWVNLAGTALYNLVGLSLAALGLLPPTLAATAQVVPDVFILGNSARLGFGKR

    >gi|221633531|ref|YP_002522756.1| HesB/YadR/YfhF [Thermomicrobium roseum DSM 5159]
    MQQTTLITMTPEAVRRLKQFMDEQGMPEAYLRVFVAPGGCSGLQYGMALEESAEEDDFTFEIDGVRVIVDPFSATYLEGA
    EIDYVNSLMGGGFTVHNPNAVATCACGHSFDAGGNAGTAQGCGCGGW

    >gi|221633544|ref|YP_002522770.1| putative molybdopterin biosynthesis MoeB protein [Thermomicrobium roseum DSM 5159]
    MTSDESAERHHRQILLPVIGRAGQSRIRAGRVCVLGLGALGSHTTMLLARAGVGFLRLVDRDVVEWTNLQRQALYEEEDV
    RAALPKAVAAARAVQRIDQAIAVEPVVLDVDAASITGLIADVDVVVDGSDNFELRYLLNDAALELGRPWVYGGVIGTHGS
    TMTIVPDETACLRCLFPDPPAPGSVPT
    CDTVGVLGPAAALVGALQASETLKLLVGDRAARNPGLLSIDLWKVEIARIAVE
    RRSDCPACGRGERAFLRQQVANRIVSLCGRDAVQVVVRPAVSLDLAALAERLSALGSLQHNPYLIRFMVEGYELTVFPDG
    RAIVRGTTDPAIARVLYARYIGM

    >gi|221633837|ref|YP_002523063.1| glutaredoxin 3 [Thermomicrobium roseum DSM 5159]
    MGRLELYGTRWCPYTAELRSSLEWRGVAFIEYDVDADVDARQRLLQLTGGRRTIPVLVEDGRVVLIGWQGRGCTI

    >gi|221635547|ref|YP_002523423.1| dsba oxidoreductase [Thermomicrobium roseum DSM 5159]
    MSSSRENLPPAASQAERVPRRAQRKLEAERRARRRRVLFITVPVVIALVAAGVGIWWSQRSAREVAAVQMPDVSKYTSVP
    RDGRVLGDPNAPVHVIEWGDYQ
    CPACKSFEQRFFPTILEQYIVTGKVRWEFRDFAFIGKESVRAAEAAACALDQGKFWEF
    HAALYANQTGENVGAFTDRRLEEIARVAGLDVGAFRSCLRQGKHADEVQQMVREAQSLGVRATPSFSVNGSAPFTIRSLS
    DLTQRIEEASK

    >gi|221635786|ref|YP_002523662.1| mercuric reductase [Thermomicrobium roseum DSM 5159]
    MTPANHESALVTYELDVEGMTCRDCERHVETAVEASGGIEPRADWRRRRVRFAAPPTFDPQPVFAAIRAASGQLHRYEPG
    QLRRLAPVQLDDESPDADADLVIIGGGSAAFAAAIEAHQLGARVIMIERGTLGGT
    CVNIGCVPSKFLLRAAEVAHLAATR
    RYRGIRSQLEAVDLAAHVAQKQDLIAALRREKYEELVDYYGWELLHGTARFVDPQTIAVGDRLIRARAFLIATGASPALP
    PLPGLAETPFLTSTSALDLERVPTSLLVLGAGYVALELGQAFQRLGSRVTLVQRRARLLPEIELKLAEQLQQALAAEGIR
    FRLGVLPQRVERVPGGVRLIVQTSDGREEALEAETLLVATGRRPNVDDLDLAAAGVELDARGAPRLDPTLRTTNPRIYAA
    GDVTLGPQFVYVAAAQGRLAARNALLGEQQILRLDAVPAVIFTQPQLASVGLTRADAEARGHRVVTGFAPASVIARERVE
    LQPFGGVFLVADAESGRILGVQALASAAGELIEAATLAVHAGLTLADLREHLAPYLTVGEGLRLAALAVEQDPARLSC
    CA


    >gi|221635892|ref|YP_002523768.1| dihydrolipoyl dehydrogenase [Thermomicrobium roseum DSM 5159]
    MTVEQRQEFDVVFLGGGTGGYVAAIRAAQLGLKVAVVEKDKVGGTCLHRGCIPSKALLKSAELLEQARRAKEFGVIVGEV
    AGDYPTAFRRAQQVVEQLHKGIHFLFRKHGITLIQGVGRLTRNRTVLVNGAEGQPQELRGRAIVIDTGSRPRAIPGIPFD
    GVRVLNSDHTTAQIDWYPKRVIIRGGGATGVEHATVWHAFGAEVTLVGRIVPNEDEEVQQQLVRAFQRKGIRIVPDYRPT
    ADDFDITEGGVRMRVRKSGTQEEVIEADALFVALGREGNIEEIGLEELGVRTRDGFIVTDEYFRTNVEGIYAIGDVLGIQ
    QLAHTAMHQGIIAVEHIAGEKPLPLDYHRVPIVTYCHPEIASLGLTEREAKEQGRAIKVGKFPFRANGKSLIEGETDGFV
    KIIADAETNDILGVHIIGNHATELIAEAALAKLLEATPWEIGLSVHPHPTVSEVIGEAALAVDNLAIHI

    >gi|221635953|ref|YP_002523829.1| peroxiredoxin OsmC (Osmotically-inducible protein C) [Thermomicrobium roseum DSM 5159]
    MPVRTATATWEGTLESGSGTTAAGSGAFSVRFTAGTRFGEEPGTNPEELIGAAYAGCYSMALAAVLGRAGFQPERITTTA
    RVRIQQVDGGFAIDRIELETEGKVPGIDEEQFKEFAEQAKRT
    CPVGRALGGVEEIVVRAQLVQ

    >gi|221636145|ref|YP_002524021.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermomicrobium roseum DSM 5159]
    MHEPTSSEPIAPTDVSSDRRAQRPLWHLLALNIALLAVLVSAVWLALWFLRQSEVPRPAPSAGDFLAAQALTIGTVAPEF
    TLPQLDGGQISLSQFRGRPVLVNFWASW
    CAPCRSEMPALQQVAAQYAGSGLVVIGINQLEDVPTVRGFVREFGLTFPIAL
    DRDGVTSRAWRVYGIPQTYLVGPDGTIRKAWVGPVTEQSVTRALDEMGIRPTPS

    >gi|221636240|ref|YP_002524116.1| metallo-beta-lactamase family protein [Thermomicrobium roseum DSM 5159]
    MFFQQILRTDIGCAAYVVASTDAGLAAVIDPRIDMVDEILDLLQREGLQLRYIIETHNHADHVSGHHQLAAATGATIAVS
    ALAGVTYPHLPLHDGDELELGEVVLRAIHTPGHRPEHIVIAVIDRSRSRDPWLVLTGDTLFVGDIARPDLAIDGQEGAAA
    LFDSLHQRLLQLPPGTLVFPGHVAGSLCGRVNNRMTGTTIGFEARNNPALQILDRQTFIRFMNENLPERPPNLARIVELN
    RAAEPPRMGTATPLTPARVRELIEQGAVVLDVRSPASFAASHIPGAISVALDGGQFQNRVGLVVPPDRSLVLVVEREEDA
    HRAVQMLAVIGYDQVVGYLAGGMAAWERAGFPYRTLPVLTVHDLARWREEDPTLQIVDVREPSEWAEGHIPGARHIPFYR
    LPERWTELDPSRPIALV
    CGAGTRSALAASLLRSRDFPRVYSVEGGMDAWRAAGLPTTRGAVVTA

    >gi|221636241|ref|YP_002524117.1| rhodanese domain protein [Thermomicrobium roseum DSM 5159]
    MLTRLFGPRVPELTPHEAHERLQAGALLIDVREPDEWRAARIPGARLIPLDELPQRVGELDRNREIILVCRSGNRSASAT
    AYLQRAGFTKVRNLAGGLIAWARAGLPVVR