Thermodesulfovibrio yellowstonii DSM 11347 uid59257

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|206890637|ref|YP_002248101.1| thiol-disulfide oxidoreductase ResA [Thermodesulfovibrio yellowstonii DSM 11347]
    MKKNVFLILFILLALIITGSILIKKNSSYTKENAKVGFPAPDFELKDINGKKWKLEDLKGKIVILNFWASWCNDCREEKK
    SIQSYLSKNGTPDDLVFITVLYKDNPLTVTEMVKKEGYTFPVLIDDGVVSTIYGIKGVPETFLIDKKGILRHKILGPVQW
    DNPHIIPHLRQVLM

    >gi|206889785|ref|YP_002248330.1| hypothetical protein THEYE_A0485 [Thermodesulfovibrio yellowstonii DSM 11347]
    MHEIEWTDEKIALIWNYYAKNPSYQGQYFSCHSGRNIIEYVNKHIKLKNIKTFLDFGCGPGYLIEHLLKFLGNRWGGKVH
    GLDFSKESIEKFREKFSRFNNVANAIWVNKLPFPIEDNSIDCVFAVEIIEHLNDLYLSATLNEIYRILRPGGYLIITTPN
    NEDLEANKTICPE
    CGCIFHRWQHVRSWDKVSLNMLLNQHNFTDIKIKEALIYPDSSRKIIKVLKKVIKVLLMERKNINPN
    KIVAIVKK

    >gi|206889314|ref|YP_002248458.1| CoB--CoM heterodisulfide reductase iron-sulfur subunit A 2, putative [Thermodesulfovibrio yellowstonii DSM 11347]
    MQIGAIFCSCAGQITEKIDFEKLQNLIRNKVAWIEKFELACAEKTHQKIINFLSLKKPEGLIILACSPKNKESVFQKLGE
    KAGINPYMINIVNIREQVAWVIKDRDKALKKAFILFSGALERLKKQKPLFEIKIPICNDIMIVGGGIAGIVAANSLSKAG
    KKVYLIEQECSLGGKIVKYEKLFPDLTCGP
    CMIHPMIEEVLNSNIELRLNSKVEELKGFYGAIFAKILSKPMYVNPKKCI
    GCSECEQICPVKAIKVEPMKLPVVARINSEKCLYLQGQDCDLCIKECPVPEAINFDESEKKESLKVGAVLWATGLELMDC
    KVLPEFGYGRFKDVYDSLEFEEILNIEGPTSGEIITSSGEIPEKIAIVHCVGSLDENYYPYCSKICCQYAFKFNRVLRQR
    LPETEIVHFVKEIVLPGKNAYRLYSQALKDPLTKILRYNDLKELKITKEDLLNVYFKNDKISCDIVVLCPAIISDRKIEE
    ISGLFLTGSIKEPLTINETINDAMAQVGNLLCLFKEEKIIKQPFIAKIDYNKCSRCGICIFQCPYKAIEIEMGEVKMMEI
    LCEGCGTCVASCPSNAIGLNGYSDEEILSEIYGILNATKEVDNGSTVA

    >gi|206889945|ref|YP_002248490.1| methylated-DNA--protein-cysteine methyltransferase [Thermodesulfovibrio yellowstonii DSM 11347]
    MTPIGLLGIVFDSFLSVKKIFITDSDKNTTIPEFALNFVKQLNSYFKGELLEFNYPVNIQNISEFDKKVLEVTCEIPYGQ
    TVTYNWLAKKLNTSPIAIGQALKRNPLPIIIP
    CHRVIKSDGTLGGYSLGIEIKKWLIEHERSTLYKFQLMKLHHRML

    >gi|206889925|ref|YP_002248533.1| HesB/YadR/YfhF family protein [Thermodesulfovibrio yellowstonii DSM 11347]
    MFSISEKAAEKAKLILKNEGKEGWGLRIFSAEGYCSPSFGLDIDENPQEGDEVVEKDGLKVYMDKQTFDLLSELELDYYE
    DEEQEGFILKGPMPSCGPGCGGSCGV

    >gi|206890946|ref|YP_002248543.1| hypothetical protein THEYE_A0701 [Thermodesulfovibrio yellowstonii DSM 11347]
    MAMVKKIKVDTKWIENFLIEVKARNHIIYVDQPEDSGGKNKGITPLEHLLAALGSCICSMAVIIAKQKNIELKNFDVSVE
    GEIDYDVLLGKSKQPRPGFYKIVVKVKLDAALTDIEKKEFIKEIQSRCPVADGLMNITPLEVIIE

    >gi|206890851|ref|YP_002248734.1| thiol:disulfide interchange protein, putative [Thermodesulfovibrio yellowstonii DSM 11347]
    MKRTSFLGIFLIISLLSCNLTTNPCTNIKEKELKETLKIDFDSIVEKNEIKGTNLCQIVIQRNGVFNIFYAYPDGKTFIF
    GDIYKNGIFLSKATLERIQEKAFKNFQTEIDKVVVFSYKPEGANKYIYMITDPD
    CPFCEKAKQEVKQWADLKKVEIKVIF
    LPLETLHPHAKDKAIRAVCAGMKYDDYLNSKWVGQLCNDGTKKIQDSIALMKKINVNGTPSFISFNGKRIVGFSPEGLDA
    IIN

    >gi|206889805|ref|YP_002248777.1| redox-active disulfide protein 2 [Thermodesulfovibrio yellowstonii DSM 11347]
    MDIKILGPGCANCYKVEETVKKVVSQLGIQAEISHIKDMKEIFKYTQVTPGILINGKLKHSGFPLPSEDKIRNILIEELS
    SK

    >gi|206890250|ref|YP_002248835.1| dihydrolipoamide dehydrogenase [Thermodesulfovibrio yellowstonii DSM 11347]
    MKAVVIGGGPAGYVAALSLKRLGAEVLLIEREELGGTCLNKGCIPTKTIIHSLGLLEKIKNQKIINEINYPNISVDLQTL
    MQKKDNVVDTQKKGLLMLLKHSGVKIIKSEAELINPQTVFLKETSEKIQADRIIIATGSKPAKLPMLSFDGKKILSSDDL
    WNLKKIPESITIIGAGAIGCEFAWIFHLLGSKVTLIELMPKILPMEEEDISKEVEKLFKKRKIQFYTGVRIQDLKIFDNS
    VQITLSNEKILTSEIVLVSVGRAFNTDCIKTSEIKLGNKKEIIVNERMQTNIENIFAAGDVIGNWLLAHVAYKEGEIAAK
    NAMGDNKKMDYTVIPSTIFTVTEVASVGLKEADAIQKGFNVKKGIFPFRAIGKAHVVGEIEGFIKVIADKDSDIIVGAHV
    VGADASELIHELAMAVKFKIKINDLKELIHSHPTLSECIGEAIKDISGEAIHKIK

    >gi|206890842|ref|YP_002248847.1| OsmC/Ohr family protein [Thermodesulfovibrio yellowstonii DSM 11347]
    MLKAKVKWTGGLQFVGQSGTGHAIVMDGSPDYGGENSGMRPMELLLVGLGGCSGMDIASILAKKKQDVRGIEINVNGKQP
    DEYPKRFTEIEIEFIVKGKNLSEEAVKRAIQLSMEKYCSVKATLEHSAKIIHSYKIVEVD

    >gi|206889349|ref|YP_002248881.1| probable peroxiredoxin 2 [Thermodesulfovibrio yellowstonii DSM 11347]
    METKMPLLGEKVDDRKIKTTHGIINFPSDYKGKWVILFSHPADFTPVCTTEFVAFQKRIDEFKSLNCELIGLSIDQVFSH
    IKWVEWIKEKLGVEITFPIISDDMGEIAKSFGMISPAKGTNTIRAVFVIDPNGILRVILYYPQEIGRNIDEIVRTVKALQ
    ISDANKVAIPAGWPNNELIGDKVIVPPASDVKTAQERPKQFECFDWWFCYKKL

    >gi|206889387|ref|YP_002248886.1| hypothetical protein THEYE_A1059 [Thermodesulfovibrio yellowstonii DSM 11347]
    MTFSSNLSFAENKKSVILYFFWGEGCPYCAKEKIFLTTLKKKYPRLEIKDYEVIHNQAPRELLMTMSRSYGISPTGVPVT
    FIGDKSFVGFNEEIASKIELILKSCLKKTCEDPLFYKKY

    >gi|206890745|ref|YP_002248966.1| sulfur transferase, putative [Thermodesulfovibrio yellowstonii DSM 11347]
    MKRFIVKIFILLSISFMGFNFSQASEQFDINDSIINDKFEVPQISTNEMKKALKNGALIIDNRPYFEWAVSHIPSAVTVS
    PKPGISKALYTSDKEEIKKLANNDKSKLIILYCDGIY
    CGKTKRVSKELVQEGFKNVYRYQLGIPVWRALGNLTQCEIEGI
    RYIYEKDGTAYFIDSRKEEEFKFKALKNSKNIPFDKVIEGKDVGEIFKAKEDGRLPVEDRNARIVVFGKDLKQTLKVAEG
    LTKEAFHNVCYYTGNLEDILKIEGNKN

    >gi|206890603|ref|YP_002248990.1| putative sulfur transferase, selenocysteine-containing protein [Thermodesulfovibrio yellowstonii DSM 11347]
    MSKKGRTLILTCLIFALCLAFLASQGISQQKPIIAKGCSLPGCHTAKQGELWGNLKTVSGKAAMIQIDTGALWTVKFDEN
    TKLKNWNQPLNKLPKEKEIAITYVEKNGEFYATLINVKPPVAVDPSKVIKVNEMKKIYDAKSALIIDCRPAGRYNEGHIP
    GAINIWFAEFDKHIDKLPKDKNSSIVYY
    CQGPTCALTPSSARRAEALGYTNVKQFVDGLPEWKKQGYPVASTVKYLQELI
    SKDIPHVLVDVRPREQAEKEHIKGAINISLAELDKAKKLFPKQKNAPIIIY
    CTQDKLSLKAFDIIRKWGYVNTSYLEGGI
    EAWKKAGGEVLSGQLKKEIVYIPKPKHGTIGIEEFKKIIGKIPANVIILDVRDPEETQMGIIKGAKNIPVNELKDRLNEL
    PKDKEIVVH
    CATGMRAEMAYNILKEAGYNVKFLDATIQIKKGGKYKITEN

    >gi|206890828|ref|YP_002248991.1| hypothetical protein THEYE_A1168 [Thermodesulfovibrio yellowstonii DSM 11347]
    MKRWSKILIVISLVLMLSNFTFAATPLSDERVKEAKQCGIQEVDVNSAKELIKKGAVILDVREYTEYVAGHIPGAIWAPR
    GLLDFQAYDWLPDKEKTYLVY
    CKTGGRGAVSSCDLKKLGYKNVYNLKGGFNAWSNSGEPVEKGEPQGMGKGIKK

    >gi|206889731|ref|YP_002248992.1| hypothetical protein THEYE_A1169 [Thermodesulfovibrio yellowstonii DSM 11347]
    MKVLLATLVTVLLFTLSAFAYDVEMAKKFDVMFSQMTPEVLAMRPCQITTKDILEMIKKKEDFVILDIRTPAEQKLIAPV
    WKDSLLIPMHELFKPENLAKLPKNKKIAVL
    CHTGDRAAAATIALRAVGFSNAFQFKGGIAEFAKEVGRLATEYVKE

    >gi|206890896|ref|YP_002249116.1| disulfide bond formation protein D, selenocysteine-containing [Thermodesulfovibrio yellowstonii DSM 11347]
    MKKFRIFVMLFFIFYFYSFAIAADQRYNLSIENSPVIGNKDAPVTIIEFIDYQCPHCVEVGPTIDRLVKELEGKVKLVIK
    FFPYRYRDYSRIAAEAAVEAWKQGKFTEMHDLLIKNSPRLDRESLINYAKKLNMDVEKFIKAIDNQEGASIIDKDLKLAK
    ELDLYVTPAFYINGIKVLGVRDSEYFKEIIFRELKNVKKK

    >gi|206890760|ref|YP_002249173.1| CoB--CoM heterodisulfide reductase iron-sulfur subunit A, selenocysteine-containing [Thermodesulfovibrio yellowstonii DSM 11347]
    MAKVGVYLCHCGENIKGAIDIEALKKYVETLPDVALVRNYVFMCSDPGQDLIKQDIKSGAVDRVVVAACTPRTHGPIFKK
    AVEDAGLNGYLLEMANIRDQDSWPHWHNKEGALEKAKRLIRSAVAKVRLNEPLEDRYGDMEKSVLVIGGGIAGMFAALDL
    ANMGLKVYLVERQPSIGGNMSKIDKTFPTMDCSA
    CILTPKTGEVAQHPNIELITYAEVDDVKGYVGNFDIRIKKKAKYID
    WDKCIGCGVCTEICPSRVPNEYNMGLNQRRAAYIEYPQAVPKKAVIDEPNCLYFKSMKKTGKPACEICKKGIPPKGIQGC
    PADAIKFDDKDEYINLKVGAVIIATGFKPMSKVHFKEYSPHCPDVITSMEFERILSATGPTGGELKRPSDGTKPKTIAMI
    SCVGSRDERYHRYCSKVCCMYMLKHARILKEKYPDIKLYLFFIDVRTAGKDFEEFYVYTRELGAKIIRGGRVSAVDVKPN
    GKLRVRGFDVDLCSPVEVDADLVVLATAIEPPDGVDELGRMFSATCGREGFLREVHTKLYPVETSARGVFIAGCVQGPKD
    IPESIAQSRAAAAATAALIIPGKIKFEAIVSEVDRDKCSSCGVCVPLCPYSAIRIEEYKGKEKAYIEPALCAGCGVCASA
    CPSRAIKFNGFTTEQIMAQIDALTEA

    >gi|206889697|ref|YP_002249215.1| hypothetical protein THEYE_A1415 [Thermodesulfovibrio yellowstonii DSM 11347]
    MKEMKIFIEGMSCAHCIKRVSHALEEAGVTEADVKIGEANIIFDETKTNLDKIAKALEEAGYKLKN

    >gi|206889599|ref|YP_002249304.1| hypothetical protein THEYE_A1507 [Thermodesulfovibrio yellowstonii DSM 11347]
    MEGFKNFLATRGGIIFVGLVIGVLAPVLQNLGNPPNMGICVACMERDIAGSLGLHRAAVVQYMRPEILGFVLGAFLSALA
    FKEYRPRGGSAPFIRFILGVFAMIGALVFLGCPWRTLLRLAGGDGNAIFGLLGLIFGIWVGTRFLKAGYSLGRTQTAPSK
    AAGLAFPLLMLGFLILLFIDPQPEGEGRGMLLFYSLKGPGAQHAPLFISLVVGLLIGVLAQRSRFCTMGAFRDLLLFKQG
    HLFSGVAAFFIAALITNLILGQFHPGFEKQPIAHTMQLWNFLGMTLAGLAFTLAGG
    CPGRQLFMSGEGDADAAVFASGMI
    VGAGIAHNFGLASSPAGIGPNGAVATIIGLIVCVIIGLTMRRR

    >gi|206890701|ref|YP_002249403.1| geranylgeranyl hydrogenase, putative [Thermodesulfovibrio yellowstonii DSM 11347]
    MQCEVLVVGGGPAGSTAARLLAEKGIETVLIEKDLTFNKPCGGGIPSAGLKEFNILNKLQNQIPFNIVTKVKIFPPFSEP
    IEVSLQGGEILIFNRQSFDSFMRKLAEKSGVKIIEAELINIENSKLTVRKKTGEVLEIYSKYIIAADGVNSRVCSIKGWS
    KPEYYWTVSLHVLENFIDTKDTCEFWFGNSHASFFYSWVFPGVDYFSVGTGAEDIKKLKTLIDNFVEKRFAGKLNINSFK
    LRAYKIPKWGRRSFFKENVIFCGDTLGTVMPISFEGIYYSMKSAQFASEAIVQKDLNLYKKLWDENFLKQFSIMKKFQDY
    MFGNDERIDNWLNIHRNPAIQELAMALWLRKEHGSKLIPLYLKAFGSLISRIATFKIK

    >gi|206890165|ref|YP_002249523.1| hypothetical protein THEYE_A1732 [Thermodesulfovibrio yellowstonii DSM 11347]
    MKIGILISNNDAETLWNAFRFGILCLNMDYENEVTIFLNSKATAYEDADSEKFNIKELVKSFALGGGKIIGCQKSMGMRG
    LEGNEICQKGGQKDLYELMVKSDKFICF

    >gi|206890893|ref|YP_002249538.1| glucose inhibited division protein A [Thermodesulfovibrio yellowstonii DSM 11347]
    MSEFYDVIIIGGGPAGLTAGIYASRANLKTLILDKSKTAGALAYASLIENYPGMEKPLTGKELLERIRAQALSFGTEYRE
    EQVVGVDLVSETKEVITMSDSYRGKTVIIATGSMGRKPTIKGEGELLGRGVSY
    CAVCDAPFFRGKTVAVIGDSEEAAKEA
    VYLTEFVELCYIVTSSSKLKVEESHPVFSNSKIRILTGYTVKEIIGTDFVTGLRINKDEGEETLEVSGVFVFIQGSQPVT
    DFLSESLKVDERGFIMVDNFMQTSLPGVFAAGDVTSPYFRQVVIACAQGAVAALSAEKYIRGRSRIKADWHG

    >gi|206890399|ref|YP_002249622.1| CoB--CoM heterodisulfide reductase iron-sulfur subunit A 2 [Thermodesulfovibrio yellowstonii DSM 11347]
    MSAETNRILVIGGGFSGLTAGIEAAETGAEVIIVEKNPYLGGRVAQLNKYFPKICPPLCGLEINFRRIKVNPSVTFYTMA
    EVESISGNPGDYTVKIKLNPRYVNENCTACNACAEVCPVEKDSDFNFGLNKTKAIYLPFEQSFPLRYVVDRTACPKDCPA
    PCVEACKYNAIDLNMQPETIEVKVDSIVVATGWKPYDATKIDNLNFGKVKNVITNMMLERLASKNGPTGGQILRPSDGKP
    VEKIAFVQCAGSRDENHLPFCSYICCLASLKHTLYIKEQNPDAEVNIFYIDIRTPGRYEKFFNQVKEQSGVNLIKGKVAA
    VEQDKDSDDVIVTAEDMLNGEKIRKKVDMVVLATGMQPEGIEIKVPGLKYAIDGFVVDAEGIYSAGCAKAPMDVAGCGKD
    ATSAALKAIQTGVRR

    >gi|206889315|ref|YP_002249670.1| glutaredoxin [Thermodesulfovibrio yellowstonii DSM 11347]
    MLKRVRLYSLSTCPVCKKVKEFLKNNSIETEIIEVDTLDSGEQWLAMKELKKINPDETFPTLVVETAVVGLNEEELKKIL
    EVKD

    >gi|206889759|ref|YP_002249715.1| cytochrome c biogenesis protein, putative [Thermodesulfovibrio yellowstonii DSM 11347]
    MGQSALKKGDFAPNFSLTAWNGENIEVYQLKGNGILIEFLSTKCFACDYVIPDINKLYGKFKKENIQIIGILFNDEIKEP
    QKLFEFAKNRGIQYPLFLCDVKIKKLYNIYGFPNFFILNREKKIVQIYRGITEDTFGLLSKDLEILLRRQ

    >gi|206889683|ref|YP_002249716.1| thioredoxin [Thermodesulfovibrio yellowstonii DSM 11347]
    MAEGIVELTSSKWETEVLNSKGVIMVDFWAPWCGPCRIIAPTIEELAKEYEGKIKVGKLNTDENPEIATRYGIMGIPTIM
    FFKDGQRVDQIVGVVPKSILKSKLDSLLSS

    >gi|206890935|ref|YP_002249767.1| copper-translocating P-type ATPase [Thermodesulfovibrio yellowstonii DSM 11347]
    MTKIVEIPIKGMTCAACAQAVQRALNRLEEVISAEVNLLTEKAKIEVTDKVDIHRLISIVRATGYDIGKTNLYLQISELA
    PDSARPIEEKIAQLEGVVEVKIDIVNKNIVLSYIPTIIDEDKILSAIKTLGIKAKKYADTISAFEEKKKEFKKLKKDLII
    SFIFTLPVFLGSMFHIPFLHEGIIQLVLTTPVQFITGWRFHRLAFLALKHGTANMNSLVSLGTNAAYFYSVAMLILGHGG
    FHLYFETSAVIITLILFGRTLEEKAKAKTSEAIQRLIQLQPKRAVVIRDGKEQEINIDEVLPEDIVLIRQSEKIPVDGII
    VEGEATVDESMITGEPIPVDKSAGEKVIGGTILLSGVIKVEAKAVGKNALLNQIIKLIQEAQTGKPPVQRLADKISAIFV
    PTVLAVAVLTFALWMFLQGEVSQALSNSIAVLIIACPCALGLATPTAIMVATGRSAKEGILIRNVEKLEEVGKIEILFSD
    KTGTLTQGKPEVKDVQYLDVDKSEILSLCATAEKYSEHPLAKAIIRHCMREGINPDEPESFEVVAGGGVLAKVFDAKGDK
    REVLIGSSKLMQKKNINLPELSYSESTTTVYAAIDGNIKAIFFIADPIREESVETIKELQKMGIEVAIITGDNELTAKAV
    AEKLEIKIYFAGVLPNEKAKIVRKFRVVERKNVAMIGDGINDAPALAEANIGIAMGSGTDIAIHTADVTLMKGGLKGVPV
    LIRLSKLTLRTIKENLFWAFIYNVIGIPVAAGVLYIFGGPLLNPMLASLAMSLSSVSVVSNSLRLKKRKI