Thermocrinis albus DSM 14484 uid46231

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|289547976|ref|YP_003472964.1| heavy metal translocating P-type ATPase [Thermocrinis albus DSM 14484]
    MMRIITQIERLNSHACAFILEPMRLSLKVSGMTCVNCARAIELNLRRLHGVKDVKVSFELGRVWVEIEEELISPQDVVAV
    IESLGYRVEDSLTGRDFSAVVLALCYILSVPIVFLMFLHQPWSLYLQALLAGVVQLVGGWSFYRSAYLSARAGVGNMDLL
    VAVGSTTAYLYSLLSLVGFLKAHPMFETSALLITFVRTGKWVEDRFKKRATRKLRDLFGFQTVKVRVLGPKGEEEKSPSE
    VFKGDRVILRKGDLIPVDGHLQEGTVWLDQSLITGESEPVKMEAGALLLSGSLVVDGYGVMKVEKTFSGSYVSFLIKLVE
    KALSEKPNIQRISDKIAHYFVQGVLILALLVFAFWMWRTHDLERSLTYALAVVVVSCPCAFGIAVPLAIVVGLSRAYSRG
    ILIKEPSIFEREVDVVFLDKTGTVTEGKPKVVKVRVRDEEALRVAHALSSLSNHPYSKAIREYTANLGISADPPSHCKEV
    VGVGILCDEYALKGKENGWVAIYRGEEVLAEFYVEDTLREDAPQAVDQLKRMGLKVVMLTGDREERAKSISDALGIEEWY
    ASVKPEDKMQVLEEYQKRGYRVCMVGDGINDAPALAKADMSVAMGSGTEVAKLVGDVVLLGGIGGLVELFRIKKTVSRRI
    KQNLFWAFSYNVLLIPVAAGGLASFGISLKPEWAGLLMVLSSVAVVINSVRP

    >gi|289547977|ref|YP_003472965.1| hypothetical protein Thal_0203 [Thermocrinis albus DSM 14484]
    MVRFVFFLFLIASFVQGEDIEKEFLKEQIKSVPLNKAVIVGKGKERVLVFMNPDCPHCRKEWQELKGCLHKLRLYVFLVP
    FPRFPESYQKSAYVVCSKNHLRALDEVLSGKWDQRPLPVKSCPLLKEHERIAKEMGVSAVPYNILLRDYTVVSGYSPDLR
    KKLSCDR

    >gi|289548043|ref|YP_003473031.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermocrinis albus DSM 14484]
    MAKLKEGDRAPDFCLKGLDERGEEKEICLGDLLKRGPLVLYFYPKDDTPGCTQEACDFRDNLERLVSKGYQVVGVSPDSL
    ESHRKFRQKYNLNFPLLSDPENKVSSMYGAYGKKKMYGKEVEGIIRSTFVIDTGGVIKKAYYNVKAKGHVEKLLSEI

    >gi|289548110|ref|YP_003473098.1| iron-sulfur cluster assembly accessory protein [Thermocrinis albus DSM 14484]
    MQKVSFNFYATEKAVQEVLRIAQENGITEPILRIRVVPGGCSGFQYAMGFDDTVEEGDHVFEFGGLKIAIDQFSMPYVNN
    AELDYVVDFMGGGFTIRNPNVTGSCGCGNSFSCG

    >gi|289548147|ref|YP_003473135.1| Heavy metal transport/detoxification protein [Thermocrinis albus DSM 14484]
    MREIRLKVEGMTCQHCVQRVRTALLQVEGVSWVDVNLEEGTVTVKVEDNVPLESLREAIESYNYRVAGEV

    >gi|289548169|ref|YP_003473157.1| Redoxin domain protein [Thermocrinis albus DSM 14484]
    MRRELVPIALAAILLGMILFFAFQHEKEDKQGVSVQTGNIQLPDMVFRTLDGREVRLSQYRGKVVLLNFWASWCPPCREE
    MPIFEQVYNRYKDKGFEILAVNMDDSEESMKRFLEKNKLSFTILRPTGDLEKELRLMGLPTSYLIDRNGKVVKMHLGVYR
    DLEKDLISQLHMVR

    >gi|289548179|ref|YP_003473167.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermocrinis albus DSM 14484]
    MIKSYDVIVVGSGPGGFNVSLPLARAGLKVALVEGNLLGGTCLNRGCIPKEGMYRIAREVLSLRRKLGTKVKPDFMKALD
    YVRRRVEKIRENARFLLKREGVEFIEGYAYMVDEQTVKVSRNRYLKGKFLVLACGSLPLEEPSVEDVLTGKLVPKGKVMV
    VGSGASACELAFILSVFGFDTYLKVQDRLLKDYPVEEDIVEKLERELELCGVKITTTEVDADIRIMATGRRPGLHRELFP
    FLQMDEDGYVKVDDTMRTNLPYVYAVGDVTRPMGATHALAKARVACQAILGLETKYEPHRVPTVICSALELAFVGKGTKG
    KKYIKTFNANTKSYVNGWGGVVQLIVDEDGRLSHVTLLGVDVSEVINAVCPFIDNPLWYDRMYSMVFSHPSLCEIFTDFA
    QDVFLPRD

    >gi|289548221|ref|YP_003473209.1| Redoxin domain protein [Thermocrinis albus DSM 14484]
    MAQTVNLKGSPVTLIGSLPNVGDRAPEAIVVTKDLQEKTVGGAKGVVQVIITVPSLDTPVCETETKKFNEMLAGMTGVDV
    TVVSMDLPFAQKRFCESFNIGNVTVASDFRYRDMEKYGVLIGEGALKGILARAVFIVDKEGKVAYVQLVPEITQEPNYDE
    VINKVKELL

    >gi|289548321|ref|YP_003473309.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermocrinis albus DSM 14484]
    MKRLWVLFLLFLWACSPKDSLPPVKVLDLKGRQVNLDSFRGRPVILYVWSRTCAGHATQLSLLHELAQRRKDLTVISYAI
    AMDPAAVSQSYLSLGLKPSFITLVDPEVKISEYYTITFLPSTFFFDERGRLVKIYAGLPYDSFIK

    >gi|289548361|ref|YP_003473349.1| hypothetical protein Thal_0588 [Thermocrinis albus DSM 14484]
    MVWEGILKGVFFILLIVTFLALAFKVYVVWRGKKMVGERVKELEEGIVYFFSERCGACKRMEKEIEELEKNWKVVRVDVF
    SPEGHERAKALGVMATPTTLLVKRGRIIKVLVGVQKAEKIKDMMKTNNC

    >gi|289548373|ref|YP_003473361.1| Rhodanese domain protein [Thermocrinis albus DSM 14484]
    MFQVPEVTPEEAKRMLEEDPNVVLLDVRTPPEHVQVRIPNSLLIPLDELRYAYANLPKDKKYIVYCRSGERSAFATYFLR
    HMGYEAYNLAGGILVWPYERESGIPS

    >gi|289548374|ref|YP_003473362.1| protein of unknown function DUF255 [Thermocrinis albus DSM 14484]
    MCLSLYFTMANRLIKERSPYLKKSAHQPVDWYPWCEEAFRKAKEEDKPILLSVGAVWCHWCHVMAKECFENPEIAQIINE
    NFVAIKVDRDERPDIDRRYQEVVVSLTGSGGWPLTVFLTPDGKAFFGGTYFPPEDRWGRPGFKSLLLRIAQLWKEDRDRV
    IRSAEHIFELLRNYSSSSHKDNVGEELLNRGIANLLASVDYQYGGIGTAPKFHHARAFELLLYHHFFTGQTLPVEAVEIT
    LDSMARGGIYDHLGGGFFRYSTDDRWIVPHFEKMLSDNAELLLVYSLAFQVTKKDLYRYVVEGILNYYQRFGFDEGGGFY
    ASQDADIGDLDEGGYYTFSLEELRGILTEEELKVTSLYFDIHPKGEMHHDPSKNVLFIAMSEEEVATATGIPLERVRQLL
    ESARRKMLSYRESTRQQPFIDKTIYTNWNGLMLEALSTCYKVFRIPWVLSSAEKTADRLMKEMWKDGQLMHTYGVKGMAE
    DYIFLARGLLSLFEVTQKREYLEASVMLAHEAIKKFWDPQGWGFFDTEEKDEGLLRIRLKTLQDTPTQSVNGAAPYLYLV
    LGSVTPYTEFLEYAEKNLQAFARMVREIPLISPSYLISLYAYLKGIYKVETETFFEDMLSSFRPFKVVLRSPVKGVVVCE
    GSSCRVYEGIPDSLS

    >gi|289548540|ref|YP_003473528.1| Thioredoxin domain protein [Thermocrinis albus DSM 14484]
    MRQIVHLVIYLLLISGVGFPRWWFSKADEGLRQAKEQGKLVVFYFHSQYCVYCRQVEDFVLPDEEVTKKLKNFVVVSLDI
    NSEEGRFWANRLGVFGTPTFVVYDPSKGSRVDLLFGSRPKEDFLRFFNKVCTAYRIKNC

    >gi|289548694|ref|YP_003473682.1| electron transport protein SCO1/SenC [Thermocrinis albus DSM 14484]
    MRSLLAVWIVLALLVSSCKKEHKFYGYLYDKPAYDFELTSQDGNRVRLSQFLKDGGVVLLFFGYTHCPDVCPTALSTMAK
    VMKNLSEKEREKVKVLFVSVDPERDTPAVLKNYVPFFYPTFVGLTGTPDEIAKVAKEYNVYYRKVKEETAAGYLVDHTAT
    IYLITPDMKIKLLYTTNRQDPQKIAEDIRYLLSS

    >gi|289548797|ref|YP_003473785.1| selenide, water dikinase [Thermocrinis albus DSM 14484]
    MELLRLVRASGCAAKVGPGDLEALVSDLQIYTDPNTLLGIGDDAGVYRYGDSVLVHTVDIITPVVNDPYLWGAISAANSL
    SDVYAMGCYPLTALAIVGFNSCEMSIDILKEVLKGACKKLEEAGTVLLGGHTLDDREPKFGLAVTGVCPDGTFLTQKGAR
    PKDILFLTKPIGTGIVVKGIKERVLKEEKVSHVIENMLKLNYTASKLAKELGATACTDVTGFGLLGHALNISRKSGVRLT
    IDASSVPVYEVAYYLVQQKVYPKGAVDNYQFVKDQLNAPHLQWWELLLLTDPVTSGGLLFTVPEDRALLVEERARDLGVD
    VWRIGWVEEGSGLRVIKTQTVPSSLIRSLDRM

    >gi|289548840|ref|YP_003473828.1| glutaredoxin-like domain protein [Thermocrinis albus DSM 14484]
    MLLGLDVRTQLREIFSKDLKEPVNIKLFSQAIGCDTCPTAEELLKEVAQLDERIKLDIYSPLVDREISARYGIERVPTIV
    VEGDKDYGIRYIGLPAGLEFSTLVHTILQVSKREPKLSEKTLEFLSEIDVPIEIMVFVTTS
    CGYCPAAAITAVNFAIAND
    NIKAVVVDASENPDLAQLYQVVGVPKIVINRGLVEFVGAQPENAFLGYVMAAYGRLKNGQA

    >gi|289548867|ref|YP_003473855.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermocrinis albus DSM 14484]
    MMQVVIIGGGPAGISASIYAARKKMNFLLVTRDIGGQVMKAGNIENYLGYAMVDGVSLVERMIQQMERLGIQPILDQVVD
    IKKLESGFQVITLSGKTFTTKTVLLCTGSEHRRLNVPGEAEYVGRGVSY
    CYTCDAPFFKDSRVLVVGGGNSGFEAADQLL
    QYASKVYLTEISDSFRADEVLREKVLTNPKVTPLLRHRVLEIRGDTKGVRSVILEDLSSGNVRQLEVEGVFVEIGLEPNT
    ELASRLGVLTNSRGEILVDCNNRTSELGIYAAGDCTNIFAKQIVTAAGDGAKALLSIYHDLTYGVSNWI

    >gi|289548887|ref|YP_003473875.1| UBA/THIF-type NAD/FAD binding protein [Thermocrinis albus DSM 14484]
    MFRLTEEQIKRYARHIILPEVGGKGQEKLLSSKVLVIGAGGLGSPAIFYLAAAGVGTIGIVDFDVVDFSNLQRQILHTTD
    RVGIPKVESAKRTVEALNPDVKVITYNTMINKNNIMEIIKDYDVVLDGTDNFPTRFLINDACYFMGKPLVSAAMLRFEGQ
    ITVFDFRDRENSPCYRCLYPEPPPPGLVPS
    CQEAGILGSIGGIMGCIQATEAIKLLLGIGEPLVGKLLIMDALSMDFRKV
    KLRKDPSCPLCSEKATIKELIEYQQTCDAHF

    >gi|289548961|ref|YP_003473949.1| dihydrolipoamide dehydrogenase [Thermocrinis albus DSM 14484]
    MEFDLVIVGAGSGGYEAGLYAHRRGMKVAFVELSPETVGGNCLNRGCIPSKYMRYGAYMIERFSHMSRYGILPKGFHLSM
    PHLKEGRDNVVRTIRENFKKFAQHLGIPIFYGKGFLKDPNTVVVEGADITLRSRFVLLATGSSTVSVGGMVADGRYIHDT
    DTIWNLEEFPKRVVIVGGGAVGVEFAYIFRMYGADVTLTELKDRLLPMAGIPEESSRFLARKLKKLGIDIKLKTTVNHYE
    KTEEGLKVSFTDGTQLTTDIILLAVGRKPNTEGFKETGIEMDERGFVVVDKHCRTNLPSVYACGDITSPLMLAHKAMYEG
    KVAVSHMLGDEGWEKNDTLMPKIIYSAYEVASVGLTEDEAEDEGYHVRVGVVSFVTNPKAMDDGENEGFVRVVVEERTKR
    ILGCHILGPNAGELLHQVIHAMKAGLGADFMSRSVYSHPSLSEAIGQASMEVHFGPITWTKRS

    >gi|289549096|ref|YP_003474084.1| nitrite and sulphite reductase 4Fe-4S region [Thermocrinis albus DSM 14484]
    MRVAVIGGGIAGSAMVEELLRLDPDTEIHLFCGEGVLPYNRVQLADVLSGKKLFTQLVLHSWQYYEEKGVRLHFQKVDRL
    YPHRRLLITERGDVYSYDRAVIATGSVPLLPPIKKTHLKGVFVLRTIKDVYGMLDMLPLSRRVVVIGGGLLGVESARAIR
    DSGVDVFLIHIMDTLMEQWIDRQCSQLVKNKLERLGIKVLLSKRVEELLGEKRVEGVRFSDGDTLEADMVLLATGIRANT
    DLAVRSGLKVERGILVDDYLETSSQYVYAVGECAQHRGKIYGIVAPILEQVKVCAKNIIYGNVERYEGSPSYTILKVPEI
    RLVSGGRVHEEEGDEVFVYMDNDNYRKVVLREGKLEGFVLLGNFSGLSQLLDVMKKGVNAKHLFPNILLSDILRPSTTED
    LVGKTVCNCNAVSYEDILNAIKLGAKSLEDIQRMTRASTSCGSCIPLVENILQQHVKIQRKVNRVEEYKRERHPFSVNLR
    KRLEEWAEEGDWQKVPEEDREYGLKWYGVFYRKATPGYFMVRIRITNGVLTAQQAKVIAHLAKKFGRNEVDITSRQQIQL
    RWIELRYLPEVLAALETVGLTTLQTGMDNVRNITGDPLSGLHEENVIDTVFITRRMTEIFLGKIQYANLPRKFNVGVLGS
    IRDMINCKFNDLCFYLAKKNGKYGFNVYAGGKMGSGGPNEAWNLDIFVEPYDAIWILKAVIEIYNDLGNREDRSKNRLHF
    LIRELGVEGFRAELEKRMVKKLPAAGEDMVRWCGEREGLIRLRNGLYAVPLIVPAGIFTGDALQRAAWLAQKYGSGELRL
    STYQRLFIVNVPQENLNQLLSDPLLDKYPISTSPFFTGLIACQGSRTCAFGVIENKPDALRLADYLSRKYNTSIPIRMHW
    SGCAKGCGLHGAGDIGFVGTKMKVDGEVKLAVDVFLRGKKIDTVPLDSLEAYVEKLFVDNFLQEVKDEGSGHPACQS

    >gi|289549110|ref|YP_003474098.1| hypothetical protein Thal_1340 [Thermocrinis albus DSM 14484]
    MKVIILMTSGPRTPWRCASPFYIAALMAANEADVEMFFNMDGTRLLKKGVAERLLPAEPNCLSPNGKKLKTVYDFMKDAK
    QAGVRFFS
    CKQAIDSLGYKPEDLIPELDGVVPASEFALRALEADKVLVF

    >gi|289549111|ref|YP_003474099.1| hypothetical protein Thal_1341 [Thermocrinis albus DSM 14484]
    MAAKDKHVILLVSQWCATCPDADALWRKLQAEYGFKYEVLDVAQPEGRMWAKKLVVRAVPSTIIDGKLVFVGVPDEAEAR
    KAIES

    >gi|289549113|ref|YP_003474101.1| CoB--CoM heterodisulfide reductase [Thermocrinis albus DSM 14484]
    MGVIGKRVAYYPGCSLEGAARAYDVSTRIVAKELGLELDYLEDYNCCGAMESKNVTFMGTMLLNARNMVLARRQGHDVIV
    APCNGCSFSLQRAEYFLETDQKVYERVNSLLREAGLDPLDKIPHTYHILEWFYHEAGPEKVREKTRKPLKGLKVANYYGC
    LYTRPHFYARTYAHAGGQEEDARPRKRETADDDEHPYYMNALLEAAGATSVPFEPMHTQCCGGPHSLSDEQVSEKFVMMI
    LQTAKRNGADIIATE
    CPLCHASLEMYRHRLMMKGVPDVDIPAAYFTQLLGLAFGYSANDVKLKDNLSDPIPVLKRLGLV

    >gi|289549119|ref|YP_003474107.1| peroxiredoxins-like protein [Thermocrinis albus DSM 14484]
    MAYEKLLFYILTVPFFERAEPTTGELINPQAGAPFFLATAATTMDYEVEMVITSEAGFLLMRDNAKKVKVRPGVEQTVYD
    FIKMAKEAGVKIYL
    CVPSLDLTDVYKKEDVNPELCDGIIGGAAFLDKLMSGEYAVITL

    >gi|289549126|ref|YP_003474114.1| thioredoxin reductase [Thermocrinis albus DSM 14484]
    MGVSEDILYDCVIVGGGPAGLTAGLYCARAKLNTVLLEKGTLGGQIAITDLVENYPGFPDGISGKELIQRFKSQAERFGL
    QIVRKEVTGLSKNGKEIHLHLRTGEVVRSKAVIVASGASPRRLGVPGEEEFINRGVSY
    CATCDGPLFEGVPIAVVGGGDS
    ACQEGLFLTRFGSVVYLIHRRDQLRAQKHLQEKILSHPKVKFLPNKVVVEIKGSEAVEKIILQDTKTGELSELPVEGVFI
    FIGLEPNTGFLRGVVDLDERGYVITDSKLRTSMEGVFAAGDCRSGSTGQVAVAVGEGCLAALEVEKYLEG

    >gi|289549127|ref|YP_003474115.1| thioredoxin [Thermocrinis albus DSM 14484]
    MAGHVITLTESNWHSEVINSSIPVVVDFWAPWCGPCRIIAPIIEELAAELEGKVKFGKLNTDENPNIAMQYGIRAIPTIM
    LFKNGEVVDTRIGVQPKEALKQMILSHL

    >gi|289549215|ref|YP_003474203.1| thioredoxin reductase [Thermocrinis albus DSM 14484]
    MELTLTFQPQKVYDVIIIGAGPAGSSAAIYTARAGLSTLVLYRAEADGALGVTQQIENYPGIRGPISGYELLKLMREHAK
    AFGAEFVRGKVIATDLLGEIKKVYTIDGREFQGRAVIIASGAMERTNKFKGEEEFLGKGVSY
    CGVCDAAFFKGRPVAVVG
    EDDYALEETEFIARFASKVYLVVPSSRIKAPEEMVEEVKKHPHIEILLHHRVLEIVGSSLVEGLAVQNIDTKEKKLLQVD
    GVFIFLGGNKPSVDFLMNQVEMTDGHCIVVNEEMMTSVPGVFAAGDVLCNNIKQAVIAAADGVKAALAVDKYLNKKAKIT
    AQW

    >gi|289549321|ref|YP_003474309.1| Disulphide bond isomerase, DsbC/G-like protein [Thermocrinis albus DSM 14484]
    MKKAIFLTGLLVLSAGMWACSGSAACPTKDKVKTSVKDLIPGDFTVEEVNPLKDIKGLCEVVVKVGASPIVFYMDQKGEY
    VLAGNLLSLKDKKNLTRERQQEFMKISQDKVKELEKYTDMTFGAKGSGKFIYFFTDPD
    CPFCKRSEPIVEEWAKKNNVEV
    RVILYPLPIHPDAFPKSVSLVCDKKTWEDYKRGYMGSQCEEGKKKVQSNLELGQKLGINGTPTFIGMNGKVQSGLPTEDD
    LNKLIN