Thermobispora bispora DSM 43833 uid48999

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296268011|ref|YP_003650643.1| heavy metal translocating P-type ATPase [Thermobispora bispora DSM 43833]
    MASLTHRDPRATGATVELSITGMTCASCANRIERKLNKLDGVIATVNYATEKATVTIPEGFDPELLVAEVEKAGYGARLS
    SAERPSDEDADGLAALRARLITSVVLAVPVIAMAMVPALQFPYWQWVSLALTLPVVLYGGWPFHKAALANLRHRATTMDT
    LISIGTIAALGWSLWALFFGTAGEPGMTHGFEFTVSRDGGTGDIYLEVAAGVTAFVLAGRYFELRSRRRTGAALRALLDL
    GAKDVAVLRNGREVRLPVAHLKVGDRFVVRPGEKIATDGVVEEGASAVDVSMLTGESVPVEVRPGDPVTGATVNTSGRLV
    VRATRVGADTQLAQMAKLVEEAQSRKAEVQRLADRISGVFVPIVIVLALGTLGFWLATGAGATAAFTAAVAVLIIACPCA
    LGLATPTALLVGTGRGAQLGILIRGPEVLESTRRIDTIVLDKTGTVTEGRMRLTGLTTAEGTTEEEALRLAGALEHASEH
    PIAQAIARAAAERLGELPTPEAFSNVEGLGVHGVVDGRAVTVGRAAFLTERGHHLPGGLAEALRAAEAAGRTAVLAGWDG
    EVRAVFTVADTVKPTSAEAVARLRELGLTPVLLTGDGEAVAKAVAAEIGVDEVIAEVLPADKVDVIKRLQAEGRTVAMVG
    DGVNDAPALAQADLGLAMGSGTDVAIEAADLILVRGDLRAAADAIRLSRRTLRTIKGNLFWAFAYNVAALPLAAAGMLNP
    MIAGAAMAFSSFFVVSNSLRLRRFR

    >gi|296268038|ref|YP_003650670.1| methylated-DNA/protein-cysteinemethyltransferase [Thermobispora bispora DSM 43833]
    MSSGDLEALLRVTAPGYKGEPAPDIALGTTDGPVGRLVLAVTARGVVACSYEDEDTVYARIHKSLGGSIGSDPRRIDPVR
    RELDAYFEGRLRAFSTPADLQLAAPFVRTVLQMMLSVPYGTTTTYRDIAARIGRPQAVRAVSSALSANPVCLFVP
    CHRAV
    ESAESLGGYAGGAEAKGYLLRLEGALA

    >gi|296268040|ref|YP_003650672.1| rhodanese domain-containing protein [Thermobispora bispora DSM 43833]
    MTVHEVDASEVPENAFLLDVRELDEWRAGHAPQAVHIPMGDLRSRIGEVPDAQPIYVICRAGGRSAQAAAWLNHIGKQAI
    NVGGGMQSWAAAGRPMVSETGMPPYVA

    >gi|296268261|ref|YP_003650893.1| Redoxin domain-containing protein [Thermobispora bispora DSM 43833]
    MSVKRLTAIVALAAAALAGCAGSEAAQPGIGETRFVPGDGRVQVFDPGERPKAPQISGRTLDGETVTLTPGTVYVLNFWA
    SW
    CAPCRAEAPVLKDVAAITKSKGVRFIGVNFKDQEASAKAYDRAVEPGYPSIFDNEGKLLLAFQGTVPPAAIPSTLIID
    AQGRIAARALGAVKYQDLLDAVTKVSDE

    >gi|296268290|ref|YP_003650922.1| peptide methionine sulfoxide reductase [Thermobispora bispora DSM 43833]
    MHWLLGKHKTTMVAPAEALPGRAEPMPVADRHAVLGTPLAPPYPEGTEIAEFALGCFWGAERRFWQTPGVVTTAVGYAGG
    YTPNPTYEEVCTGLTGHAETVRVVFDPKVISYERLLKVFWESHDPTQGMRQGNDVGTQYRSVIFTHGPEQERLAVASRDA
    YQKVLTEHGYGRITTEIVPAGEFYFAEDYHQQYLHKVPDGYCGFGGTGVGCPVGLTSGEA

    >gi|296268447|ref|YP_003651079.1| hypothetical protein Tbis_0458 [Thermobispora bispora DSM 43833]
    MVGVIVLAVTLAVGVVIGLFLRHRDGRMRTVSAPASDQAPQERSPGEPSAGATVLTSEDIGAELGERATLVQFSTAFCQP
    CRATRVVLGEVARIVPGVRHVEIDAESRLDLVRRLGIMRTPTVLVLDRSGNVVKRASGRPRKVDVIAALGAVVDDDAPRP
    AAETSHEPSQHSDKV

    >gi|296268449|ref|YP_003651081.1| thiosulfate sulfurtransferase [Thermobispora bispora DSM 43833]
    MSRSAVLVDADWVEANLDTPGVVIVEVDEDTTAYDKGHIRGAIKLDWKKDLQDPVRRDFIDKAGFEALLSERGIANDDTV
    VLYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELESRELVTEVPQRPRTNYKAKDQDLSIRAFRDDVINAIGKLNL
    VDVRSPDEFVGKLLAPAHLPQEQAQRPGHVPTARNIPWSKAVNDDGTFKSDEELRKIYSDAGVDFSKDTIAY
    CRIGERSA
    HTWFVLHELLDLPNVKNYDGSWTEYGSLVGVPIELGEAR

    >gi|296268459|ref|YP_003651091.1| hypothetical protein Tbis_0470 [Thermobispora bispora DSM 43833]
    MARSLVIKVTAGMDAPERCNQAFTVAAAAVASGVPVSLWLTGESAWFALPGRAKEFRLPEATPLEDLLDAVLTGGKVTLC
    TQCAARRGITVDDVIEGIRIAGAPTFVEEVLAEGAQALVY

    >gi|296268675|ref|YP_003651307.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Thermobispora bispora DSM 43833]
    MTRIAIIGGGPGGYEAALVAAQLGAKVTVIEQDGPGGACVLSDCVPSKTLIATSVRKQALLDAASLGVRFSGGPDGDAGH
    VLADMPLVNRRVKELARAQSEDIAKRLAAEGVDVIEGRGRLVDPQRIRVGDQTIRADVVIVATGAHPRVLPGAEPDGERI
    LTWRQLYDLDELPEHLIVVGSGVTGAEFAGAYRSLGSEVTLISSRDRMMPNEDADAAEVLEAVYRRRGMNVLGRSRAASV
    RRTADGVVVTLEDGRVAEGTHCLMTVGMVPNTAGLGLEDNGIRLDRNGFIEVDKVSRTSAPGVYAAGDCTGVMMLASVAA
    MQGRIAVWHALGEAVEPIRLATVASNIFTDPEIASVGVTQRQVDSGQVDAKVVKLPLATNARAKMQGFLDGFVKLFCRPN
    TGIVLGGVVVAPRASELILAVSTAVRNRLTVDQLAHTFAVYPSLSGSITEAARRLMSREAAFL

    >gi|296268682|ref|YP_003651314.1| methylated-DNA/protein-cysteinemethyltransferase [Thermobispora bispora DSM 43833]
    MITYQVVPTPVGPLAMLAHDGPLVAAGFTADPRELFVRLPQRLQELPLVAGDLAEAAEAVRAYVDGELDALDRVPVAEQA
    GTPTRRRLYAALRAVPAGATVTYGQLAEKAGLPRTAARAAGTACAQNLIAPFVP
    CHRVLPATGGYGGYYYGSHIKQWLLT
    HERR

    >gi|296268938|ref|YP_003651570.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermobispora bispora DSM 43833]
    MSRLQPGDPAPDFTLPDADGEEVSLAAFRGKRVILYFYPAAMTPGCTKQACDFRDNLGVFTEKGYAVLGISKDTPERLRR
    FRERDGLTFPLLSDPDLVVHKAYGAYGEKQNYGRTVQGVIRSTFVIDGDGRVERALYNVKATGHVARLMKELGLA

    >gi|296269194|ref|YP_003651826.1| rhodanese domain-containing protein [Thermobispora bispora DSM 43833]
    MTEDRPPSTIDAVTARSLIASNPDVLVVDVRTPREFETAHIEGAINLPLDQVDAHLQRIVKDAGGTLLLVCQSGGRAGKA
    REKLCGAGLPGAVVLEGGMNAWIAAGGPVIRGKPRWSLERQVRLVAGGIVLVSIVADLWLPGARVVAALIGAGLTVAALT
    DTCLLGMLLAKLPYNRGPAVDPERALAAMRRPARAKG

    >gi|296269196|ref|YP_003651828.1| thioredoxin [Thermobispora bispora DSM 43833]
    MLVDLTKDNWSTTVQSDGIVLVDFWAPWCGPCRLFGPIFEAAAGRHPDIVFGKVNTEEQPQLAAAYGISAIPTLMAIRDG
    IVVFAQAGALPEAALEQLIAQVRALDMDEVRRRMAAQPAQG

    >gi|296269197|ref|YP_003651829.1| beta-lactamase domain-containing protein [Thermobispora bispora DSM 43833]
    MKFIQYYLECLSHASYLIGDETTGRAVIVDPRRDISEYVADAEAHGLRIEGVINTHFHADFIAGHLEMAARTGAWIGYGS
    KAEAEYPIRRLADGERIELGDVVLEIMETPGHTPESISILVYEHADDAVPYGVLTGDTLFIGDVGRPDLLASLGKTADEL
    GRMLYRSVRRLMELPDEVRVFPAHGAGSACGKNLSAELQSTIGKQRRTNYACAPMSEDEFVALVTEGQPSAPGYFVYDAV
    LNRKNHDLLDVDAHARPLGIEEFLARRDAGAVIVDARSEEDFARGHLRGSLNVPVDGRFAERAGMVVEPGSEIIVVAPQN
    RELEVITRLGRIGFDTVTGYLRRPEAALRAVPGEVAQAERVTVEELRQALADAEPPVLLDVRNVGEVALGAIEGALTIPL
    AELPRRLDEVPADRPVVVY
    CASGSRSSTAASLLRRAGRERVSDLIGGYQAWQDAHAPTAA

    >gi|296269250|ref|YP_003651882.1| dihydrolipoamide dehydrogenase [Thermobispora bispora DSM 43833]
    MADGSGPFDIVVLGGGSGGYACALRAAELGMNVALIEKDKVGGTCLHRGCIPTKALLHAAEIADQARESASFGVRATFEG
    IDVPAVQAYKDKVITGLWKGLSGLIKAKKITFVEGEGRLAGPGRVVVGDRVYEGRYVVLATGSAPKSLPGLEIDGEKIIT
    SDHALVLDRVPSSVVILGGGVIGVEFASIWRSFGAEVTIVEALPHLLPLEDASSSALLERAFRRRGIKYELGTRFESVKT
    TDTGVVVTLENGRTLDAELLLVAVGRGPVSAGLGYEEAGIAMDRGYVLVNEYCQTNVPGIYAVGDLIPTLQLAHVGFAEG
    ILVAEHIAGLNPVPIDYDGVPRITYSDPEVASVGLTSAAARERGYDVVELSYNLAGNGRSKILQTQGEVKVVAERDGRVL
    GIHMVGSRVGELIAEAQLIYNWEATPGDVAQLIHPHPTQSEALGEAMLALAGKPLHVHN

    >gi|296269265|ref|YP_003651897.1| iron-sulfur cluster assembly accessory protein [Thermobispora bispora DSM 43833]
    MAVESSETTQQGVILTDAAAAKVKSLLEQQGEEGLSLRVAVQPGGCSGLRYQLYFDDRSLDGDIVSTFNGVNVVVDRMSA
    PYLAGATIDFVDTIEKQGFTIDNPNATSSCACGDSFN

    >gi|296269553|ref|YP_003652185.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Thermobispora bispora DSM 43833]
    MADAGDVFDVIVIGAGPAGETVAARVVRGGLTAAVVEERLAGGECSYYACIPSKALLRPVGLAAEVRRMPGLELRGAIDT
    AAVLARRDEAVSHLDDGGQVSWIESVPAVFVRGRGRLAGPLRVDVTRPEGGVRALRARHAVVIATGGDPLIPAIPGLREA
    RPWTNREATSVRRVPKRLIVIGGGPVACEMAQALHALGAEETTMLVRGDCLLGRVEPFAGELLADSLRRSGIDLRFGCTP
    VRAERPVPGGPVTVHAGDGSVVEADEILVATGRVPAVAGIGLETVGLEGRGPITVDASMRAIGVPGGWLYAVGDVNGRNR
    LTHMGKYQARVCGDVIVARATGTPDDLPGLRDIADDLGAPQVIFTDPEICAVGRTESQARADGFRVRAVEYDMGAVAGAY
    LQADGYTGRAKAVVDEDRRVLLGVTFAGPGVADLLHAATIAVTAEIPLDRLWHAVPAFPTVSEIWLRLLEEYGL

    >gi|296269711|ref|YP_003652343.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Thermobispora bispora DSM 43833]
    MTAHIAVVGASLAGLRTAEQLRAAGHTGPITIIGDERYAPYNRPPLSKELLSEPGDLGPQELHAKVAFRRRASLADADFR
    LGLPVVEADLDRGRLTLEDGSAISFDGLVAATGLRPRRLAVPGPVAGRHVLRTLDD
    CVGLRGELREGAKVVVVGAGFIGC
    EAAATALRLGCRVTVVEPTGAPMNRVLGTELAEAVQRYHEAAGIEFVTRRGVTGFTGGDRVTGVELDDGGVLEADVVIEA
    IGSLPNVEWLAGNGALDLRDGILCDNRLSAAERVVAVGDVARFPNPLFDEVPRRVEHWSIAGDTAKRAAATLVAELGGRE
    PDPTPFTPIPSFWSDQLDLRFQSFGLPALGDEARLEEGDYDKLTDGLLVRYFRRSVHVGTIAINLPPTRYREFREAFTTP
    A

    >gi|296269873|ref|YP_003652505.1| thioredoxin domain-containing protein [Thermobispora bispora DSM 43833]
    MATVDVTEQNFNEIAEKGIVLLDFWADWCAPCQAFEPIFAQASERHTDITFGRIDTDAQPVLTAAFQVSAVPTLMAIRDG
    IQVFAQPGALPAPVLEELIERVRALDMDEIRAQLAQQSEAGQQDL

    >gi|296270186|ref|YP_003652818.1| alkylhydroperoxidase-like protein [Thermobispora bispora DSM 43833]
    MSIDNLKDALPAYAKDIKLNLGSLVTTSQLTEQQLWGTLLATAIATKSPKVIAEVSGEAADYLSAEAFTAAKAAASIMAM
    NNVYYRSTHLIGDEAYTTMPAKLRMTVIGNPGVEKVDFELWCLAVSAINGCGA
    CLESHERVVRQAGLSREQVQETLKIAA
    VINAVATTLEAEAVPTGV

    >gi|296270187|ref|YP_003652819.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermobispora bispora DSM 43833]
    MLTIGDRFPEYELTACVSLDPDNAFQTINHKTYEGKWRVVFFWPKDFTFICPTEIAEFGRLNQEFADRDCQVLGCSVDSE
    YVHYAWRKHHPDLRDLPFPMLADTNRELTGALGILNKEGVAERATFIVDPNNEIQFVMVTAGSVGRNVKEVLRVLDALQS
    DELCPCNWNKGEETLDAKKLLAGV

    >gi|296270223|ref|YP_003652855.1| OsmC family protein [Thermobispora bispora DSM 43833]
    MATTRTATTQWKGALLDGSGTVSLTSSGVGTFDVSWPSRAEQPGGKTSPEELIAAAHSSCFSMALAHGLAQAGTPPRSLE
    TTAEVTFQPGEGITGIVLRVRGEVPGISAEEFAQAAEKAKAG
    CPVSKALSGTTITLEAELAG

    >gi|296270230|ref|YP_003652862.1| methionine-R-sulfoxide reductase [Thermobispora bispora DSM 43833]
    MEKIVRSEEEWRALLSPEEYRVLREGGTEPPFSGEYVSTTTPGVYACRACGAELFRSEAKFESHCGWPSFFEPARSDAVT
    LHEDRSFGMNRVEVRCARCGSHLGHVFHGEGYPTPTDDRY
    CINSICLVLRPAE

    >gi|296270323|ref|YP_003652955.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermobispora bispora DSM 43833]
    MAVEVGQVAPDFELKDQHGTPIKLSGLRGKKVVLVFYPLAFTPVCHGELTAIRDGLVGALPDDARVLTVSVDSMFSHRAW
    AEQEGFTFPLLSDFWPHGAVARAYGVFDEGRGVAQRGTFIIDAEGVVRWKVVNPPGEPRDIAAYLKALAEI

    >gi|296270346|ref|YP_003652978.1| rhodanese domain-containing protein [Thermobispora bispora DSM 43833]
    MTPLITPQELAALDDVTILDVRWRLGGPPGIEAYRQAHIPGAVFCDLDADLAGPPGPAGRHPLPEPAAFQAAMRRLGVSG
    SRPVVVYDEADSTAAARAWWTLRYFGHPDVRVLDGGLRAWTDAGLPVTAEERRAEPGDFTAVPGGMPLLDADGAAEIAAR
    GVLLDARAAERYRGEVEPIDPVAGHIPGAVSAPTTENVDATGRFRGPESLRERFAGLGVGEGAEVGVY
    CGSGVTAAHQVL
    ALELAGVRAALYVGSWSNWVADPSRPVAKGPSPRG

    >gi|296270354|ref|YP_003652986.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermobispora bispora DSM 43833]
    MAVNSFMVPLGTQAPDFDLPSIDGGRVKRSDFAGRPLLVIFLSNHCPYVRRIEEGIGRFAADYRDRIAIVGIMSNDVVNY
    PDDDVAHLREQAKRAGFGFPYLVDETQEVARAYRAACTPDFFLFDADHRLVYRGQFDDARPGNDVPVTGASLRAAADAVL
    EGRTLPESEQRPSLGCGIKWKPGNEPS

    >gi|296270698|ref|YP_003653330.1| rhodanese domain-containing protein [Thermobispora bispora DSM 43833]
    MRLWNRLVRGNTPGQRKRVDVFEAHRMQQQEGAVLVDVRDRHEWAAGSAPDSRHIPVDQIVERRSELPLSATVLTICRSG
    ARSARAASLLRASGFAAIDVVGGMLAWQAAGLPVVTADGEPGRVI

    >gi|296270926|ref|YP_003653558.1| glutaredoxin-like protein [Thermobispora bispora DSM 43833]
    MALTVYTTSWCGPCRRLKSQLTREGIPFEEIDVERDPKAAEFVMSVNNGNRVVPTVVADCHVMTNPSIAEIKRHLEGACQ
    AA

    >gi|296270941|ref|YP_003653573.1| UBA/THIF-type NAD/FAD binding protein [Thermobispora bispora DSM 43833]
    MSLPPLVEPAAELTVDEVRRYSRHLIIPDVGMTGQKRLKNAKVLCVGAGGLGSPALMYLAAAGVGTLGIIDFDVVDESNL
    QRQVIHGQSDVGRPKVESAAARVREINPFVNVVVHNTSLTTDNVMEIFSGYDLIVDGTDNFATRYMVNDAAVLLGKPYVW
    GSIYRFDGQASVFWAEHGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASIGAIQVNEAIKLITGIGEPLVGRLMIYDALE
    MKYRDVKVRKDPECAICGKNPTITELIDYETFCGALSDEAQRAAADATITAQELKAMLDRGEDIMLIDVREPNEYEICSI
    PGAVLIPKGEFLNGSALERLPQDKKIVLH
    CKSGGRSAEVLAVLKNAGFSNAVHVGGGILSWIKNVDPSLPEY

    >gi|296271305|ref|YP_003653937.1| heavy metal transport/detoxification protein [Thermobispora bispora DSM 43833]
    MSVKTYTVVGMTCGHCVASVKEEVGEIPGVTGVEVDLATGRLDVTGEGVSDEAVRRAVEEAGYRLG

    >gi|296271345|ref|YP_003653977.1| hypothetical protein Tbis_3394 [Thermobispora bispora DSM 43833]
    MTATGQDGRTKVDFYFDPVCPFAWITSRWILEVEKHRDIDLRFRVMSLSVLNEGRDVPEEYRELLQRAWGPVRVCAAAAV
    HHGEAVLRDLYTALGTRIHNQNNKDFDAVVKESLAEIGLPLELAEAANSTEYDEALRKSHHEGMDPVGLDVGTPTIHVNG
    VAFFGPVLTKIPRGEEAVRMFDATVALASYPYFFELKRTRTGELDFS

    >gi|296271499|ref|YP_003654131.1| DSBA oxidoreductase [Thermobispora bispora DSM 43833]
    MRIDVWSDIVCPWCYLGKRRLERALAEFEHADRVEVVWRSFQLDPGYPVGTREPVYQSLAKKMGLPLKQVRAMTDRVKAL
    AAEEGLAYDFDRAVMVNTFAAHRLTHLAKAHGLGAEMHERLMRAQLCEGRVLDDPETLAELAAEVGVPADEARRVLAGDE
    YTREVEEDIRQARELGVTGVPFFVFDNAYGIAGAQSSEMLLQALRTVHGNATAGTTATPA

    >gi|296271527|ref|YP_003654159.1| thioredoxin reductase [Thermobispora bispora DSM 43833]
    MSDVRNVIIIGSGPAGYTAALYTARADLKPLVFEGSVTAGGALMNTTEVENFPGFPDGIMGPELMDNMRKQAERFGAELV
    ADDVVEVDLLADPKVVKTYTAAYHAKAVILAMGSQYRELGLESEKRLSGRGVSW
    CATCDGFFFRDQDIAVVGGGDSAMEE
    AIFLTRFAKSVTVIHRRDTLRASKIMQDRAFANEKIRFLWNSQVVDILGEDRVTGVRVRNVHTGEETELQVTGVFIAIGH
    EPRSALVKGQVALDEQGYIIVDSPTTRTNIEGVFAAGDVVDHTYRQAITAAGTGCAAALDAERWLAERA

    >gi|296271528|ref|YP_003654160.1| thioredoxin [Thermobispora bispora DSM 43833]
    MGAIKEVTDATFQDEVLKSDKPVLVDFWAPWCGPCRQIAPILEEIANEYADKLTVVKMNIDENMETPRNYGVLQIPTLNV
    YRNGEVVRQIIGAKPKSMLLRELEGII