Thermobifida fusca YX uid57703

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|72160576|ref|YP_288233.1| thioredoxin [Thermobifida fusca YX]
    MPRMRNKAAASTAVQGRRPLLTPRSGEPVATIELTKDNFNQTLEENDFVLIDFWASWCGPCKMFAPIFERASERHKDLVF
    AKVDTEAQQELAASFNIQSIPTLMIVRDRTVLYAQPGALPEAALEDLIQQARDLDMDEVRRQIAEQQGNGQASE

    >gi|72160758|ref|YP_288415.1| 3-mercaptopyruvate sulfurtransferase [Thermobifida fusca YX]
    MARSESAASPSFPVIVTADWLRAHADEVILADVRWYLDGRSGRQAYRDGHLPGAVFVDVDTDLAAPPSPAGGRHPLPDPA
    DFAAALSRLGIGDGSVVVAYDDAGGSTAARLVWMLRVLGTRAALLDGGLQAWPGPLETGDVTAEPRTRTPVPWPADRVVD
    TDTVRQELGEPGRLLLDARTFGRFTGEQPAPVDARPGHIPGARSASWQDNLDDTGRFAPPDVLQARFRALGVDTATSVTV
    Y
    CGSGVTACHDLLALEHAGFPDARLYPGSWSAWGADESLPVQTGE

    >gi|72160770|ref|YP_288427.1| methylated-DNA (protein)-cysteine S-methyltransferase [Thermobifida fusca YX]
    MRCRAENSLSPPLPHRRTPDTGTSTPAPRTHQGVIVTAEIPARARVHTVVDSPLGPLTLVAADGALVGLYQEDQRHRPAP
    DSFGVPDPAPFTEVIAQLTEYFSGQRTVFDLPLAFTGTPFQTTVWRALLEIPYGQTVSYGELAARIGKPSASRAVGLANG
    RNPISIIVP
    CHRVVGSSGSLTGYGGGLARKQWLLALEQRRAHQPPLLDFADGLDAGEPRSATLPMGSHHSA

    >gi|72160855|ref|YP_288512.1| hypothetical protein Tfu_0451 [Thermobifida fusca YX]
    MPNRLAHATSPYLLQHADNPVDWYPWGEEAFAEARRRDVPILLSIGYAACHWCHVMARESFADEQTAQIMNANFVNVKVD
    REERPDVDAVYMEATQAMTGHGGWPMTVFATPDGEPFYCGTYFPREHFQRLLLGISHAWRTDRTGVVGQGKRVAEALSAP
    RTLPSGPPPSAQVLEQAVARLAAEYDTVNGGYGTAPKFPPSPVMEFLLRHHARVSDGAETEALRMVRHTAEAMARGGIYD
    QLAGGFARYAVDATWTVPHFEKMLYDNALLLRCYTHLWRQTGDELARRVAVETADWMVAELRTAEGGFASALDADSEGEE
    GRYYVWTPAQLRDVLGEEDGAWAAELFGVTEQGTFERGTSVLQLRADPDDRERYAYVRDRLRKARANRVPPARDDKVVTG
    WNGLAIAGLAEAGALLDRPDLVERAREAARLVVERHYADGRLVRVSRDGVPGTSAGVLEDYANLAEGLLALHAVTGEIRW
    VGVCGELLETVLTRFTDGSGGFYDTADDAEALFNRPREFTDDATPSGWSAAAGALLSYAALTGSFRHREAAEAALGVVST
    LAEKTPRFAGWGMAVAEALLAGPVEIAVVGPKGDPVAEELHRTALLATTPGTVVSRGDGVNDGGIGLLEGRTLVDGRPAA
    YVCRNFTCRLPATTTEELTAELARA

    >gi|72160924|ref|YP_288581.1| molybdopterin biosynthesis-like protein MoeZ [Thermobifida fusca YX]
    MSLPPLVEPADELTIDEVQRYSRHLIIPDVGMDGQKRLKNAKVLVVGAGGLGSPTLMYLAAAGVGTLGIIDFDVVDESNL
    QRQVIHGQSDIGKPKAESARETIEEINPFVKVVLHKERLDSSNALEIFADYDLILDGTDNFATRYLVNDAAVLLNKPYVW
    GSIFRFDGQVSVFWNEYGPNYRDLYPEPPPPGMVPS
    CAEGGVLGVLCATIGSVMANEAIKLITGIGDPLVGRLLIYDALE
    MTWRTVKIRKDPNAEPITELIDYEAFCGTIPEEAQEAARGSTITAKELKEKMDRGEDFFLVDVREKNEYEIVNIPGAVLI
    PKGEFLTGEAFAKLPQDKQIILH
    CKSGGRSAEALAAVKKAGFSDAVHVGGGILSWIETVDPSLPKY

    >gi|72160933|ref|YP_288590.1| glutaredoxin-like protein GlrX [Thermobifida fusca YX]
    MATSTGAQITMYTTPWCGFCKRLKSQLDREGIPVVEVDIERDPKAAEFVMQVNGGNQTVPTVVFADGTALTNPSLAEVKQ
    KLAAQS

    >gi|72161101|ref|YP_288758.1| putative ATP/GTP binding protein [Thermobifida fusca YX]
    MALVSHAHTVWEGTLFEGSGTVFFDSSNLPQQKVTWKARAEEHGGLTSPEELIAAAHSSCFSMALSNALAKAGTPAKSLH
    TEAQVTFQPGEGIKGIHIVVRGEVPGISADDFVKAAEGAKEN
    CPVSKALAATPITLDAALK

    >gi|72161355|ref|YP_289012.1| putative metal-binding protein [Thermobifida fusca YX]
    MASTTITVTGMTCGHCVSSVKEEISELPGVTDVRVDLESGRVEIDSTAPLSDEQIRAAVAEAGYEVVA

    >gi|72161398|ref|YP_289055.1| dihydrolipoamide dehydrogenase [Thermobifida fusca YX]
    MSESGGTFDLVILGGGSGGYSAAIRASELGMRVALIEKDKLGGTCLHYGCIPTKALLHAGEVADTVRASEKFGVRASFDT
    IDMARVHEYKDKVVSGLHRGLTGLIKARGITLVEGEGKLTGVDEVTVNGVAYKGRHIILATGSQARSLPGLEIDGERIIT
    SYEALRLDRVPKSAIILGGGVIGVEFASVWRSFGAEVTIVEALPHLVPAEEESSSKLLERAFRKRGIKFELGSPFESVKL
    TETGVSMTLASGKTVEGELLLVAVGRGPVSQGLGYEEVGIRLERGFVQVDENLHTGVGNIYAVGDLIPTPQLAHVGFAEG
    IFVAEHIAGLNPVNIDYDGIPRVTYSDPEVASVGITSKTAAERGIETTEFVYNLAGNGKSQILQTQGAVKVIAAKDGPVL
    GVHMVGSRVGELITEGQLIYNWEALPSEVAQLIHAHPTQSEALGEAHLALAGKPLHVHD

    >gi|72161415|ref|YP_289072.1| HesB/YadR/YfhF [Thermobifida fusca YX]
    MTAETDATTQGVTLTDAAVEKVKSLLAQEGRDDLRLRLGVAPGGCSGLRYQLYFDERTLDGDIITDHNGVELAVDRYSMP
    YLMGATIDFVDTIEKQGFTIDNPSAQNSCACGDSFH

    >gi|72161671|ref|YP_289328.1| frnE protein [Thermobifida fusca YX]
    MSAPDRAVTVEVWSDVVCPWCYIGKRRLERALAQFEHADEVEVVWRSFQLDPTFPAGVRQPVPQMLAEKIGGTLEQVRQM
    NARVTALAAEEGLEYRLEQATMVNTFDAHRLTHLAKAHGKGDAAHERLLRAQLVEAQVLDDADTLVRLGVEIGLPEEETR
    RVVAGDDYAQQVRDDFAAARTLGVRGVPFFALNRAFAVSGAQPVETFVSALRAAYTRARPAPS

    >gi|72161677|ref|YP_289334.1| putative oxidoreductase [Thermobifida fusca YX]
    MERIVIVGGGLAASRTCEQLRSRGYEGELVMLCAEPHPPYDRPPLSKAALLEEEHDSTFPTDYAQLSVDVRLGVAATGLV
    PDARTVQTTDGELSYDALVIATGASPIRLPGPGRQFTVRTVEDAAQLRAELKPGQRVVLVGASWISAEVATAALRRGCSV
    TCIEAGPAPLSAALGADVGQRFLPWWSEVDLRLDTGVAEVTETGVQLANGEQVDADVVVTGIGVRPAVDWLSGSGIALDT
    GVVVDEHLRTSLPGIYALGDVAVRWSPRWNTRIRVEHWDDAREAARTLAGVLLHDPSSQDPLPVHDPVPYFWSDQFGHKI
    QYVGHHSPEDTLVIRGDGTPQWAAAWVDAEGRLTAHLSIDAPRLMIDARMAIAAGARPDEAALRDPQAKLAPPRGR

    >gi|72161909|ref|YP_289566.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Thermobifida fusca YX]
    MREEPLEQQLADLAVDAPADLIDRIVARWVTVESPIGELFVAYTDHGIAYVRRHGAEAAEEFRRRFQRPLVRAPRPPAGL
    VSALRRGRSSTLTFDLRGLSDFQVAVLRATRTIPRGEVRPYAWIAQKINRPRAVRAVGTALATNPVPVLIP
    CHRVVRSDG
    SPGEYIFGAEVKHRLLHDEGTNLEELHTLARRGIFYVASDTTGIVCHPTCRHARRITPPHRKGFRTFAEAAAAGYRPCQH
    CQPAPTVATPAPGLSRDEER

    >gi|72161923|ref|YP_289580.1| glutaredoxin family protein [Thermobifida fusca YX]
    MGFGCRPAFLSGCAGPAGVVGVGMMVGMEIWVNPACSKCRSALSLLDAEGVRYTVRRYLEDPPTAAEVEEVLGKLGLEPW
    DITRLGERQARELGMAEWPRTVEERGRWISALVAHPVLIQRPIITAEERAVVGRSEEAVRQMLEE

    >gi|72161925|ref|YP_289582.1| protein-disulfide isomerase [Thermobifida fusca YX]
    MRPALWRRRWRPVVVVRPSCCCGWSRRCVEWRVSQVVGEVRGESGRGWGRGYVVVAVVLLLVAVAAGVWVGWGGRGAESD
    SRPGDGAVAGSASPPVVAGPVPPQVDPELVLGRSDAPVTMVVFSDYQ
    CPYCARFALEQQPVLVERYVETGQVRLVWRDYP
    YLGEESVRAAVAARAAGRQGRYWDYHEALYESSEVWRAAGASRESLVEVAATIGLDTDQFAVDLADPVLREAVEEDFAFA
    LGLGVPGTPAFLIDGEAFFGAQPVERFAERLDEALGKRG

    >gi|72162292|ref|YP_289949.1| methionine sulfoxide reductase B [Thermobifida fusca YX]
    MSEQNPPVQRSEEEWRAILDPEAFAVLRLGATEPPWSGEYVSTTAQGVYRCRACGAELFRSEHKFDAQCGWPSFYDPVDS
    SAVTLHEDLSHGMVRTEVRCARCGSHLGHVFYGEGYPTPTDARY
    CINSIALTLEAEDTVE

    >gi|72162363|ref|YP_290020.1| putative thiol-specific antioxidant protein [Thermobifida fusca YX]
    MPIEVGQNAPDFELADQHGQTVRLSDFRGRSRVAVVFYPLAFSGICDKELRQLHECMSEFTARSVQPLAISVDSMFAHRV
    WADREGVDFPLLSDFWPHGAVAQRYGVFDETKGVALRGSFLIDTEGVVRWKVVNPTFQGRDMDDYRQAFADLGWNP

    >gi|72162602|ref|YP_290259.1| hypothetical protein Tfu_2203 [Thermobifida fusca YX]
    MTQERIPVDLWFDPLCPWAWITSRWLLEVEKVRPVRPRWHVMSLAVLNEGKDVPEEYRKMLATEAWWGVRVAVAVEQRSG
    NEELGRFYTALGTRLHNRREPRSLETIAAALADVGQPADLIEAAESTDYDEALRKSHHDGMDRVGQEVGTPVIAVEDVAF
    FGPVVSPAPRGEAAGRLWDGVLLVAGTDGFFELKRSRTRDPIFD

    >gi|72162759|ref|YP_290416.1| bacterioferritin comigratory protein [Thermobifida fusca YX]
    MSENTIRLHPGDIAPDFTLNSASGASVTLSEVLKDHDRVVVYFYPAAMTPGCTTQACDFRDNLHDFNKAGLTVLGISPDS
    LTRLAKFAEQEGLTFPLLSDPDRSVMTSYGAFGEKKNYGRIVQGVIRSTFVISAGRTVERAYYNVRATGHVERLKRDLGL


    >gi|72163077|ref|YP_290734.1| methionine sulfoxide reductase A [Thermobifida fusca YX]
    MFGFVKTDMVDPAKALPGRDTPMPVPERHEVLGTPLAPPYPEHAQLADFGMGCFWGVERIFWRLGAENGIITTAAGYAGG
    YTPNPTYEEVCTGRTGHAEVVRVVFDPERISYTDLLKVFWENHDPTQGMRQGNDVGTQYRSIILYHNEEQRAAAEASRDA
    FQPVLTRMGYGPITTEIVPATPFYFAEPYHQQYLSEAKNPHGYCGVSGTGATCPVGVARTSG

    >gi|72163103|ref|YP_290760.1| hypothetical protein Tfu_2704 [Thermobifida fusca YX]
    MPFTRPGPRVRAAALRGLAAVAVLAALAGCAEEIDTGAATEDDRYISGDGSSTLFPSEDREQAPAVEGETLDGDPVSLAD
    YSGDVVVMNFWASW
    CAPCRAETPVLNEVNAEHADQGVSFLGVNIKDNRTAAQAFERNQDVSYPSLYDQSGEIPQAFRDTV
    PPQAIPSTLVIDRQGRIAARVIGATNYKELTELVSTVAAEDADVQ

    >gi|72163118|ref|YP_290775.1| thiosulfate sulfurtransferase [Thermobifida fusca YX]
    MSRADVLVDADWVEAHLDDPNVVIVEVDEDTSAYDKGHIRNAIKLDWRKDLQDPVRRDFVDKAGFEALMSERGIANDHTV
    VLYGGNNNWFAAYAYWYFKLYGHEKVRLLDGGRKKWELDSRELVTEVPERPKTNYVAKEQDTSIRAFRDEVVDAIGKKAL
    VDVRSPDEFVGKLLAPAHLPQEVSQVPGHIPTARNVPWAKVVNEDGTFKSDEELRKLYEEAGVDLDKEIIAY
    CRIGERSS
    IAWFALHELLGLPNVKNYDGSWTEYGSLVGVPVELGEAK

    >gi|72163134|ref|YP_290791.1| putative redoxin [Thermobifida fusca YX]
    MASASNHAKKSDNPHVVTMLGKAGCHLCEEALAVIARVCAETGARYEVRDLTTADDKEKEEYWDKIPVIFVDGKQHDFWR
    VNEQRLRAALLEERA

    >gi|72163158|ref|YP_290815.1| glutathione peroxidase [Thermobifida fusca YX]
    MTLPNSLCRIACATILGPRGSEHGTVRHAARQDSPVGSSDGQGAEARLRDMKIYQSELRTLEGEPFRLPQTQLLLIVNVA
    SK
    CGLTPQYSGLERLQEAYAYRGFSVIGVPCNQFGGQEPGDAQEIRLFCATTYGISFPILEKMEVNGPNRHPLYVELTKA
    RDSQGLAGDVQWNFEKFLVAPGGRVLYRFRPQVEPEDPEIIRAIEENLPN

    >gi|72163169|ref|YP_290826.1| thioredoxin [Thermobifida fusca YX]
    MSAMATIELTKENFNETVTGSDMVLVDFWASWCGPCRMFAPVYERVAARHDDIVFGKVNTETEQELAAAFRISSIPTLMV
    IREGVVVFSQAGAIPEQALEALIADARKLDMDEVRRKIAEQSAKA

    >gi|72163247|ref|YP_290904.1| ATPase, E1-E2 type:copper-translocating P-type ATPase:heavy metal translocating P-type ATPase [Thermobifida fusca YX]
    MGEEATRRRDAERVELLIGGMTCASCANRVERKLNKLAGVRASVNYATEKASVEFDSGVTIDDLITTVEKAGYTAALPAP
    PCAAQDTEDQAADPVAALRTRLLVSAVLSIPVIAMAMIPALQFTYWQWASLVLAAPVVVWGALPFHIAAVKNLRLGEATM
    DTLVSMGTLAAFAWSLYALFFGEAGMPGMTHPFEFTISRTDGSAAIYLEVAAGVTTFILAGRYFEARAKRRAGAALRALL
    ELGAKEVTVVRGGRETRIPVEQLAVGDRFVVRPGEKIATDGVVEEGASAVDASMLTGESVPVEVGVGDAVVGATVNVGGR
    LVVRATRVGADTQLAQMAKLVEEAQSGKAEVQRLADRISGVFVPVVIALAVATLGFWLGAGGPVEAAFTAAVAVLIIACP
    CALGLATPTALLVGTGRGAQLGILIKGPEVLENTRRVDTVVLDKTGTVTMGTMALVDVAAADGEDADEVLRLAGAVEHAS
    EHPIARAIARSAADRVGNVPPVTDFAATAGLGVRGVVDGRTVLVGKAALLAQEGVAVPEAVARKAAQAEAAGHTAVLAAW
    DGKARGVLVVADTVKPTSAEAVAQLRQLGLTPILLTGDNAAVARTVAEQVGIDEVIAEVLPADKVDVVKRLQDEGRVVAM
    VGDGVNDAAALAQADLGLAMGTGTDAAIEAADLTLVRGDLRVAADAIRLSRRTLATIKGNLFWAFAYNVAALPLAAAGLL
    NPMIAGAAMAFSSVFVVSNSLRLRGFRPHAAP

    >gi|72163323|ref|YP_290980.1| hypothetical protein Tfu_2924 [Thermobifida fusca YX]
    MERVLVIKATAGEDAPERCNQAFTVAAAAVASGVRVSLWLTGEASWLAVPGRAEQFSLPHATPLNELLDVVLSSGQVTVC
    SQCAARRSLTEEDLIEGVRIAGAPTFVEEVMAEGAQALVY

    >gi|72163394|ref|YP_291051.1| hypothetical protein Tfu_2995 [Thermobifida fusca YX]
    MGADTSNKPEFKRSPSHFVDRITADGSEGWPVEAGRYRLIVSRACPWANRAMIARRLLGLESAISLAVADPIQDERSWRF
    TLDPDGRDPVLGIRFLAEAYYARDPEYTGGISVPAIVDIPSGKLVTNDYLHIPANFATEWRSLHREGAPDLYPEPLRDEI
    DEISEVIFRDVNNGVYVCGFARTQQTYERAFTALFTRLDALSERLSRQRYLVGDSITVADIALFVTLVRFDAVYHGHFKC
    NRNKLTEMPVLWAYARDLFQTPGIGDTVDFDHIKRHYYVVHRDINPSGIVPLGPDLSGWLTPHGREELGGRPFGDGTPPG
    PPPEAERIPAQW

    >gi|72163457|ref|YP_291114.1| rhodanese-like [Thermobifida fusca YX]
    MSGVSIPVVEVSAVPENGYLLDVREEDEWRAGHAPNAVHIPLGQLAERAAEIPKDTQVYVLCRVGGRSARAVQALNEAGW
    RAANVAGGMSAWALARRPMVSETGEPPVVL

    >gi|72163482|ref|YP_291139.1| rhodanese-like protein [Thermobifida fusca YX]
    MDTSLPVSLTPEEVRELQERNPRVRIIDVRTPGEFAGMHIPGSYNVPLDLLREHQRELTANHDDPVVLVCRSGMRADQAS
    KLMAESGLRQVSVLQGGISEWERTGAPLKRGSGGRWAMERQVRLVAGLIVLVFVTASAVFDPLKWVAAAIGAGLTFAAIT
    DTCLMARLLALLPYNRTDRCDAPTMLAALTGTTPAQRG

    >gi|72163484|ref|YP_291141.1| rhodanese-like protein [Thermobifida fusca YX]
    MLFTQYYLDCLSHASYMVADETTGKAIVVDPRRDVTEYLADAEEKGLTIEGVINTHFHADFIAGHLELAERTGAWIGYGS
    RAEAEYPIRKLADGERIVLGDVVLEIMETPGHTPESISILVYEHADDPVPYGVLTGDALFIGDVGRPDLLASLGYTAEEL
    GRMLYDSVQHKLMGLHDDVRVFPAHGAGSACGKNLSTERWSTIGEQRRTNYACRPMDEETFVSLVTAGQPSAPSYFAYDA
    VLNRKQREVLDIDTLVVALSADDFLAQRAAGAVVVDSRDPQEYATGHLRGALNIPVNGRFAETAGSVLKPGTPLLVVAPE
    GQEEETLVRLARVGFDTARGYLPEPENVFVTIPDEMQSSSRLTAVALTERLRDAEPPVVLDVRNQGERDQGAIPDSLHIP
    LAELPKRLDEVPKDRPVVVY
    CASGYRSSVAASLLRAEGLTDVSDLLGGYTAFEALQQTV

    >gi|72163507|ref|YP_291164.1| thioredoxin reductase [Thermobifida fusca YX]
    MSDVRNVIIIGSGPAGYTAAIYAARAELKPLVFEGAITAGGALMNTTEVENFPGFPDGIMGPELMDNMRKQAERFGAELV
    PEDVTEVDLTANPKVVKAGDQTFYARAVIVATGSGYRKLGVPGEEEFSGRGTSW
    CATCDGFFFRDQDIAVVGGGDSAMEE
    AIFLTRFARSVTVIHRRDQLRASKIMQERAFANEKISFLWNTEVVEILGDTRVHAVRLRNRVTGEESTLNISGLFIAIGH
    DPRVELFKGQLELDEQGYLKVDSPTTHTNIPGVFACGDVVDHRYRQAITAAGSGCAAALDAERYLTEEAG

    >gi|72163508|ref|YP_291165.1| thioredoxin [Thermobifida fusca YX]
    MATIQNVTDDTFEEVVLKSKLPVLVDFWAEWCAPCKMIAPVLEQIAEEQEGKLTVVKINADQNPDTVRQYGVMGLPTLNL
    YKNGEVVKQLVGAKPKRVIEKELEEFL